2NSVA

Nmr solution structure of the pheromone en-1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
52
structure length
52
Chain Sequence
NPEDWFTPDTCAYGDSNTAWTTCTTPGQTCYTCCSSCFDVVGEQACQMSAQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mating pheromone En-1
publication title NMR Solution Structures of the Pheromones En-1 and En-2 from the Antarctic Ciliated Protozoan Euplotes Nobilii
rcsb
molecule tags Signaling protein
total genus 9
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2006-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.40 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 2nsvA01
2NSVA 2NSWA 2KC6A 2JMSA 2KK2A
chains in the Genus database with same CATH superfamily
4EDRA 2NSVA 4EDGA 2KC6A 2LMKA 2ERLA 2NSWA 2B39A 1DD9A 4EDVA 2KK2A 4EDTA 3CU7A 1EQNA 2JMSA 4E2KA 3KLSA 3KXRA 1ERCA 4EDKA 1DDEA 3B39A 2AU3A 4EE1A
chains in the Genus database with same CATH topology
4EDRA 2NSVA 4EDGA 2KC6A 2LMKA 2ERLA 2NSWA 2B39A 1DD9A 4EDVA 2KK2A 4EDTA 3CU7A 1EQNA 2JMSA 4E2KA 3KLSA 3KXRA 1ERCA 4EDKA 1DDEA 3B39A 2AU3A 4EE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSV A;  2NSW A;  2KC6 A;  2JMS A;  2KK2 A; 
#chains in the Genus database with same CATH topology
 4EDR A;  2NSV A;  4EDG A;  2KC6 A;  2LMK A;  2ERL A;  2NSW A;  2B39 A;  1DD9 A;  4EDV A;  2KK2 A;  4EDT A;  3CU7 A;  1EQN A;  2JMS A;  4E2K A;  3KLS A;  3KXR A;  1ERC A;  4EDK A;  1DDE A;  3B39 A;  2AU3 A;  4EE1 A; 
#chains in the Genus database with same CATH homology
 4EDR A;  2NSV A;  4EDG A;  2KC6 A;  2LMK A;  2ERL A;  2NSW A;  2B39 A;  1DD9 A;  4EDV A;  2KK2 A;  4EDT A;  3CU7 A;  1EQN A;  2JMS A;  4E2K A;  3KLS A;  3KXR A;  1ERC A;  4EDK A;  1DDE A;  3B39 A;  2AU3 A;  4EE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...