2ERLA

Pheromone er-1 from
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
DACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATING PHEROMONE ER-1
publication title A challenging case for protein crystal structure determination: the mating pheromone Er-1 from Euplotes raikovi.
pubmed doi rcsb
molecule tags Pheromone
total genus 14
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1995-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06360 E_raikovi_mat Euplotes raikovi mating pheromone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.10 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 2erlA00
1ERCA 2ERLA
chains in the Genus database with same CATH superfamily
2JMSA 1DD9A 2NSWA 2LMKA 4EDTA 4EDGA 2KC6A 3KLSA 2ERLA 3CU7A 4EE1A 2B39A 1ERCA 1DDEA 4EDVA 2NSVA 1EQNA 4EDRA 2AU3A 3B39A 4E2KA 3KXRA 4EDKA 2KK2A
chains in the Genus database with same CATH topology
2JMSA 1DD9A 2NSWA 2LMKA 4EDTA 4EDGA 2KC6A 3KLSA 2ERLA 3CU7A 4EE1A 2B39A 1ERCA 1DDEA 4EDVA 2NSVA 1EQNA 4EDRA 2AU3A 3B39A 4E2KA 3KXRA 4EDKA 2KK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERC A;  2ERL A; 
#chains in the Genus database with same CATH topology
 2JMS A;  1DD9 A;  2NSW A;  2LMK A;  4EDT A;  4EDG A;  2KC6 A;  3KLS A;  2ERL A;  3CU7 A;  4EE1 A;  2B39 A;  1ERC A;  1DDE A;  4EDV A;  2NSV A;  1EQN A;  4EDR A;  2AU3 A;  3B39 A;  4E2K A;  3KXR A;  4EDK A;  2KK2 A; 
#chains in the Genus database with same CATH homology
 2JMS A;  1DD9 A;  2NSW A;  2LMK A;  4EDT A;  4EDG A;  2KC6 A;  3KLS A;  2ERL A;  3CU7 A;  4EE1 A;  2B39 A;  1ERC A;  1DDE A;  4EDV A;  2NSV A;  1EQN A;  4EDR A;  2AU3 A;  3B39 A;  4E2K A;  3KXR A;  4EDK A;  2KK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...