2NSWA

Nmr solution structure of the pheromone en-2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
DIEDFYTSETCPYKNDSQLAWDTCSGGTGNCGTVCCGQCFSFPVSQSCAGMADSNDCPNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mating pheromone En-2
publication title NMR Solution Structures of the Pheromones En-1 and En-2 from the Antarctic Ciliated Protozoan Euplotes nobilii
rcsb
molecule tags Signaling protein
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2006-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.40 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 2nswA00
2NSVA 2JMSA 2NSWA 2KC6A 2KK2A
chains in the Genus database with same CATH superfamily
4EDRA 4EDVA 3KLSA 4EDKA 3B39A 4EDGA 4EE1A 2KC6A 2ERLA 2KK2A 2NSVA 2LMKA 1DD9A 1ERCA 3KXRA 1DDEA 4EDTA 2AU3A 2JMSA 1EQNA 2NSWA 2B39A 4E2KA 3CU7A
chains in the Genus database with same CATH topology
4EDRA 4EDVA 3KLSA 4EDKA 3B39A 4EDGA 4EE1A 2KC6A 2ERLA 2KK2A 2NSVA 2LMKA 1DD9A 1ERCA 3KXRA 1DDEA 4EDTA 2AU3A 2JMSA 1EQNA 2NSWA 2B39A 4E2KA 3CU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSV A;  2JMS A;  2NSW A;  2KC6 A;  2KK2 A; 
#chains in the Genus database with same CATH topology
 4EDR A;  4EDV A;  3KLS A;  4EDK A;  3B39 A;  4EDG A;  4EE1 A;  2KC6 A;  2ERL A;  2KK2 A;  2NSV A;  2LMK A;  1DD9 A;  1ERC A;  3KXR A;  1DDE A;  4EDT A;  2AU3 A;  2JMS A;  1EQN A;  2NSW A;  2B39 A;  4E2K A;  3CU7 A; 
#chains in the Genus database with same CATH homology
 4EDR A;  4EDV A;  3KLS A;  4EDK A;  3B39 A;  4EDG A;  4EE1 A;  2KC6 A;  2ERL A;  2KK2 A;  2NSV A;  2LMK A;  1DD9 A;  1ERC A;  3KXR A;  1DDE A;  4EDT A;  2AU3 A;  2JMS A;  1EQN A;  2NSW A;  2B39 A;  4E2K A;  3CU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...