The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
118
|
structure length |
118
|
Chain Sequence |
AYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEARKNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSQAAVHVSITHTKEYAAAQVVIERL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structures of substrate binding to Bacillus subtilis holo-(acyl carrier protein) synthase reveal a novel trimeric arrangement of molecules resulting in three active sites.
pubmed doi rcsb |
| molecule keywords |
HOLO-(ACYL CARRIER PROTEIN) SYNTHASE
|
| molecule tags |
Transferase
|
| source organism |
Bacillus subtilis
|
| total genus |
36
|
| structure length |
118
|
| sequence length |
118
|
| chains with identical sequence |
B, C
|
| ec nomenclature |
ec
2.7.8.7: Holo-[acyl-carrier-protein] synthase. |
| pdb deposition date | 2000-06-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01648 | ACPS | 4'-phosphopantetheinyl transferase superfamily |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Ribosomal Protein L22; Chain A | 4'-phosphopantetheinyl transferase domain |
#chains in the Genus database with same CATH superfamily 1FTH A; 4MRT A; 4DXE A; 1FTF A; 1F7T A; 2WAT A; 2WDS A; 3NE9 A; 2WAS B; 2BYD A; 1F80 A; 3QMN A; 2WAS A; 3NE3 B; 3NFD A; 4JM7 A; 2C43 A; 3H7Q A; 3NE1 A; 3HYK A; 1FTE A; 1F7L A; 3HQJ A; 2JCA A; 4HC6 A; 2JBZ A; 3GWM A; 2WDO A; 2BDD A; 5CMO A; 2QG8 A; 1QR0 A; 2WDY A; 5CXD A; 2CG5 A; #chains in the Genus database with same CATH topology 3CCQ R; 3DLL P; 1FTF A; 1YJ9 R; 1YJN R; 4WFA P; 1F7T A; 2WAT A; 2WDS A; 3CC2 R; 1Q81 S; 1VQ8 R; 5JVH P; 1F80 A; 1VQM R; 1VQO R; 4WFN P; 3OW2 Q; 3G4S R; 3CD6 R; 2ZJR P; 3PIO P; 3CF5 P; 3CC4 R; 3HYK A; 1VQ4 R; 1VQK R; 4UY8 S; 1Q82 S; 1M1K S; 2D0P A; 5MLC U; 1VQ9 R; 2QG8 A; 3CCS R; 5H1S U; 1JJ2 Q; 1YIJ R; 3CCJ R; 1QVF Q; 3G6E R; 3CXC Q; 1K8A S; 3CCV R; 3QMN A; 3CC7 R; 3J7Z S; 5DM7 P; 1M90 S; 2C43 A; 1YJW R; 3CMA R; 3NE1 A; 3HQJ A; 4IO9 P; 3CCM R; 4IOC P; 5GAG T; 3J7Y T; 1Q7Y S; 4HC6 A; 3GWM A; 2WDO A; 2BDD A; 5CMO A; 5HL7 P; 1YI2 R; 5JVG P; 5DM6 P; 2WDY A; 5CXD A; 2D0O A; 2CG5 A; 1FTH A; 3I56 R; 4DXE A; 1NBW A; 4WF9 P; 3CCR R; 2WAS B; 1KC8 S; 1VQL R; 1VQP R; 1KQS Q; 2QEX R; 2QA4 R; 1FTE A; 5GAH T; 1F7L A; 1VQ6 R; 4IOA P; 3I55 R; 3PIP P; 2JCA A; 1BXE A; 4U67 P; 1YIT R; 1KD1 S; 3CCU R; 2ZJQ P; 1S72 R; 5GAD T; 1QR0 A; 3H7Q A; 3CPW Q; 1VQN R; 4MRT A; 2OTL R; 4WFB P; 1NJI S; 3NE9 A; 2BYD A; 1W2B Q; 1N8R S; 2WAS A; 3NE3 B; 3NFD A; 3G71 R; 4JM7 A; 1VQ5 R; 1VQ7 R; 2OTJ R; 5GAE T; 1K73 S; 3CCE R; 1QVG Q; 2ZJP P; 4WCE P; 1I4J A; 2JBZ A; 3CCL R; 1K9M S; 1Q86 S; 1YHQ R; 4V19 W; 3CME R; #chains in the Genus database with same CATH homology 1FTH A; 4MRT A; 4DXE A; 1FTF A; 1F7T A; 2WAT A; 2WDS A; 3NE9 A; 2WAS B; 2BYD A; 1F80 A; 3QMN A; 2WAS A; 3NE3 B; 3NFD A; 4JM7 A; 2C43 A; 3H7Q A; 3NE1 A; 3HYK A; 1FTE A; 1F7L A; 3HQJ A; 2JCA A; 4HC6 A; 2JBZ A; 3GWM A; 2WDO A; 2BDD A; 5CMO A; 2QG8 A; 1QR0 A; 2WDY A; 5CXD A; 2CG5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...