The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
63
|
sequence length |
202
|
structure length |
202
|
Chain Sequence |
MEIGFTFLDEIVHGVRWDAKYATWDNFTGKPVDGYEVNRIVGTYELAESLLKAKELAATQGYGLLLWDGYRPKRAVNCFMQWAAQPENNLTKESYYPNIDRTEMISKGYVASKSSHSRGSAIDLTLYRLDTGELVPMGSRFDFMDERSHHAANGISCNEAQNRRRLRSIMENSGFEAYSLEWWHYVLRDEPYPNSYFDFPVK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Structure of VanX Reveals a Novel Amino-Dipeptidase Involved in Mediating Transposon-Based Vancomycin Resistance
pubmed doi rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Enterococcus faecium
|
| molecule keywords |
D-alanyl-D-alanine dipeptidase
|
| total genus |
63
|
| structure length |
202
|
| sequence length |
202
|
| chains with identical sequence |
B, C, D, E, F
|
| ec nomenclature |
ec
3.4.13.22: D-Ala-D-Ala dipeptidase. |
| pdb deposition date | 2003-10-03 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01427 | Peptidase_M15 | D-ala-D-ala dipeptidase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Muramoyl-pentapeptide Carboxypeptidase; domain 2 | Muramoyl-pentapeptide Carboxypeptidase; domain 2 |
#chains in the Genus database with same CATH superfamily 1VHH A; 3K7I B; 3D1M A; 3MXW A; 3N1O A; 2WFQ A; 3N1P B; 4F78 A; 4MUS A; 4MUQ A; 4D0Y A; 2VO9 A; 3N1M B; 2WFX A; 3N1F A; 4OX5 A; 2WFR A; 5HNM A; 3K7J B; 4JID A; 3K7H B; 2IBG E; 4OX3 A; 3N1G A; 1LBU A; 3HO5 H; 4OAK A; 2WG4 A; 2WG3 A; 1R44 A; 4C4N A; 3N1R A; 1TZP A; 3M1N A; 4MUR A; 1U10 A; 4NT9 A; 3K7G B; 3N1Q A; 4C4M A; 4MPH A; 4MUT A; 4OXD A; #chains in the Genus database with same CATH topology 1WC8 A; 1VHH A; 3K7I B; 3D1M A; 3MXW A; 3KXC A; 3N1O A; 2BJN A; 2WFQ A; 3N1P B; 4F78 A; 2J3R A; 2J3T A; 4MUS A; 4MUQ A; 3NJC A; 2VO9 A; 4D0Y A; 2C0J A; 3N1M B; 2WFX A; 3N1F A; 4OX5 A; 2CFH A; 2WFR A; 5HNM A; 2OSO A; 3KXC C; 3K7J B; 2J3R B; 4JID A; 2J3T B; 3K7H B; 2IBG E; 4OX3 A; 3CUE D; 3N1G A; 1LBU A; 2OSD A; 3HO5 H; 2C0J B; 4OAK A; 1WC9 A; 2WG4 A; 2WG3 A; 1R44 A; 4C4N A; 2CFH C; 2J3W D; 3CUE B; 3N1R A; 1TZP A; 3M1N A; 2J3W B; 4MUR A; 1U10 A; 4NT9 A; 3K7G B; 1SZ7 A; 3N1Q A; 4MPH A; 4C4M A; 4OXD A; 4MUT A; 2PWN A; #chains in the Genus database with same CATH homology 1VHH A; 3K7I B; 3D1M A; 3MXW A; 3N1O A; 2WFQ A; 3N1P B; 4F78 A; 4MUS A; 4MUQ A; 4D0Y A; 2VO9 A; 3N1M B; 2WFX A; 3N1F A; 4OX5 A; 2WFR A; 5HNM A; 3K7J B; 4JID A; 3K7H B; 2IBG E; 4OX3 A; 3N1G A; 1LBU A; 3HO5 H; 4OAK A; 2WG4 A; 2WG3 A; 1R44 A; 4C4N A; 3N1R A; 1TZP A; 3M1N A; 4MUR A; 1U10 A; 4NT9 A; 3K7G B; 3N1Q A; 4C4M A; 4MPH A; 4MUT A; 4OXD A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
