3B39A

Structure of the dnag primase catalytic domain bound to ssdna
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
319
structure length
317
Chain Sequence
NAHQRQTLYQLMDGLNTFYQQSLQQPVATSARQYLEKRGLSHEVIARFAIGFAPPGWDNVLKRFGGNPENRQSLIDAGMLVTNDRSYDRFRERVMFPIRDKRGRVIGFGGRVLGNDTPKYLNSPETDIFHKGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYAVASLGTSTTADHIQLLFRATNNVICCYDGDRAGRDAAWCALETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKEAFEARMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLISQVPGETLRIYLRQELGNKLGILDDSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*DCP*DAP*DAP*DAP*DGP*DCP*DCP*DAP*DAP*DAP*DAP*DGP*D
publication title Identification of a DNA primase template tracking site redefines the geometry of primer synthesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/dna
total genus 92
structure length 317
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08275 Toprim_N DNA primase catalytic core, N-terminal domain
A PF10410 DnaB_bind DnaB-helicase binding domain of primase
A PF13155 Toprim_2 Toprim-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.20 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 3b39A03
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 3b39A02
3.90.980.10 Alpha Beta Alpha-Beta Complex DNA primase DNAg catalytic core, N-terminal domain DNA primase, catalytic core, N-terminal domain 3b39A01
3VDUA 4E2KA 4EDTA 3VDPA 3B39A 2V1CA 1VDDA 4O6PB 4EDKA 4EE1A 2Q2EA 5GUJA 4EDGA 4EDVA 2AU3A 1DD9A 1DDEA 3VE5A 1EQNA 1D3YA 4EDRA 4JCVA 1T6T1 4O6OA 2ZBKA
chains in the Genus database with same CATH superfamily
3VDUA 4E2KA 4EDTA 3VDPA 3B39A 2NSVA 1ERCA 2V1CA 2B39A 2JMSA 1VDDA 4O6PB 4EDKA 4EE1A 2Q2EA 5GUJA 4EDGA 2KK2A 2NSWA 4EDVA 2AU3A 1DD9A 2LMKA 1DDEA 3VE5A 1EQNA 1D3YA 4EDRA 4JCVA 1T6T1 3KLSA 2FCJA 2ERLA 4O6OA 2KC6A 2I5RA 3CU7A 3KXRA 2ZBKA
chains in the Genus database with same CATH topology
3VDUA 4E2KA 4EDTA 3VDPA 3B39A 2NSVA 1ERCA 2V1CA 2B39A 2JMSA 1VDDA 4O6PB 4EDKA 4EE1A 2Q2EA 5GUJA 4EDGA 2KK2A 2NSWA 4EDVA 2AU3A 1DD9A 2LMKA 1DDEA 3VE5A 1EQNA 1D3YA 4EDRA 4JCVA 1T6T1 3KLSA 2ERLA 4O6OA 2KC6A 3CU7A 3KXRA 2ZBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDU A;  4E2K A;  4EDT A;  3VDP A;  3B39 A;  2V1C A;  1VDD A;  4O6P B;  4EDK A;  4EE1 A;  2Q2E A;  5GUJ A;  4EDG A;  4EDV A;  2AU3 A;  1DD9 A;  1DDE A;  3VE5 A;  1EQN A;  1D3Y A;  4EDR A;  4JCV A;  1T6T 1;  4O6O A;  2ZBK A; 
#chains in the Genus database with same CATH topology
 3VDU A;  4E2K A;  4EDT A;  3VDP A;  3B39 A;  2NSV A;  1ERC A;  2V1C A;  2B39 A;  2JMS A;  1VDD A;  4O6P B;  4EDK A;  4EE1 A;  2Q2E A;  5GUJ A;  4EDG A;  2KK2 A;  2NSW A;  4EDV A;  2AU3 A;  1DD9 A;  2LMK A;  1DDE A;  3VE5 A;  1EQN A;  1D3Y A;  4EDR A;  4JCV A;  1T6T 1;  3KLS A;  2FCJ A;  2ERL A;  4O6O A;  2KC6 A;  2I5R A;  3CU7 A;  3KXR A;  2ZBK A; 
#chains in the Genus database with same CATH homology
 3VDU A;  4E2K A;  4EDT A;  3VDP A;  3B39 A;  2NSV A;  1ERC A;  2V1C A;  2B39 A;  2JMS A;  1VDD A;  4O6P B;  4EDK A;  4EE1 A;  2Q2E A;  5GUJ A;  4EDG A;  2KK2 A;  2NSW A;  4EDV A;  2AU3 A;  1DD9 A;  2LMK A;  1DDE A;  3VE5 A;  1EQN A;  1D3Y A;  4EDR A;  4JCV A;  1T6T 1;  3KLS A;  2ERL A;  4O6O A;  2KC6 A;  3CU7 A;  3KXR A;  2ZBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...