4EDRA

The structure of the s. aureus dnag rna polymerase domain bound to utp and manganese
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
321
structure length
321
Chain Sequence
SNADDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERGFTDALIKERGIGFAPDSSHFCHDFLQKKGYDIELAYEAGLLSRNEENFSYYDRFRNRIMFPLKNAQGRIVGYSGRTYTGQEPKYLNSPETPIFQKRKLLYNLDKARKSIRKLDEIVLLEGFMDVIKSDTAGLKNVVATMGTQLSDEHITFIRKLTSNITLMFDGDFAGSEATLKTGQHLLQQGLNVFVIQLPSGMDPDEYIGKYGNDAFTTFVKNDKKSFAHYKVSILKDEIAHNDLSYERYLKELSHDISLMKSSILQQKAINDVAPFFNVSPEQLANEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primase
publication title Binding Mechanism of Metal-NTP Substrates and Stringent-Response Alarmones to Bacterial DnaG-Type Primases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 114
structure length 321
sequence length 321
ec nomenclature ec 2.7.7.-:
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08275 Toprim_N DNA primase catalytic core, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.20 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 4edrA03
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 4edrA02
3.90.980.10 Alpha Beta Alpha-Beta Complex DNA primase DNAg catalytic core, N-terminal domain DNA primase, catalytic core, N-terminal domain 4edrA01
4EDKA 4E2KA 3VDUA 2Q2EA 3VE5A 4O6OA 4EDVA 1D3YA 4O6PB 4EDTA 3B39A 1DDEA 1EQNA 4EE1A 1VDDA 2V1CA 4EDRA 2AU3A 5GUJA 3VDPA 1T6T1 1DD9A 4JCVA 4EDGA 2ZBKA
chains in the Genus database with same CATH superfamily
2NSWA 4EDKA 2ERLA 4E2KA 3VDUA 2Q2EA 3VE5A 2B39A 4O6OA 2I5RA 3KLSA 3CU7A 2KC6A 2ZBKA 4EDVA 1D3YA 4O6PB 3B39A 1DDEA 1EQNA 4EDGA 4EE1A 1VDDA 1ERCA 2V1CA 2KK2A 2JMSA 4EDRA 2AU3A 5GUJA 3VDPA 3KXRA 1T6T1 2FCJA 1DD9A 2LMKA 4JCVA 2NSVA 4EDTA
chains in the Genus database with same CATH topology
2NSWA 4EDKA 2ERLA 4E2KA 3VDUA 2Q2EA 3VE5A 2B39A 4O6OA 3KLSA 3CU7A 2KC6A 2ZBKA 4EDVA 1D3YA 4O6PB 3B39A 1DDEA 1EQNA 4EDGA 4EE1A 1VDDA 1ERCA 2V1CA 2KK2A 2JMSA 4EDRA 2AU3A 5GUJA 3VDPA 3KXRA 1T6T1 1DD9A 2LMKA 4JCVA 2NSVA 4EDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EDK A;  4E2K A;  3VDU A;  2Q2E A;  3VE5 A;  4O6O A;  4EDV A;  1D3Y A;  4O6P B;  4EDT A;  3B39 A;  1DDE A;  1EQN A;  4EE1 A;  1VDD A;  2V1C A;  4EDR A;  2AU3 A;  5GUJ A;  3VDP A;  1T6T 1;  1DD9 A;  4JCV A;  4EDG A;  2ZBK A; 
#chains in the Genus database with same CATH topology
 2NSW A;  4EDK A;  2ERL A;  4E2K A;  3VDU A;  2Q2E A;  3VE5 A;  2B39 A;  4O6O A;  2I5R A;  3KLS A;  3CU7 A;  2KC6 A;  2ZBK A;  4EDV A;  1D3Y A;  4O6P B;  3B39 A;  1DDE A;  1EQN A;  4EDG A;  4EE1 A;  1VDD A;  1ERC A;  2V1C A;  2KK2 A;  2JMS A;  4EDR A;  2AU3 A;  5GUJ A;  3VDP A;  3KXR A;  1T6T 1;  2FCJ A;  1DD9 A;  2LMK A;  4JCV A;  2NSV A;  4EDT A; 
#chains in the Genus database with same CATH homology
 2NSW A;  4EDK A;  2ERL A;  4E2K A;  3VDU A;  2Q2E A;  3VE5 A;  2B39 A;  4O6O A;  3KLS A;  3CU7 A;  2KC6 A;  2ZBK A;  4EDV A;  1D3Y A;  4O6P B;  3B39 A;  1DDE A;  1EQN A;  4EDG A;  4EE1 A;  1VDD A;  1ERC A;  2V1C A;  2KK2 A;  2JMS A;  4EDR A;  2AU3 A;  5GUJ A;  3VDP A;  3KXR A;  1T6T 1;  1DD9 A;  2LMK A;  4JCV A;  2NSV A;  4EDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...