4F78A

Crystal structure of vancomycin resistance d,d-dipeptidase vanxyg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
251
Chain Sequence
GMMKTIELEKEEIYCGNLLLVNKNYPLRDNNVKGLVPADIRFPNILMKRDVANVLQLIFEKISAGNSIVPVSGYRSLEEQTAIYDGSLKDNGEDFTRKYVALPNHSEHQTGLAIDLGLNKKDIDFIRPDFPYDGICDEFRRAAPDYGFTQRYARDKEEITGISHEPWHFRYVGYPHSKIMQENGFSLEEYTQFIKAYLEDNKYLFEQAHRAEIEIYYVPAKDDKTLIKIPENCVYQISGNNIDGFVVTIWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D,D-dipeptidase/D,D-carboxypeptidase
publication title Structural basis for the evolution of vancomycin resistance D,D-peptidases.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Hydrolase
total genus 71
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02557 VanY D-alanyl-D-alanine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.180 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f78A01
3.30.1380.10 Alpha Beta 2-Layer Sandwich Muramoyl-pentapeptide Carboxypeptidase; domain 2 Muramoyl-pentapeptide Carboxypeptidase; domain 2 4f78A02
1U10A 3K7JB 4JIDA 4C4MA 2WG4A 4D0YA 3N1OA 2WFXA 3HO5H 1LBUA 3N1RA 1VHHA 3N1PB 3N1FA 4MURA 4OX3A 4C4NA 5HNMA 2WFRA 2WFQA 2WG3A 3D1MA 3MXWA 4MUSA 4OX5A 3K7HB 4OAKA 1R44A 3N1GA 4F78A 2IBGE 4MUTA 2VO9A 3N1QA 3K7GB 4MUQA 3M1NA 4MPHA 4OXDA 3N1MB 4NT9A 1TZPA 3K7IB
chains in the Genus database with same CATH superfamily
4AAYA 1K9AA 5E1SA 4P5ZA 5HLNA 1W0XC 2JKOA 3ZEPA 1H1WA 4EBVA 4FTIA 3PRFA 4X2GA 3ZFXA 5HNBA 4N4SA 4O0VA 4BTMA 4M68A 3CQUA 2VX1A 3GCVA 3F2NA 1MRUA 4GV1A 3PA4A 3LCOA 4LYNA 5E91A 1QPDA 4F7SA 3AC2A 4GT4A 2V7OA 2VD5A 1ZYJA 2C3LA 2ETRA 3QALE 3T9TA 2IWIA 4FV6A 4X3FC 3QD3A 3LMGA 2VNWA 4IB0A 3EH9A 4IX5A 3T8OA 3VW8A 4BCFA 4EOSA 3O50A 3UIUA 4ZY5A 4F9CA 1ZY5A 4GIHA 4O22A 4V0GB 5EOBA 4BGQA 4EHZA 2VRXA 3GXLA 3GU4A 5IQDA 4MEDA 4MXCA 4NT4A 5K3YA 2WQMA 4MXOA 3F3ZA 4A9YA 3FJQE 4C4MA 4YTHA 3QZIA 3PVUA 4E6QA 3ZXZA 3O51A 4FZAB 3ZUTA 4PF4A 2PMOX 3PPKA 2DWBA 4YJUA 4TL0A 3K5VA 3O17A 2HIWA 1VZOA 2HXLA 3D7ZA 3NSZA 5AJQA 5M4UA 4O38A 2X9FA 4Z55A 4U43A 5BVDA 3OCGA 3MFRA 4O27B 3NZ0A 3NCGA 4RWJA 5CS6A 1E1XA 2F7XE 2VWIA 2BKZA 3IDPA 4FKQA 4JBPA 3E62A 1KE8A 5CYIA 5KMNA 3UP2A 2XBAA 4Q2AA 2I40A 4TYIA 3LW0A 4HOKA 4K11A 2O65A 3QRIA 4H3QA 5EG3A 3JS2A 3AT3A 3OUKA 4G3DA 1H00A 3C13A 5CSWA 1PMEA 4W4WA 5ANGA 5BYZA 2RFEA 3V8WA 4RWIA 3N1PB 3ZM4A 2R3OA 1PXKA 5AAEA 3HX4A 4GW8A 2X2KA 3EYHA 3KQ7A 2PL0A 3G51A 4O2ZA 4YZCA 3RAHA 1M7QA 5JFSA 4DDGA 3RK9A 5HBJA 4IVDA 1H27A 1KV1A 3L8SA 2XK9A 4G3FA 3KIOC 2ERKA 4RVTA 5LXMA 4O7YA 1TQPA 4KS7A 3EOCA 4MK0A 2XKDA 2NRUA 4TNBA 5E8YA 4DG0E 4G9RA 5FEDA 2VO7A 3N9XA 4YHTA 3ZCLA 3A7HA 3AC5A 4H39A 3EQRA 4YP8A 2X6EA 2HAKA 3RVGA 3NNXA 4GK4A 4L9IA 4AZWA 3N1OA 3RAIA 4AZFA 4F63A 1G3NA 4MBIA 3VJOA 2WD1A 4BKJA 4C59A 3MH0A 4WG5A 3QGYA 4WHZA 4FX3A 1U59A 5C4KA 4I0RA 2WZJA 4KIOA 3VUKA 4O84A 4JR3A 4G31A 4M13A 4P4CA 5CSPA 2IZTA 3E3PA 2XMYA 2J3TA 3KKVA 5L2IA 3KRWA 3BHTA 4D1ZA 3G9NA 1Q8UA 1WBVA 2GFSA 2UZWE 3C7QA 5M09A 5EYKA 2XNGA 3MB7A 3OBJA 2GMXA 4MCVA 4MQ1A 3CPBA 4FL1A 3ZDUA 1OI9A 5FM2A 3JVRA 4I4EA 3TKIA 2C6OA 2VWBA 3KA0A 5BMMA 4EL9A 4ZTQA 4Z7HA 3I79A 2GCDA 2OW3A 2P3GX 1G8KA 2R64A 3KC3A 3KN5A 3VBWA 2WU6A 1VHHA 4BBFA 3D15A 2C68A 2I0VA 2VTNA 2FB8A 4UWBA 2YISA 2R3NA 4OX3A 1JVPP 1J3HA 1GZKA 3C50A 3R8UA 5HD7A 2RG5A 2W1HA 4NM0A 2BRHA 4IDTA 4MUSA 1TKIA 3JR1A 5F95A 5LWNA 3ENHA 3FPQA 2WQOA 1OBGA 4XRJA 1DS5A 2W99B 2R5TA 3UDZA 3VS7A 1ZLTA 5A4TA 3IQ7A 1YXTA 3QTRA 5C26A 4R3PA 3IK3A 2B55A 3V5PA 3PFYA 3U6IA 4TW9A 4IADA 3UVRA 1DI9A 4NWMA 3NAXA 3OXZA 3RGFA 1PMNA 1M52A 3CY2A 2XK3A 2WEIA 3BGPA 3DTCA 3MH3A 4FTMA 4O96A 1H0VA 3NW6A 4IX6A 5I9UA 3ZZEA 2GTMA 5L8LA 3BYSA 1GNGA 3Q32A 1IEPA 1FGKA 2YZLA 3UQFA 4YNOA 4I4FA 4D0XA 3C4WA 3BYMA 3OVVA 4ZTSA 4EK8A 3SXSA 3QL8A 3LFFA 2BILB 4AOTA 2PVNA 3K7HB 2XK4A 3FI8A 3QZGA 4HPTE 4EHEA 2J4ZA 5ETAA 2OH4A 5AADA 1IAHA 3LJ2A 4EOPA 2FO0A 4FTKA 4QOXA 2IJMA 5H8EA 3A7FA 3ZUUA 2XAMA 3CSVA 4J1RA 5F94A 4K18A 2UW0A 3C9WA 4GRBA 1AGWA 1H26A 3BIZA 4LOQA 1B38A 4ANLA 4F0FA 3KXCA 2YABA 2XJ2A 3R2BA 5T3QA 2IVSA 5E8WA 3A2CA 3EKKA 3ZS5A 4IAFA 3G6GA 5EM7A 3KXZA 3QLFA 3ALOA 3AC4A 1H8FA 3AXWA 4OUCA 4WRGA 1QCFA 4ALUA 4AXEA 4CT2A 3N51A 2UV2A 1WBSA 3CR0A 4HYIA 1GIIA 4HJOA 4WD5A 3LCKA 3E5AA 5GIPE 4JAIA 3F2RA 2I7QA 2W0JA 2W1ZA 3Q52A 2WTCA 4HYSA 4DF3A 2ITXA 2ZVAA 4CZTA 3K7IB 1F0QA 1JQHA 2UZVA 5CANA 3PVWA 1SZ7A 4E4MA 3ZSHA 2ZJWA 3DBDA 2XNMA 3P1AA 1OL7A 3OY3A 3VJNA 2C6IA 2W9FB 2XK6A 4R7BA 2KTYA 2BHHA 5DR6A 2YWVA 2XP2A 1WC8A 2ONLC 3SD0A 4DH5A 4EBWA 5IA3A 3DPKA 5L6WL 1NXKA 5FRIA 4MH7A 2HENA 3F69A 4LUEA 1FOTA 1UU7A 5A46A 4C4FA 2QHMA 3LQ3A 4J99A 4DHZA 3MGYA 3RHKA 5K5XA 4XOYA 2QR7A 3F5UA 3K7GB 3NIEA 3QD0A 2C6EA 3EFKA 2CPKE 5F4NA 4DTAA 3MYGA 1NA7A 3F3VA 4I6BA 4TRLA 4OTRA 5CQWA 4ZAUA 4YHJA 4CNHA 4G34A 5M56A 5D12A 3ZC6A 4X6QC 4OTIA 2E9VA 4BF2A 2IVTA 1FMOE 3NUSA 4AXAA 2GQSA 2OSOA 2HCKA 4KAOA 4LRKA 1OL5A 5JFVA 4R78A 3LFAA 5KMJA 4DEAA 2HZ0A 2XKFA 3PSCA 4X21A 3UO4A 2C3IB 3W2OA 3SA0A 4ACHA 4C38A 3UIMA 1RW8A 2RGPA 5CU2A 5IQIA 3MVMA 2DQ7X 3GU6A 4QTBA 3R9OA 4D28A 3L9PA 3KREA 3AMYA 4MBJA 4M67A 4AZVA 3R30A 4FEQA 2AUHA 3UVQA 5J1VA 3S0OA 5HG5A 3R8ZA 4AN2A 3QUPA 3LZBA 2HZ4A 4C4GA 2IZUA 4CG8A 4USEA 4IQ6A 4EWHA 5KNJA 3NUXA 4N57A 5AFVA 2FSLX 3U8WA 5FGKA 4D55A 4MXZA 4LGGA 2W1GA 2WG3A 3R7UA 2O63A 3A7IA 1P2AA 2KULA 4P5QA 3UODA 5KO1A 4I5MA 3FY2A 5A4EA 4DG2E 2C47A 4YNEA 1CKPA 4UXLA 3HP5A 1WMKA 5HEZA 1UNGA 4G3EA 3EL8A 4BY9E 2P33A 4JDHA 4FL2A 4C3PA 3HAMA 4FKOA 2OWBA 4FSUA 3LCSA 2HOGA 1OM1A 3ANQA 4FEUA 5G6VA 4C34A 5E9EA 3FYJX 4GFMA 4ARKA 5JGAA 4L44A 4O21A 3VF9A 5HNGA 4QMUA 1ZOEA 3H0YA 3WE8A 4BCGA 2JFMA 3KRRA 3W33A 3EQHA 4X2NA 1SMHA 5BVWA 5KKRB 5I9YA 4PNIA 3HMOA 2GFCA 5AM6A 4OGRA 5CZIA 3TEIA 4EUUA 4W4YA 3VW6A 2XF0A 3WZKA 3ROYA 5EDPA 4K8AA 1JKLA 3UQCA 4D1XA 4IZYA 4B99A 2XKEA 3DXPA 5AP4A 4AW1A 2YACA 4EJNA 2IZSA 3FKNA 3FHRA 3FXXA 4MXAA 2W05A 4UBAA 2GQGA 5B0XA 2PK9A 5AP2A 3PSDA 1Y57A 3A8WA 5KCVA 2QO9A 3HAVA 5C9CA 4BDIA 3AT2A 4ZTRA 3R83A 3UZRA 4G6NA 4MWHA 5J5SA 1OKZA 3PJ8A 4MBLA 5M08A 3KB7A 1YXXA 2VGOA 4DA5A 4YTCA 3K3JA 4FA2A 5BYYA 3BLRA 3R1QA 2WMQA 4FTQA 4EK5A 3NAYA 2C1AA 3OOMA 3S4QA 3LLAA 3E88A 4YZMA 4TWNA 1I09A 1R44A 4J97A 3OTVA 1TVOA 5KZ0A 1L8TA 2QI8A 3BBTB 4S31A 4XH6A 4C62A 5CZHA 4D9TA 4NFMA 3MSSA 1OZ1A 4F78A 1FGIA 4TYJA 3RCDA 2NYAA 3A8XA 3WYXA 3ZYAA 5KMIA 1ZAOA 3CGFA 3NJCA 1NW1A 5TR6A 2QOHA 3L8PA 3QRUA 3UG2A 3IPHA 2OZAB 3L8XA 4U0IA 5DNRA 3Q9WA 4UWYA 1GZOA 2PTKA 3DKFA 3OW3A 3V5LA 5BQ0A 1TZPA 3VHEA 5EM5A 4YZNA 4IAAA 2J0JA 2IO6A 4K2RA 1M14A 5CENA 4HPUE 3WF7A 4BI0A 4E5AX 3P7AA 1YDRE 2REIA 3IW4A 3RALA 2OG8A 4XS2A 4HW7A 3S1HA 1DAYA 4FZDB 3U9CA 2XM8A 2UZDA 4LV5A 4PV0A 2GHLA 3KRJA 4HZRA 1R3CA 3ZXTA 1OL6A 4G2FA 3U87A 5DA3A 4IW0A 1OL2A 2QCSA 5EW9A 3PZEA 3TWJA 2VV9A 4RT7A 3PA3A 1YRPA 4C61A 2EVAA 3QKKA 3F66A 5K9IA 5EI6A 3W2RA 3OXTA 4MUQA 4WIHA 3UOHA 2BIKB 2J0KA 3DCVA 1UU9A 3HDMA 5HX6A 3BI6A 3ODZX 3V5QA 1PXPA 3O2MA 3O8UA 2J3RB 4QYEA 1GIHA 3IO7A 4YLJA 2VWVA 5AUUA 3UQGA 3LXNA 4FSWA 2OJ9A 2EXMA 4MHAA 5EW3A 3LMHA 2FUMA 2OGVA 2IPXA 3LFQA 3VO3A 2OSDA 3HECA 2VWYA 2A1AB 2EWAA 3BHUA 4XEYA 1E1VA 1NVSA 3WOWA 4AZEA 5CEMA 4DGOA 4M84A 2GNIA 2YHVA 5D9HA 3BU6A 2PULA 4CLIA 4EZ3A 3VVHA 2Z7QA 4OW8A 3ZM9A 5AA8A 5I9ZA 1PYEA 4IACA 4PP9A 4FVPA 4EQCA 2PZPA 4EI4A 3SRVA 2X4ZA 2BRNA 3FMMA 4OTWA 4U41A 2CKOA 2ITUA 4F64A 1KE9A 1JSUA 3VUGA 3PY1A 3QYZA 4YC8A 2C5YA 2FSTX 4YPSA 3LXLA 2B9JA 5EYCA 5LVMA 2VTLA 3O8TA 4ACMA 4WKQA 4CCUA 5L6PA 1HCKA 2R3QA 3FQHA 3IECA 4IFCA 4WRSA 3VNTA 4RA4A 4QMOA 5DT0A 3OHTA 4FK3A 4CT1A 1IRKA 4OTQA 3CE3A 2Y7JA 2JDTA 3H9OA 4DEGA 5FXRA 3DS6A 4DTBA 3WIKA 4XBUA 5GJFA 1BI7A 5AMNA 3QXOA 4MUTA 3TZMA 4X3FA 4KABA 1XH8A 2IW9A 3MDYA 4O83A 3IDCA 3LKMA 5HICA 3R7VA 4O0SA 1TFFA 3RK7A 1UVRA 3QFVA 2JKMA 4LL0A 4YHFA 4F6SA 4C4JA 3ZC5A 3UOJA 3EN7A 2PZYA 4XLIA 4XG8A 3OWJA 4FIFA 5DEWA 3SV0A 2BAJA 4HGEA 5A9UA 3Q9ZA 3UPZA 3BRBA 2X2LA 4AOJA 3AGMA 4HGTA 3SGCA 1FPUA 1ST4A 4JBQA 3I4BA 4Y5HA 4F0IA 3TKUA 4FG9A 4Y5QA 3LFDA 2WGJA 5IDPA 2YCQA 3LPBA 1ND4A 4L6QA 4EH7A 4JG6A 2W1FA 2FYSA 3R1NA 5JEBA 1KOAA 4RJ3A 3LOKA 4EYJA 2I6LA 4ANQA 2ITYA 3G9LX 3QAME 3RM6A 4BRXA 4QMSA 2HELA 1P14A 2PVRA 4RIWA 2JKKA 5IUIA 5LOHA 4LUDA 3WBLA 4CMOA 3TDVA 4DYMA 2BMCA 3PJCA 3F82A 5GNKA 1V0BA 4A9UA 1YVJA 1MQBA 5CVHA 1VR2A 5K5NA 4DFBA 1J1CA 4ZSEA 5JMSA 4AXDA 4GT5A 4DEBA 2OJGA 3HV6A 4YJTA 5CU3A 2J0IA 2QOFA 3BBWA 4DGNA 4U97A 5ANIA 2F4JA 3BWJA 4UWCA 2ZMCA 4Z7GA 3IDBA 3MH1A 2BROA 4G1WA 3U4WA 4H3BA 5M4CA 3PVBA 4O86A 3NDMA 4LQMA 2EUFB 4UV0A 3W16A 3O23A 5TKDA 5CF4A 5E8VA 3VS4A 1KE5A 3Q60A 4FMQA 1P4OA 2XNPA 3M1SA 3MESA 3PVGA 3ZOSA 5B7VA 4GK2A 1FBNA 4J53A 2BZHB 1ZYSA 4BDFA 4NH1A 5ETIA 2WOUA 4NTTA 4FKJA 3ORZA 3E3BX 4BDAA 5E8SA 5ACBC 4NK9A 4JIDA 1ATPE 2YCRA 2X1NA 3D5UA 3PUPA 3QTXA 3ETAA 4KBKA 4RWLA 5EHOA 4IJPA 4L7FA 3R04A 4FR4A 4XG4A 2YIRA 3QU0A 2W4OA 4L46A 3PDTA 3HRBA 3UVPA 3PJ1A 2YM7A 1XBAA 3QA8A 4IJ9A 2ITZA 2X2MA 1UNLA 3BLAA 4I21A 3ORTA 4CQEA 3Q96A 2C3KA 2NRYA 3BKBA 2IW8A 4IFGA 4RPVA 5EKOA 2E9UA 3MA3A 4AE6A 4I5PA 2YA9A 3UJGA 2NPQA 3A99A 3VUDA 1NVQA 2IVUA 1PYXA 5BPYA 3HV7A 4LI5A 5DT4A 1ERKA 3RI1A 4FUXA 2J2IB 3Q9YA 5B2MA 3MTLA 3KULA 4O2PA 4IIRA 4B6LA 3GFWA 3P23A 5HG7A 2XYNA 2GNGA 4USDA 4KA3A 2BALA 4FYNA 3D2IA 3EFJA 2CKEA 4FT3A 3R9HA 4L67A 4DGGA 2Z7RA 1XR1A 4GVJA 2PZRA 3OXIA 4L42A 5LVLA 5JQ5A 4FK6A 3CUEB 3G0EA 4FVRA 3KEXA 4DFUA 2WAJA 3E8CA 5K4JA 4FNXA 5EI8A 2WTKC 3VUHA 2CJMA 4QDVA 3DGKA 1U54A 4GU6A 4ZTMA 2Z7SA 4NJ3A 2VWXA 1UU8A 2Z2WA 3RINA 5CU4A 5EHYA 1MRVA 2UZOA 3HRCA 2QO2A 4A9RA 4O6EA 3DNEA 5HZNA 2JIVA 5FM3A 2H9VA 5M06A 2OFUA 1P4FA 5FLFA 2XM9A 2B9HA 3R2YA 4I6LA 4ITJA 3C5UA 5DRDA 4A7CA 4KKHA 5IEYA 5ANOA 4CMUA 4J96A 3NVKI 3FAAA 2DYLA 2UW3A 4FKGA 3LM5A 3PWDA 3RCJA 4M15A 1ZYLA 2PYWA 2GPHA 5DIAA 4ZZMA 3S2PA 4EC8A 1QMZA 2Q0NA 3V01A 4MAOA 2WMBA 2C30A 5H3QA 1KUTA 2WO6A 4RVMA 3FHIA 3R0TA 5DGZA 2ITNA 2VO9A 2BRBA 3GU8A 5DRBA 2YJSA 3R9RA 4RBLA 5CT7A 4FKIA 4EHGA 4BCHA 4CTCA 2NNWB 4RFYA 4FTUA 4AT4A 2XNBA 4AF3A 3HMNA 5CEKA 5M44A 5KBRA 4CEGA 2ACXA 4RJ6A 4GH2A 2CGVA 3TTJA 3UNJA 4TYHA 4BYJA 4DGLC 5JFXA 4OTFA 4TZRA 3B2WA 3MBLA 5A4LA 5I9WA 4DN5A 3FZOA 4DG3E 4FIGA 4EK3A 3UBDA 4Y8DA 4ZTLA 5C03A 2X0GA 4FUYA 4PDSA 2WTIA 4FSMA 4FE2A 3ZH8A 1BUHA 3ORXA 5DN3A 2XJ1A 5DOSA 5LJJA 5A6OA 3LQ5A 4I94A 4J8MA 2PUUA 2OIBA 1B39A 4ANBA 5IQEA 3FZTA 4YSJA 3FZRA 2W4KA 1CSNA 4BCKA 5IA0A 3FLZA 3I6UA 4G6OA 1LPUA 4KB8A 4XV1A 3PXFA 4AFEA 1RQQA 1YKRA 2P55A 1JKSA 2LGCA 2XKCA 3R63A 4NZWB 3Q4TA 3UNZA 3TDWA 3W8LA 4PP7A 3MN3A 3NVMB 1YXSA 4U3YA 3MXWA 3PTGA 2F7ZE 2GTNA 2W1DA 5HCZA 3QC4A 2ONLA 3NS9A 4NM7A 2ETKA 4Q9ZA 3OG7A 4O7TA 1BLXA 4RVLA 3VQUA 4KINA 5HIDA 5AV3A 4TWCA 3AKJA 3PPJA 3GBZA 4LL5A 4M69B 1ZWSA 4R1YA 3S00A 3UTOA 5A4CA 5AUVA 3CPCA 5HE1A 5IG1A 5BX0A 4MPHA 2ZB1A 3ORPA 3P5JC 1XJDA 2BFXA 2RFDA 5AV4A 4AFJA 3C4FA 4E20A 3UOLA 3U54A 3JVSA 4WOVA 2X39A 3KXGA 3RPSA 3WARA 3KK8A 3VUIA 3ORMA 4BDGA 2J0MB 4I22A 4EH4A 4MYGA 3V6RA 3D94A 3VWAA 3DDQA 3LXKA 1SVGA 3O7LB 4AGWA 2OFVA 3O7LD 5J8IA 4DHFA 5CTPA 5HVYA 4AGCA 4FV5A 3LIJA 1STCE 1OKYA 3PG3A 3QKLA 5E92A 2GS6A 3IW7A 5E4HA 2OJIA 1XBCA 3CQEA 3DT1A 3NX8A 3F5PA 3ZUVA 5LWMA 5J9LA 3QQFA 3TNPC 4EK4A 3C4CA 2C1BA 3GC9A 5AP3A 4GKIA 3HRFA 3D7TA 3GOPA 2UZEA 4ZSAA 3O5AA 3ZFYA 1R0PA 2BKKA 4FL3A 3HUBA 1UU3A 3UZTA 5AM7A 4FTAA 4WUAA 3SDJA 5EKNA 2WQNA 3VIDA 4N6YA 1Z57A 3V6SA 4FSYA 1XH4A 1LEZA 1PXJA 3R9NA 4IAKA 4JMQA 4EOKA 5TF9A 4HVSA 3BV3A 4E4NA 3FE3A 2BAQA 2XCHA 3BV2A 4R5SA 4V04A 2PY3A 4FEVA 5I4NA 2ZM4A 3ACKA 4JOAA 1VLRA 2Z8CA 4BGHA 3NMUF 4WBBB 4C02A 4ENXA 3GUBA 3F88A 3KULB 3ZO2A 3VBTA 2XVDA 4M8TA 5CNNA 4I6QA 3COIA 4FKRA 4FZFB 5AIRA 5A14A 2HXQA 1JAMA 3FQEA 3OCBA 1PHKA 4IAZA 4WG4A 4UN0C 4QTAA 4YTFA 4RLLA 4EQUA 4FV9A 1WVYA 2YITA 3KFAA 3Q6UA 3DOGA 2PE2A 4DFLA 1Y6AA 5BUIA 3R8LA 4DC2A 1OPLA 3WF6A 4LV8A 3NNVA 5C8MA 5HE3A 5DI1A 3TNWA 4OAKA 3E7VA 3RMFA 3OMVA 2UZLA 4EH6A 3FL4A 2HY0A 5FP6A 2JAMA 2BTSA 4RC2A 5DVRA 1QPCA 5IZFA 3RPRA 2WNTA 2C0OA 3DK7A 1K2PA 2OJJA 1MP8A 3L9LA 2OIDA 4AU8A 4CKRA 3A60A 4KBAA 2PUNA 1MUOA 1DM2A 2BRMA 3PRIA 4AG8A 4BTFA 4Q5EA 2W5BA 4FC0A 5IMXA 3MB6A 3R8VA 3PP1A 5IQBA 4CTBA 4LMUA 1Q61A 4JG7A 3QTQA 2PZIA 1G5SA 4G17A 4IB1A 3TJCA 4ALWA 5CSHA 4BB4A 4BZNA 2XIRA 4D1SA 4EOQA 5LMKC 4O0WA 2O8YA 3V51A 4MXXA 1PKGA 4AN9A 4K33A 3DK6A 4FSRA 5JK3A 5AIKA 2ITQA 5HG8A 4E4LA 3VBXA 5KHWA 4Y73A 4YO4A 2F9GA 4U3ZA 2ZV7A 4AOIA 4M14A 4DTKA 4NYEA 1ST0A 3FI4A 3TV4A 3MFSA 1JOWB 1OIRA 2R3MA 1NVRA 4MURA 3QUDA 3Q4ZA 2W96B 1YHVA 4AE9A 4D9UA 2RKUA 2WTVA 2YM5A 3BL9A 2OK1A 3E8DA 3OUNB 4J98A 4QRCA 3CTHA 4O7LA 4DH7A 4MD7E 3PIXA 3UC3A 3M11A 4R7HA 3O8PA 5CEPA 1Q4LA 3GOKA 4RRVA 4C0TA 5JZJA 3SOCA 1JKTA 3CKXA 4CG9A 1WZYA 2CGXA 3CD8A 3FMNA 3GI3A 4ITIA 2C6TA 3IW6A 4IC8A 1LR4A 2WMXA 4PMTA 3G5DA 3DK3A 3QWKA 4FT5A 2PWNA 5LMAA 1OL1A 1GY3A 4H05A 2GNHA 2BAKA 4U45A 1OIUA 4ZLOA 5J1WA 4NCTC 3QHRA 2C6MA 3BLHA 2WFQA 4K77A 4RMZA 4TNDA 4P2KA 4AW5A 5BNJA 1MQ4A 5D11A 4E26A 3AMAA 1LP4A 5ICPA 3L1SA 4BC6A 1FVRA 2UW7A 4UXQA 4HVGA 4NFNA 3OBGA 4FZ7A 5TOZA 3RJCA 2AC3A 4CFUA 2WTWA 3HV4A 3SOAA 4RJ4A 4CFNA 4ACCA 4DDIA 2WFXA 2IZRA 1NY3A 4F09A 2Y9QA 1UV5A 5EDRA 4ZZOA 3C4XA 4YJVA 5I9XA 2XIYA 4DT9A 3FY0A 3G6HA 4S34A 4YC6A 1FVTA 1XH7A 3HUCA 5IEVA 5CT0A 3PLSA 4J7BA 5KHXA 2O64A 3FSFA 5M4IA 2XB7A 5H8BA 4AACA 3DDPA 4WNKA 4M97A 3M42A 4JT3A 3RPOA 5EM6A 3TNHA 3W18A 4DFZE 2BJNA 5AEPA 2W17A 4L45A 3ZBXA 2XK7A 3QYWA 4I5CA 3HMMA 4GL9A 2VTQA 3TV6A 4RQVA 4BCOA 4OXDA 3KMMA 4O7NA 2JAVA 4EHVA 1W98A 4MD9E 4OT6A 5GIOE 4HYHA 1E9HA 2PPQA 3RAKA 3WF9A 5IDNA 4QMNA 3EJ1A 4UZDA 5B2KA 3S95A 4F08A 3BYOA 2QG5A 1M7NA 2ITOA 2WMSA 2ZDTA 3F3UA 3OT3A 4FV8A 3QQUA 4L3PA 3MVJA 4JXFA 4QP6A 4ZOGA 4IAIA 3AKKA 4QMLA 3KF4A 2DUVA 4QT1A 3O71A 3E92A 1REJA 4ZLYA 3BU5A 4PQNA 5DFPA 3TXOA 1WBOA 3NUUA 4U9AA 3TN8A 1W83A 3R1SA 4QTCA 4MWIA 3PP0A 3RHXA 2QOIA 3SVVA 3DKOA 2V0DA 3NNWA 3R7EA 2QNJA 1U5RA 3HMIA 1OBDA 2WXVA 3BCEA 3I6WA 3ORIA 5KMOA 3Q9XA 4QO9A 5IISA 5IUHA 2QO7A 3EL7A 4FV0A 1ZOGA 4PDPA 3W0SA 3SXRA 4D2RA 5CEOA 5C4LA 2C6KA 2O2UA 2H6DA 2OF4A 3FLWA 4OR5A 2CNVA 5AV2A 2YIYA 3KCFA 3QTSA 2UW6A 3PUFC 2J3TB 2QC6A 3A7JA 4HZSA 4IWDA 2J51A 3MV5A 2W4JA 2QOQA 1FVVA 1ZMVA 4BI1A 4YR8A 2OO8X 2YAAA 4BBEA 4F6WA 5AP0A 3UYSA 3BGQA 3ITZA 2X7FA 3ANRA 3CD3A 5ACKA 3IG7A 1BL7A 4R5YA 4PL3A 1H1QA 3DXNA 2R0IA 3PSBA 5CEIA 4E5BA 4CXAA 2Y4IB 3N4UA 4MNEA 4APPA 4F70A 4EOOA 3QC9A 3N1RA 3KVWA 3E63A 5FEEA 5AA9A 2PHKA 4GG5A 1PXMA 1V0PA 2VUWA 1OKVA 1Q5KA 2ETMA 2JD5A 2QODA 5KZIA 4OX5A 2CCIA 3EQDA 3TUBA 5FTQA 4GU9A 3TZ7A 3U9NA 2W06A 1U4DA 3DBEA 4RX5A 5A4QA 4YTIA 4EQMA 2ZV2A 1QPJA 2O3PA 3DU8A 3VF8A 4EOLA 5AUZA 4FTCA 3PXZA 3LAUA 3LCTA 4ZLZA 2PWLA 4EONA 4F7LA 5C8NA 3EN6A 2X6DA 2YDJA 1WAKA 4ZMFA 5F9EA 2OICA 3OOGA 4O7ZA 1OGYA 1MRYA 5C27A 2YWPA 3BHHA 2PMLX 1F3MC 3ET7A 2QURA 3ZLXA 4QMMA 3SHEA 4H1MA 3OP5A 4L00A 4F1OA 3EQGA 5K4IA 4IBMA 3UDBA 4FV3A 4TYGA 4ID7A 2BZIB 2QONA 3NRMA 5EYDA 4BCPA 1WC9A 2BDJA 5CX9A 1Q99A 2XARA 4JQ8A 4YJPA 1GOLA 2XNEA 4XX9A 2QLUA 1PY5A 4NKAA 5FUTA 4DLJA 3OY1A 3HA6A 3QQHA 4CLJA 4AN3A 4CZUA 3LM0A 1BX6A 5EQEA 1M2RA 3SLSA 3POOA 4IX3A 3I0OA 4UYNA 2C6LA 2ZYBA 4NU1A 1UKHA 1IAJA 3TZ9A 1OUKA 1ZARA 2CLXA 4D2SA 3P0MA 2ITPA 2H8HA 2UVXA 5DEYA 3UDSA 5I0BA 2WIPA 2JDVA 3FI3A 3PY3A 4LDTA 2BZJA 3I0QA 5BVNA 2VTTA 3F7WA 5JZNA 5HHWA 3VHKA 3LLTA 4W4VA 2F2CB 4Z9LA 3UZPA 3C0HA 1OIYA 3V5JA 3NWWA 2VU3A 3GCQA 3CP9A 3OROA 2WQBA 3HNGA 5KKRC 4RLKA 3ZLYA 4JVGA 4EORA 4J71A 4XUFA 5GHVA 1YW2A 5CI6A 3PLAE 3GB2A 3MVHA 3EYGA 5HBHA 4GMYA 3ODYX 3I5NA 4FKWA 4FKPA 5DBXA 3H0ZA 4ZTHA 3TTIA 3UMXA 4F9WA 4U42A 2A19B 2JGZA 5CXHA 4U6RA 4XOZA 3U6JA 3FC1X 3I7BA 5KE0A 3DY7A 2CN8A 1H28A 1S9IA 3QRJA 4PMMA 5EYMA 3UIBA 4BDJA 4I93A 1RJBA 2VO6A 3Q2MA 2YJRA 1YI4A 3O96A 2R7BA 4JX3A 5EQYA 2UVZA 1JLUE 4EH5A 4ENYA 3DZOA 2ITWA 2C0IA 3R21A 5BUEA 4GYGA 4CKIA 4F0GA 3EMGA 2OXYA 4L01A 3E93A 3OW4A 4QP2A 1VEBA 3FMEA 2Z7LA 3S3IA 4W4XA 1ZYDA 2BDFA 2HY81 4FGRA 3ROCA 4ZY6A 3F5XA 3RNIA 3A61A 3KXMA 3QZHA 4RWKA 3RPYA 2BTRA 4CMTA 1I44A 2J5EA 5CQUA 4MKCA 1KOBA 4AGDA 4DFYA 5CXZA 5IH4A 2UZNA 4Q5HA 4N6ZA 3R73A 4F1MA 1PKDA 2VO3A 3CBLA 3HDNA 5FBNC 3BLQA 3CXWA 5AP1A 3VS1A 1IA8A 4RFMA 3UG1A 5J9YA 2R7IA 2OXDA 3D5VA 4I1ZA 2R9SA 3OFMA 1XMMA 2BVAA 3PZHA 3TL8A 2XIKA 5FXQA 3FMLA 3GU7A 3ZFMA 5CU6A 4KWPA 4NIFB 1OMWA 3N1GA 1V1KA 1TQMA 1Q3WA 2C0JA 2B7AA 3QGWA 1BL6A 2W7XA 3MY1A 4LMNA 4ASEA 4ITHA 3FSKA 4JG8A 1OPKA 4RG0A 3RWQA 4BVUA 3W0QA 1G8SA 3FKOA 3N4VA 1OKWA 2BHEA 4FSNA 4JIKA 4R6VA 3G33A 4ORKA 5LQFA 4I23A 3QX4A 5KUPA 2OI4X 3EB0A 3VULA 2WMTA 4RGJA 3DBCA 1AQ1A 2WQEA 3MVLA 3QCXA 4F65A 1U46A 3Q4CA 4KIQA 1O6YA 5CI7A 4WNOA 5HU3A 1Q8ZA 2G2HA 4QP4A 4FSQA 3FLSA 4WBOA 4AQCA 4CKJA 4ANMA 4FNZA 4S33A 2VTHA 5AP7A 4C2WA 5M55A 1W7HA 3MPAA 3LQ8A 5H9BA 4ZSLA 5BMSA 3QQKA 2OKRA 4DEIA 4NW5A 3BE9A 3TKHA 1CM8A 3CLYA 5E7RA 5LCJA 3FQSA 3MTFA 2VTSA 1H0WA 2PVMA 2QVSE 4DLIA 4C3FA 5CASA 2PVLA 4M7IA 4GS6A 4FKVA 3MPTA 4U8ZA 4FV1A 5FTGA 4FV2A 3MFUA 5ANJA 3EFLA 3FLYA 4FTTA 4L7SA 4Y72A 4J8NA 3FUPA 3SC1A 3UOKA 4DBNA 4O0XA 2GS7A 4O0TA 2YM3A 4OTHA 5EOLA 3DKCA 2YIWA 3CJFA 1Z5MA 3RAWA 4E93A 4JBOA 3NUAA 1UNHA 2JIIA 1SVEA 2YIXA 5AUWA 5CF5A 1Q8YA 3RPVA 3TM0A 4K1BA 1UKIA 2AYPA 2P0CA 3AG9A 4JX7A 4X7QA 3G90X 3ULIA 3K5UA 4EKKA 2R2PA 3F61A 4K9YA 3UIXA 5IA5A 4E1ZA 1H25A 3BYUA 3DJ6A 3NW7A 3P08A 3L9NA 4YPDA 3V5WA 4X6RA 3UGCA 3BELA 3GC7A 4O7RA 2C5VA 2R3HA 3R22A 2XUUA 4MX9A 2C6DA 4CVAA 2XK8A 4OBQA 4HNFA 5IU2A 3DLSA 1URCA 2CGUA 4KSQA 2Z02A 5E1EA 3SG8A 4QP9A 2G1TA 3SX9A 4OT5A 3FWQA 5JGBA 2YDKA 2JBPA 2ZV9A 2Y8OA 3D14A 3GC0A 3KXXA 3QUEA 4YLKA 3W0RA 3H9FA 5EHLA 4EK6A 5EDQA 4I6FA 3OEFX 4RX8A 4P90A 2XRWA 5F20A 3BEAA 3E7OA 4XBRA 5B2LA 4RC4A 4LRMA 5FTOA 1YHSA 4A4XA 1GIJA 4BDBA 3C0GA 4G5JA 4I92A 3KF7A 3FMHA 2PMNX 2CNQA 4LFIA 2WEVA 4F4PA 3KRLA 3TYKA 3UPXA 4G5PA 4FT7A 2HWOA 2IVVA 4QYHA 3BGZA 1Q8WA 4R3CA 1CMKE 2WHBA 4PL5A 3LJ0A 4EZ5A 5KBQA 5KX8A 4YO6A 2OLCA 2XIXA 4FTOA 2G2IA 2C3JA 4YMJA 4FEWA 4BIEA 4CGAA 4JAJA 4KIPA 1XBBA 4C33A 1W82A 5CVGA 4BDDA 5IQCA 3EFWA 4DFXE 4KS8A 2VTOA 5LARA 4ZMEA 4BGGA 3ERKA 2XCKA 3E87A 3R00A 3GCSA 3CUED 3QTIA 4TY1A 1O6LA 5HBEA 3NUYA 1G8JA 1YOJA 1YWNA 4MXYA 4C36A 5HIEA 2CFHC 3DQXA 1EH4A 3Q3BA 3QHWA 2J50A 3EZVA 1KV2A 4ZJIA 1APME 2B9FA 4E4XA 4E6CA 5LMKA 3BL7A 5HKMA 4FICA 4F7NA 4J95A 2V55A 3ZEWA 2PVFA 2NP8A 3Q53A 4PUZA 5ANEA 4UZHA 4IVCA 4ZEGA 2QQ7A 2V7AA 3D9VA 2B52A 4O91A 3VBYA 4HYUA 4XG7A 5IQGA 4JRNA 5AAFA 4X2KA 1W8CA 3W0NA 1PMUA 3V3VA 4WO5A 2B1PA 3P86A 3P7CA 1XHAA 3PFQA 4FGBA 4II5A 4QYFA 4S32A 4WT6A 5LVPA 4F9BA 4PY1A 5EM8A 5C8KA 4QEBA 4QMXA 3V04A 1SM2A 2FA2A 3DBFA 4PDOA 5CSVA 4RJ5A 3TJDA 2YM4A 3FLNC 3PJ2A 4UY9A 3FL5A 3PIZA 3SRVB 1LUFA 2G15A 3M1NA 3WZEA 2ZOQA 3EQPA 3IGGA 4DEHA 4V01A 4CFMA 3A62A 3AC3A 3R28A 3KVXA 3Q2JA 3U55A 2J6MA 4YC3A 3KMWA 5CAQA 1H1SA 2CN5A 2Y0AA 3EQBA 4H1JA 3MY5A 4BCJA 5L3AA 4EOMA 2J7TA 3UO6A 4QPAA 5AWMA 3CIKA 3V8TA 4ASXA 4O6LA 4C7TA 4DCEA 3WI6A 4ZS0A 4B8LA 1LEWA 3MW1A 2WMUA 4FI1A 3NYXA 2JIUA 4NCTA 5T6KA 4YBJA 2WB8A 3NLBA 1Y6BA 3D83A 3ZSIA 4WUNA 5AP6A 3TUDA 5ANDA 3WYYA 5JRSA 3W2SA 5IUGA 5FDPA 1A06A 4X3FB 5JRQA 4F6UA 4L8MA 3TACA 4AW2A 1CDKA 3N1QA 3NNUA 3KK9A 2H96A 4NJDA 1VYWA 1Z9XA 4AX8A 3H30A 4CRSA 3SW7A 3ELJA 4CFWA 2CKPA 2P2HA 4QP8A 1SYKA 5CLPA 4PMPA 3FI2A 1KE6A 4Q9SA 3ULZA 3QTWA 1OIQA 3FYKX 3IS5A 3R1YA 4YBKA 3VRZA 4BIDA 4DINA 1JSVA 4BZDA 4OBPA 4CV9A 2CDZA 3BHVA 4D4YA 4FTJA 2G9XA 3NYNA 3D1MA 1BKXA 5AAGA 4FT9A 3ZTXA 4GJ2A 5D7VA 3ZRMA 3IKAA 1JSTA 4MTAA 3AQVA 3U4UA 4E7WA 3R7YA 2R3PA 2P4IA 3NR9A 3EKNA 4ALVA 1CKJA 3D0EA 4IVAA 4IWQA 4RIWB 3NEWA 4AZSA 4AGUA 4YU2A 1VJYA 4TKSA 5M4FA 3LFSA 3UC4A 4PMSA 5L6OA 4GUEA 5CNOA 3CJGA 2HYYA 5JSMA 1IG1A 4LOOA 3HA8A 4E6DA 4D5KA 4O0YA 3MI9A 3WF5A 3I5ZA 5E8XA 2UW9A 4JLCA 4FJVA 5BVKA 4B9DA 5H8GA 4EH3A 3PE1A 2OBJA 4RIYA 3QWJA 5ANKA 5LVOA 4XRLA 5DHJA 3LFEA 3BEGA 4IX4A 5HO8A 5EH0A 3RKBA 3F6XA 4NUSA 2BDWA 2VTPA 1HCLA 4OBOA 3C1XA 5DE2A 3NUNA 5A54A 5IQAA 4M0ZA 4AAAA 5IEXA 4WSYA 4XP3A 3P78A 2QU5A 5A3XA 3WILA 3DAKA 3CTQA 4BDCA 4DE4A 2VO0A 4R77A 4GT3A 4LV7A 4PX6A 4APCA 2YAKA 3B2TA 5HTCA 2FSMX 3KXHA 3QX2A 4O0RA 5FQDC 4JR7A 4CSVA 5M51A 4O82A 5IQHA 4X2FA 1J7UA 1H24A 2X8IA 3COMA 3OWLA 4M12A 2GHGA 1Y8YA 3HV5A 1DAWA 4GIIA 2JLDA 4U80A 3KMUA 5HD4A 5HVJA 1F5QA 2GHMA 5AV1A 4BN1A 3GC8A 1ZMWA 3ZONA 5LCKA 5DWRA 4UX9A 1XKKA 3NFFB 3KGAA 3WF8A 2G01A 2GS2A 1WBPA 2VNYA 3GCUA 4O7SA 4M0YA 3ATTA 3MY0A 5J87A 4HVHA 3UNKA 3JXWA 1HOWA 1Q8TA 1RE8A 3UMWA 3TIZA 2UVYA 3AC1A 4EEVA 4AXFA 4BYIA 2F2UA 3A4PA 3LCDA 3CS9A 4EYMA 4F9YA 3EWHA 1S9JA 1AD5A 2XZSA 1YHWA 4RQKA 2VX3A 2C69A 4TT7A 3ZLWA 3EHAA 3FMDA 2W1EA 1PW2A 4NSTA 2BR1A 4O7WA 3GNIB 3BYVA 3HL7A 4KRCA 3F9NA 4FNWA 4BHNA 4C35A 2W1CA 4L3LA 4H3PA 4NM5A 3VAPA 4RIOA 2HWPA 2UW8A 1KSWA 1U54B 3ML1A 2IW6A 4MVFA 1PXIA 4R1VA 1GZNA 3TI1A 3W10A 2P2IA 5JH6A 3B8RA 3FC2A 1T46A 5BYLA 3N4TA 4AW0A 4G9CA 2VN9A 4YGAA 3GP0A 1Q97A 4TWPA 4XG6A 3G2FA 3VS3A 2QKRA 2PUIA 4DHIB 4FKSA 3TCPA 3DV3A 4YLLA 2WTJA 4JIAA 3LMIA 3AKLA 2OZOA 4JDJA 3P7BA 5FDXA 3ENMA 4L53A 5E8UA 3PG1A 2JC6A 4LOPA 3MJ2A 4DITA 4FKLA 5D7AA 4FG7A 4IZAA 4CCBA 4AA5A 3LFCA 2QD9A 2W5AA 1H07A 4BDHA 2PVKA 4RJ7A 1OPJA 4L68A 2X8DA 5CSXA 2VX0A 3ZO1A 5CAUA 1Q62A 4YZ9A 4JBVA 4QYYA 4RVKA 2XANA 3M2WA 3KCKA 2XNOA 3QTUA 4GK3A 1XO2B 2WPAA 5DPVA 5ETFA 3R8PA 4HVIA 2JDOA 4JQ7A 4A4LA 4NT9A 4EOJA 4RX9A 5T68A 4TYHB 2QR8A 4KKEA 3ZHPC 5HE2A 1R1WA 1P5EA 3VONA 4TYEA 5IA1A 4LG4A 3UP7A 4QQCA 5HGIA 1M2QA 4XHKB 1OVEA 2ERZE 4IM2A 4F7JA 5A6NA 3R7OA 4B8MA 2V5QA 2HZIA 2QHNA 4YZDA 3SW4A 4TXCA 1Q41A 1YXVA 1ZMUA 3CEKA 5AUYA 4I0TA 4UYAA 3W55A 2CMWA 2PVJA 4QTDA 3PYYA 2EB2A 3GQLA 2YN8A 3QXPA 5HQ0A 3SAYA 4C58A 3OCSA 3TV7A 4QYGA 1XQZA 4RIXA 1WFCA 2HW6A 2JKQA 4DEEA 3COKA 1R0EA 2ZM1A 2RG6A 1JNKA 3EN4A 4NW6A 3FXWA 4IC7A 3GU5A 5F1ZA 2CLQA 1LBUA 4Y83A 2WG4A 3ZLSA 2C5XA 2E9NA 2OJFE 2UUEA 4FBXA 4RZWA 4XV3A 3UE4A 4C37A 2GNJA 4PL4A 5DR9A 5HIBA 4O81A 4FKTA 4ZXTA 5J7HA 5TO8A 2XBJA 4BIBA 5HNMA 4DFNA 4DT8A 2YCFA 4PDYA 4C4EA 4JDIA 1XMLA 3MJ1A 1J1BA 1YOLA 2A2AA 2QLQA 2VTIA 1XH9A 3RP9A 1ZXEA 4QQTA 3MPMA 4YJOA 4ZSJA 3TIYA 3C4EA 1QL6A 2ZMDA 3H9RA 5HCYA 3C4ZA 2FVDA 3QBNA 4GUBA 4EWQA 5AV0A 4HGSA 3RNYA 2OZAA 4AZTA 3P9JA 2UZTA 3CQWA 3E8EA 3H4JA 3W0MA 5CF8A 3SKCA 4W8EA 4ACGA 4ZZNA 4TN6A 5DH3A 2VZ6A 3Q6WA 2EB3A 2I0EA 2R4BA 4RIYB 2R3RA 3E64A 3DAEA 4A07A 5L8KA 4ZJVA 4KBCA 3FBVA 3KU2A 3QQJA 3BHYA 2A4LA 5FD2A 1YDSE 2ZAZA 3MFTA 3Q5ZA 3SQQA 5JT2A 3NPCA 1XH5A 2OF2A 3ALNA 5FXSA 3F5GA 5HCXA 4PNKA 3GFEA 5CAPA 3QF9A 4Z3VA 3ACJA 4M3QA 3PJ3A 4I41A 3DJ7A 4QMPA 5TT7A 2BUJA 4RC3A 5JKGA 1URWA 3PPZA 2R3KA 2YERA 2ZDUA 3BE2A 3OEZA 4FIJA 5CEQA 1G8AA 1WVWA 4GYIA 3FZPA 4QQJA 4D58A 3Q04A 3D7TB 4DAWA 4DH3A 3AOXA 4CRLA 3P4KA 2OU7A 2J3RA 3UO5A 4E6AA 1PRYA 3BU3A 2WMRA 3N1FA 2YZAA 2Z60A 3CC6A 4TTHB 4N0SA 5D41A 5ETCA 2LAVA 4IDVA 3HGKA 2QKWB 4XCUA 5GJGA 2VWZA 5JQ8A 3HV3A 3FEGA 3IOPA 3BQRA 3IW5A 5H2UA 3MIYA 2OXXA 2BRGA 4CFVA 2WMWA 4ASDA 5CF6A 4G3CA 4AS0A 5HI2A 2A0CX 5BVOA 3FLQA 4GJ3A 3G0FA 4FG8A 2XYUA 4F9AA 4DCAA 4IHPA 3BQCA 1H01A 1ZOHA 2CNUA 3C51A 1M2PA 5CVFA 4XG2A 3NUPA 3EZRA 4X0MA 2RF9A 2OH0E 3AT4A 4XG9A 4JQEA 4XYFA 3TNIA 1K3AA 2GNFA 3ORNA 4FZ6A 5HO7A 3ZO4A 2RFSA 2QOLA 3WZUA 3W0OA 3PY0A 1CKIA 3JPVA 3FV8A 3KN6A 2WFYA 2ZV8A 3GQIA 3BWFA 2F49A 4EH8A 3QTZA 4ZP5A 5C01A 3Q5IA 4F1TA 1CTPE 2BIYA 5BVEA 4IANA 1REKA 1A9UA 3R6XA 1R39A 4XG3A 1Y91A 3AC8A 3ID6C 3ORLA 4YJSA 1L3RE 4FOBA 4BI2A 3THBA 3N1MB 4BTKA 4FIHA 3GEQA 4D0YA 4FT0A 4ZS4A 2R3GA 4AWIA 4DEDA 4B0GA 4DH8A 3WE4A 2GNLA 3H10A 4GVAA 4ZJJA 3C5IA 4ZIMA 4CFXA 2VAGA 1WBTA 3WZDA 4NKSA 4UEUA 2WFRA 2J0LA 3QD4A 1BYGA 2GU8A 5HE0A 3RM7A 3DFCB 4TPTA 5IA2A 3K2LA 4ZK5A 4HGLA 3PWYA 3TNQB 4YJRA 3EQFA 1PXLA 4ZY4A 2Y6MA 3TMOA 1JWHA 2DS1A 1PXOA 4FYOA 3F3WA 5IH6A 4BBMA 4JRVA 3TUCA 1SVHA 3PXQA 3RZBA 3VS6A 4OTGA 3W2CA 2BPMA 3R02A 4FNYA 4PRJA 4A06A 2PE0A 5KMLA 3VRYA 2FGIA 2VTJA 3ZO3A 3K7JB 4PWNA 4WNPA 3QA0A 2GDOA 1M17A 4JNWA 4U7ZA 4L52A 4RZVA 2WMVA 2CGWA 2I0YA 4YZBA 1QPEA 3HEGA 4IEBA 3GGFA 1A48A 4FV4A 4NTSA 2WKMA 4IB3A 3UDTA 1YWVA 3BPRA 4BHZA 4KSPA 2PSQA 3MA6A 5G1XA 3MH2A 3VQHA 2R3IA 3MS9A 1H1RA 4PTCA 4KD1A 4OLIA 4U44A 4QTEA 5HTBA 5IPJA 4K0YA 5FP5A 4KKGA 4RIXB 3CKWA 1KWPA 4FSZA 1T45A 2CFHA 2VWUA 2EU9A 4EH2A 2Y4IC 4ZSGA 3ZU7A 2R3FA 5IH5A 1FINA 4IVBA 4QP3A 4IMYA 5DLSA 3I1AA 2Y4PA 4O7VA 2QG7A 4LRJA 4I0SA 4UB7A 4WG3A 2VTAA 5DG5A 3L8VA 4XJ0A 2HZNA 2RL5A 2WELA 3DNDA 2QU6A 3ZDIA 4H58A 2X7GA 4I5HA 4GCJA 1SNXA 3UYTA 2X4FA 4BCQA 3QCYA 4YJNA 4IAYA 4YUQA 5BV3A 2Y6OA 1IA9A 2XALA 5EQPA 3VC4A 3OF0A 4Y46A 1V0OA 2RIOA 3AD6A 2UZBA 1XWSA 5J95A 3DBQA 2UW4A 3WZJA 2Q83A 4JL9A 5BVFA 2E9OA 2WMAA 3JY0A 5EI2A 4TWOA 4FSTA 1RDQE 4S30A 4XP2A 2Q0BA 3NCZA 4EOIA 1ZY4A 1J91A 3PXYA 2JITA 3QQLA 4XNEA 5C1QB 1ZZ2A 3MWUA 4AA4A 5HU9A 4DGMA 5HESA 4I6HA 3EIDA 3GVUA 3PXKA 4QP7A 2WU7A 3AMBA 4LM5A 3EQCA 3DJ5A 3NYVA 5CY3A 3VS5A 2I0HA 4EJ7A 4EKLA 3ZSGA 2HW7A 3OCTA 3Q4UA 4BCNA 4C4NA 1PJKA 4Y95A 3W0PA 4XP0A 3QQGA 4MF1A 2C0TA 3R8MA 2JEDA 3QKMA 1ZZLA 1FQ1B 4RJ8A 4BTJA 1SNUA 2PUPA 3LHJA 3L9MA 3QD2B 2FSOX 2J9MA 1Y8GA 4FIIA 4A9SA 3VUMA 3FKLA 3K3IA 4IWOA 3PE2A 3R7IA 3ZRLA 5J9ZA 3PIYA 2GQRA 3KXCC 3OS3A 1GAGA 1Q3DA 2IG7A 5DT3A 3ZRKA 4QMTA 2BCJA 4CD0A 4E73A 4EC9A 3NIZA 4BICA 2O0UA 3JUHA 3I7CA 4QDEA 5BUJA 4C4IA 4DHJA 5CAVA 5FBOA 5IA4A 3FZ1A 2WIHA 1JBPE 2PZ5A 4AQKA 3QRTA 4USFA 4AT5A 3KY2A 3OC1A 4HCTA 4AT3A 3LXPA 4AP7A 5L2TA 4C4HA 1YWRA 2PVYA 3ZZWA 2YM8A 3DB8A 2YCSA 1W84A 5JGDA 3VBQA 3HKOA 4P7EA 4C2VA 1Q24A 3VBVA 1TQIA 5KMMA 3HLLA 4ZTNA 3FDNA 5JN2A 5IMEA 2VGPA 3DLZA 4I20A 4RA5A 4MQ2A 3IOKA 2B4SB 5E8ZA 3AGLA 3CTJA 4MNFA 3V5TA 3F3TA 4PTGA 4BDKA 4BJJA 3TG1A 4FVQA 5D1JA 3EN5A 5EW8A 3W2PA 3GCPA 1FMKA 3H3CA 4K6ZA 4FKUA 4A9TA 4NM3A 2B53A 3IW8A 1BI8A 4QQ5A 3IONA 3COHA 3D2KA 4I24A 3FMKA 4QMYA 4B7TA 4FEXA 1H4LA 1YI6A 3FPMA 3BX5A 3NYOA 2IBGE 1O6KA 2EXCX 4PTEA 2YIQA 4HNIA 3II5A 2G2FA 2O5KA 2XH5A 4OTDA 4FTNA 4AUAA 4FODA 4F99A 1GJOA 3RK5A 4WNMA 4Y85A 5L2SA 4YJQA 4BCIA 2YFXA 1U10A 2ITTA 4MNEB 3KXNA 4NL0A 2AEGA 2J3WB 3AD4A 4IE9A 4ASZA 5AX3A 2J3WD 2A27A 2XEYA 4QPSA 3JY9A 1UWJA 4ACDA 2JDRA 4V05A 3CGOA 4RFZA 1PMVA 1DI8A 3T3UA 4D5HA 4YURA 2CCHA 3JYAA 4U79A 1PXNA 2PU8A 2QOCA 3QCQA 3D4QA 3I81A 4I3ZA 4IB5A 5CU0A 3HMPA 5HLWA 2VTRA 5HX8A 1J7LA 2XNNA 5IQFA 4U5JA 4X3JA 3NFGB 2R3LA 5LVNA 4JJRA 4L3JA 1ZRZA 3QLGA 3DB6A 4D4RA 3PA5A 4G3GA 4KUJA 3CCNA 2UW5A 4V0GA 1IASA 3O0GA 2J5FA 5AP5A 4E8AA 2XRUA 4D0WA 2C5NA 3VN9A 2X8EA 1GZ8A 3OWPA 3QRKA 3ZMMA 3GT8A 4HCUA 3DKGA 3LFBA 2F57A 3DA6A 4ERWA 3CY3A 5HNIX 5D10A 3W1FA 3LVPA 1PF8A 5CAOA 2RFNA 3FXZA 4E5WA 3KL8A 4ONAA 2PMIA 4FTRA 2XAOA 4MD8E 3BZ3A 2V22A 4B4LA 2E9PA 2E2BA 2V62A 5EFQA 2WTKB 2JBOA 4EH9A 2W9ZB 2VWWA 4ANSA 2W5HA 4FV7A 5AUTA 2C5OA 1YXUA 2PVHA 4GKHA 3TZ8A 5M57A 2R0UA 3NW5A 4X2JA 4GFOA 2WTDA 2ZM3A 2X81A 2F7EE 2JDSA 3TT0A 4RSSA 5I5ZA 3KRXA 2QOOA 3R01A 3HO5H 2CKQA 4HVDA 3W2QA 3P79A 5I9VA 2GSFA 1OITA 1WCCA 3LFNA 4BR3A 3IGOA 1U5QA 4ERKA 5AUXA 4QMQA 3R9DA 3V8SA 2IN6A 4CFFA 1YOMA 4N70A 1YI3A 5GJDA 1OECA 3HZTA 1YQJA 2J90A 4IWPA 3G15A 5LMBA 1R78A 4WA9A 1OGUA 3DFAA 3HYHA 3VS0A 3F7ZA 3REPA 3C0IA 3DAJA 2I1MA 2ZB0A 3W32A 3W8QA 4AA0A 3T3VA 1H1PA 1IR3A 2X9EA 3FMJA 2YEXA 3POZA 4G16A 3ZBFA 4QP1A 2H34A 3A7GA 4QMZA 1X8BA 3RTPA 2C4GA 2CHLA 1JPAA 4KRDA 5CWZA 5DR2A 1BMKA 4U81A 2SRCA 2CSNA 3QZFA 3AD5A 4IZ5A 4CV8A 4JS8A 4UALA 3B8QA 3U51A 4GG7A 2R3JA 3DXQA 2AC5A 5JFWA 2XEZA 5FEQA 1YDTE 4XLVA 4YSMA 4AXCA 2ESMA 3OZ6A 5HG9A 4DBXA 1NT2A 3PXRA 1ZYCA 2XIZA 3K54A 4R3RA 3OTUA 4GSBA 5E90A 3SG9A 4EUTA 5ITAA 3WIGA 3FZSA 2BFYA 2HK5A 3LJ1A 3F2AA 2JFLA 3D5XA 3OWKA 1UWHA 2VTMA 4H36A 1B6CB 5GINE 5HLPA 4QMWA 3EN9A 2WOTA 2X7OA 3OD6X 2ITVA 4A4OA 3VS2A 5DYJA 4DH1A 4Z16A 4HCVA 4S2ZA 1J7IA 3HVCA 5L2WA 3EQIA 4IZ7A 1O9UA 4BDEA 1SZMA 5L8JA 2XS0A 5IF1A 2W1IA 4R7IA 3ATSA 4IM0A 3D5WA 4W8DA 5KMKA 2YDIA 2QOBA 4FOCA 3R71A 4U40A 2C0JB 3QCSA 4G6LA 2QOKA 1XH6A 3RWPA 5E8TA 4L43A 3SXFA 4QMVA 1VYZA 5AX9A 2YM6A 4RX7A 2FH9A 1WBWA 5HORA 4KNBA 4EZ7A 1UA2A 1H08A 4BJJB 3U6HA 4C3RA 3MIAA 5HVKA 4BCMA 2ZFYA 1WVXA 3OT8A 4QNAA 2OSCA 4IH8A 4O0UA 4XMOA 3LE6A 4LGHA 4XV9A 5M07A 3GENA 5FG8A 2PE1A 4J52A 3T9IA 4IM3A 4XV2A 5M53A 4GFGA 5EK7A 3E8NA 4D4VA 2OIQA 2B0QA 1JKKA 3DQWA 4BZOA 4D4SA 2B9IA 3DTWA 2B54A 1OUYA 4JDKA 2BZKB 4FIEA 3A4OX 1KE7A 4GEOA 4QNYA 2UZUE 3HP2A 2XA4A 1OB3A 3DZQA 3P5KA 4FTLA 1WBNA 5CALA 2XJ0A 4JI9A 2NO3A 3ORKA 3I60A 3NGAA
chains in the Genus database with same CATH topology
4AAYA 1K9AA 5E1SA 4P5ZA 5HLNA 1W0XC 2JKOA 3ZEPA 1H1WA 4EBVA 4FTIA 3PRFA 4X2GA 3ZFXA 5HNBA 4N4SA 4O0VA 4BTMA 4M68A 3CQUA 2VX1A 3GCVA 3F2NA 1MRUA 4GV1A 3PA4A 3LCOA 4LYNA 5E91A 1QPDA 4F7SA 3AC2A 4GT4A 2V7OA 2VD5A 1ZYJA 2C3LA 2ETRA 3QALE 3T9TA 2IWIA 4FV6A 4X3FC 3QD3A 3LMGA 2VNWA 4IB0A 3EH9A 4IX5A 3T8OA 3VW8A 4BCFA 4EOSA 3O50A 3UIUA 4ZY5A 4F9CA 1ZY5A 4GIHA 4O22A 4V0GB 5EOBA 4BGQA 4EHZA 2VRXA 3GXLA 3GU4A 5IQDA 4MEDA 4MXCA 4NT4A 5K3YA 2WQMA 4MXOA 3F3ZA 4A9YA 3FJQE 4C4MA 4YTHA 3QZIA 3PVUA 4E6QA 3ZXZA 3O51A 4FZAB 3ZUTA 4PF4A 2PMOX 3PPKA 2DWBA 4YJUA 4TL0A 3K5VA 3O17A 2HIWA 1VZOA 2HXLA 3D7ZA 3NSZA 5AJQA 5M4UA 4O38A 2X9FA 4Z55A 4U43A 5BVDA 3OCGA 3MFRA 4O27B 3NZ0A 3NCGA 4RWJA 5CS6A 1E1XA 2F7XE 2VWIA 2BKZA 3IDPA 4FKQA 4JBPA 3E62A 1KE8A 5CYIA 5KMNA 3UP2A 2XBAA 4Q2AA 2I40A 4TYIA 3LW0A 4HOKA 4K11A 2O65A 3QRIA 4H3QA 5EG3A 3JS2A 3AT3A 3OUKA 4G3DA 1H00A 3C13A 5CSWA 1PMEA 4W4WA 5ANGA 5BYZA 2RFEA 3V8WA 4RWIA 3N1PB 3ZM4A 2R3OA 1PXKA 5AAEA 3HX4A 4GW8A 2X2KA 3EYHA 3KQ7A 2PL0A 3G51A 4O2ZA 4YZCA 3RAHA 1M7QA 5JFSA 4DDGA 3RK9A 5HBJA 4IVDA 1H27A 1KV1A 3L8SA 2XK9A 4G3FA 3KIOC 2ERKA 4RVTA 5LXMA 4O7YA 1TQPA 4KS7A 3EOCA 4MK0A 2XKDA 2NRUA 4TNBA 5E8YA 4DG0E 4G9RA 5FEDA 2VO7A 3N9XA 4YHTA 3ZCLA 3A7HA 3AC5A 4H39A 3EQRA 4YP8A 2X6EA 2HAKA 3RVGA 3NNXA 4GK4A 4L9IA 4AZWA 3N1OA 3RAIA 4AZFA 4F63A 1G3NA 4MBIA 3VJOA 2WD1A 4BKJA 4C59A 3MH0A 4WG5A 3QGYA 4WHZA 4FX3A 1U59A 5C4KA 4I0RA 2WZJA 4KIOA 3VUKA 4O84A 4JR3A 4G31A 4M13A 4P4CA 5CSPA 2IZTA 3E3PA 2XMYA 3KKVA 5L2IA 3KRWA 3BHTA 4D1ZA 3G9NA 1Q8UA 1WBVA 2GFSA 2UZWE 3C7QA 5M09A 5EYKA 2XNGA 3MB7A 3OBJA 2GMXA 4MCVA 4MQ1A 3CPBA 4FL1A 3ZDUA 1OI9A 5FM2A 3JVRA 4I4EA 3TKIA 2C6OA 2VWBA 3KA0A 5BMMA 4EL9A 4ZTQA 4Z7HA 3I79A 2GCDA 2OW3A 2P3GX 1G8KA 2R64A 3KC3A 3KN5A 3VBWA 2WU6A 1VHHA 4BBFA 3D15A 2C68A 2I0VA 2VTNA 2FB8A 4UWBA 2YISA 2R3NA 4OX3A 1JVPP 1J3HA 1GZKA 3C50A 3R8UA 5HD7A 2RG5A 2W1HA 4NM0A 2BRHA 4IDTA 4MUSA 1TKIA 3JR1A 5F95A 5LWNA 3ENHA 3FPQA 2WQOA 1OBGA 4XRJA 1DS5A 2W99B 2R5TA 3UDZA 3VS7A 1ZLTA 5A4TA 3IQ7A 1YXTA 3QTRA 5C26A 4R3PA 3IK3A 2B55A 3V5PA 3PFYA 3U6IA 4TW9A 4IADA 3UVRA 1DI9A 4NWMA 3NAXA 3OXZA 3RGFA 1PMNA 1M52A 3CY2A 2XK3A 2WEIA 3BGPA 3DTCA 3MH3A 4FTMA 4O96A 1H0VA 3NW6A 4IX6A 5I9UA 3ZZEA 2GTMA 5L8LA 3BYSA 1GNGA 3Q32A 1IEPA 1FGKA 2YZLA 3UQFA 4YNOA 4I4FA 4D0XA 3C4WA 3BYMA 3OVVA 4ZTSA 4EK8A 3SXSA 3QL8A 3LFFA 2BILB 4AOTA 2PVNA 3K7HB 2XK4A 3FI8A 3QZGA 4HPTE 4EHEA 2J4ZA 5ETAA 2OH4A 5AADA 1IAHA 3LJ2A 4EOPA 2FO0A 4FTKA 4QOXA 2IJMA 5H8EA 3A7FA 3ZUUA 2XAMA 3CSVA 4J1RA 5F94A 4K18A 2UW0A 3C9WA 4GRBA 1AGWA 1H26A 3BIZA 4LOQA 1B38A 4ANLA 4F0FA 2YABA 2XJ2A 3R2BA 5T3QA 2IVSA 5E8WA 3A2CA 3EKKA 3ZS5A 4IAFA 3G6GA 5EM7A 3KXZA 3QLFA 3ALOA 3AC4A 1H8FA 3AXWA 4OUCA 4WRGA 1QCFA 4ALUA 4AXEA 4CT2A 3N51A 2UV2A 1WBSA 3CR0A 4HYIA 1GIIA 4HJOA 4WD5A 3LCKA 3E5AA 5GIPE 4JAIA 3F2RA 2I7QA 2W0JA 2W1ZA 3Q52A 2WTCA 4HYSA 4DF3A 2ITXA 2ZVAA 4CZTA 3K7IB 1F0QA 1JQHA 2UZVA 5CANA 3PVWA 4E4MA 3ZSHA 2ZJWA 3DBDA 2XNMA 3P1AA 1OL7A 3OY3A 3VJNA 2C6IA 2W9FB 2XK6A 4R7BA 2KTYA 2BHHA 5DR6A 2YWVA 2XP2A 2ONLC 3SD0A 4DH5A 4EBWA 5IA3A 3DPKA 5L6WL 1NXKA 5FRIA 4MH7A 2HENA 3F69A 4LUEA 1FOTA 1UU7A 5A46A 4C4FA 2QHMA 3LQ3A 4J99A 4DHZA 3MGYA 3RHKA 5K5XA 4XOYA 2QR7A 3F5UA 3K7GB 3NIEA 3QD0A 2C6EA 3EFKA 2CPKE 5F4NA 4DTAA 3MYGA 1NA7A 3F3VA 4I6BA 4TRLA 4OTRA 5CQWA 4ZAUA 4YHJA 4CNHA 4G34A 5M56A 5D12A 3ZC6A 4X6QC 4OTIA 2E9VA 4BF2A 2IVTA 1FMOE 3NUSA 4AXAA 2GQSA 2HCKA 4KAOA 4LRKA 1OL5A 5JFVA 4R78A 3LFAA 5KMJA 4DEAA 2HZ0A 2XKFA 3PSCA 4X21A 3UO4A 2C3IB 3W2OA 3SA0A 4ACHA 4C38A 3UIMA 1RW8A 2RGPA 5CU2A 5IQIA 3MVMA 2DQ7X 3GU6A 4QTBA 3R9OA 4D28A 3L9PA 3KREA 3AMYA 4MBJA 4M67A 4AZVA 3R30A 4FEQA 2AUHA 3UVQA 5J1VA 3S0OA 5HG5A 3R8ZA 4AN2A 3QUPA 3LZBA 2HZ4A 4C4GA 2IZUA 4CG8A 4USEA 4IQ6A 4EWHA 5KNJA 3NUXA 4N57A 5AFVA 2FSLX 3U8WA 5FGKA 4D55A 4MXZA 4LGGA 2W1GA 2WG3A 3R7UA 2O63A 3A7IA 1P2AA 2KULA 4P5QA 3UODA 5KO1A 4I5MA 3FY2A 5A4EA 4DG2E 2C47A 4YNEA 1CKPA 4UXLA 3HP5A 1WMKA 5HEZA 1UNGA 4G3EA 3EL8A 4BY9E 2P33A 4JDHA 4FL2A 4C3PA 3HAMA 4FKOA 2OWBA 4FSUA 3LCSA 2HOGA 1OM1A 3ANQA 4FEUA 5G6VA 4C34A 5E9EA 3FYJX 4GFMA 4ARKA 5JGAA 4L44A 4O21A 3VF9A 5HNGA 4QMUA 1ZOEA 3H0YA 3WE8A 4BCGA 2JFMA 3KRRA 3W33A 3EQHA 4X2NA 1SMHA 5BVWA 5KKRB 5I9YA 4PNIA 3HMOA 2GFCA 5AM6A 4OGRA 5CZIA 3TEIA 4EUUA 4W4YA 3VW6A 2XF0A 3WZKA 3ROYA 5EDPA 4K8AA 1JKLA 3UQCA 4D1XA 4IZYA 4B99A 2XKEA 3DXPA 5AP4A 4AW1A 2YACA 4EJNA 2IZSA 3FKNA 3FHRA 3FXXA 4MXAA 2W05A 4UBAA 2GQGA 5B0XA 2PK9A 5AP2A 3PSDA 1Y57A 3A8WA 5KCVA 2QO9A 3HAVA 5C9CA 4BDIA 3AT2A 4ZTRA 3R83A 3UZRA 4G6NA 4MWHA 5J5SA 1OKZA 3PJ8A 4MBLA 5M08A 3KB7A 1YXXA 2VGOA 4DA5A 4YTCA 3K3JA 4FA2A 5BYYA 3BLRA 3R1QA 2WMQA 4FTQA 4EK5A 3NAYA 2C1AA 3OOMA 3S4QA 3LLAA 3E88A 4YZMA 4TWNA 1I09A 1R44A 4J97A 3OTVA 1TVOA 5KZ0A 1L8TA 2QI8A 3BBTB 4S31A 4XH6A 4C62A 5CZHA 4D9TA 4NFMA 3MSSA 1OZ1A 4F78A 1FGIA 4TYJA 3RCDA 2NYAA 3A8XA 3WYXA 3ZYAA 5KMIA 1ZAOA 3CGFA 1NW1A 5TR6A 2QOHA 3L8PA 3QRUA 3UG2A 3IPHA 2OZAB 3L8XA 4U0IA 5DNRA 3Q9WA 4UWYA 1GZOA 2PTKA 3DKFA 3OW3A 3V5LA 5BQ0A 1TZPA 3VHEA 5EM5A 4YZNA 4IAAA 2J0JA 2IO6A 4K2RA 1M14A 5CENA 4HPUE 3WF7A 4BI0A 4E5AX 3P7AA 1YDRE 2REIA 3IW4A 3RALA 2OG8A 4XS2A 4HW7A 3S1HA 1DAYA 4FZDB 3U9CA 2XM8A 2UZDA 4LV5A 4PV0A 2GHLA 3KRJA 4HZRA 1R3CA 3ZXTA 1OL6A 4G2FA 3U87A 5DA3A 4IW0A 1OL2A 2QCSA 5EW9A 3PZEA 3TWJA 2VV9A 4RT7A 3PA3A 1YRPA 4C61A 2EVAA 3QKKA 3F66A 5K9IA 5EI6A 3W2RA 3OXTA 4MUQA 4WIHA 3UOHA 2BIKB 2J0KA 3DCVA 1UU9A 3HDMA 5HX6A 3BI6A 3ODZX 3V5QA 1PXPA 3O2MA 3O8UA 4QYEA 1GIHA 3IO7A 4YLJA 2VWVA 5AUUA 3UQGA 3LXNA 4FSWA 2OJ9A 2EXMA 4MHAA 5EW3A 3LMHA 2FUMA 2OGVA 2IPXA 3LFQA 3VO3A 3HECA 2VWYA 2A1AB 2EWAA 3BHUA 4XEYA 1E1VA 1NVSA 3WOWA 4AZEA 5CEMA 4DGOA 4M84A 2GNIA 2YHVA 5D9HA 3BU6A 2PULA 4CLIA 4EZ3A 3VVHA 2Z7QA 4OW8A 3ZM9A 5AA8A 5I9ZA 1PYEA 4IACA 4PP9A 4FVPA 4EQCA 2PZPA 4EI4A 3SRVA 2X4ZA 2BRNA 3FMMA 4OTWA 4U41A 2CKOA 2ITUA 4F64A 1KE9A 1JSUA 3VUGA 3PY1A 3QYZA 4YC8A 2C5YA 2FSTX 4YPSA 3LXLA 2B9JA 5EYCA 5LVMA 2VTLA 3O8TA 4ACMA 4WKQA 4CCUA 5L6PA 1HCKA 2R3QA 3FQHA 3IECA 4IFCA 4WRSA 3VNTA 4RA4A 4QMOA 5DT0A 3OHTA 4FK3A 4CT1A 1IRKA 4OTQA 3CE3A 2Y7JA 2JDTA 3H9OA 4DEGA 5FXRA 3DS6A 4DTBA 3WIKA 4XBUA 5GJFA 1BI7A 5AMNA 3QXOA 4MUTA 3TZMA 4X3FA 4KABA 1XH8A 2IW9A 3MDYA 4O83A 3IDCA 3LKMA 5HICA 3R7VA 4O0SA 1TFFA 3RK7A 1UVRA 3QFVA 2JKMA 4LL0A 4YHFA 4F6SA 4C4JA 3ZC5A 3UOJA 3EN7A 2PZYA 4XLIA 4XG8A 3OWJA 4FIFA 5DEWA 3SV0A 2BAJA 4HGEA 5A9UA 3Q9ZA 3UPZA 3BRBA 2X2LA 4AOJA 3AGMA 4HGTA 3SGCA 1FPUA 1ST4A 4JBQA 3I4BA 4Y5HA 4F0IA 3TKUA 4FG9A 4Y5QA 3LFDA 2WGJA 5IDPA 2YCQA 3LPBA 1ND4A 4L6QA 4EH7A 4JG6A 2W1FA 2FYSA 3R1NA 5JEBA 1KOAA 4RJ3A 3LOKA 4EYJA 2I6LA 4ANQA 2ITYA 3G9LX 3QAME 3RM6A 4BRXA 4QMSA 2HELA 1P14A 2PVRA 4RIWA 2JKKA 5IUIA 5LOHA 4LUDA 3WBLA 4CMOA 3TDVA 4DYMA 2BMCA 3PJCA 3F82A 5GNKA 1V0BA 4A9UA 1YVJA 1MQBA 5CVHA 1VR2A 5K5NA 4DFBA 1J1CA 4ZSEA 5JMSA 4AXDA 4GT5A 4DEBA 2OJGA 3HV6A 4YJTA 5CU3A 2J0IA 2QOFA 3BBWA 4DGNA 4U97A 5ANIA 2F4JA 3BWJA 4UWCA 2ZMCA 4Z7GA 3IDBA 3MH1A 2BROA 4G1WA 3U4WA 4H3BA 5M4CA 3PVBA 4O86A 3NDMA 4LQMA 2EUFB 4UV0A 3W16A 3O23A 5TKDA 5CF4A 5E8VA 3VS4A 1KE5A 3Q60A 4FMQA 1P4OA 2XNPA 3M1SA 3MESA 3PVGA 3ZOSA 5B7VA 4GK2A 1FBNA 4J53A 2BZHB 1ZYSA 4BDFA 4NH1A 5ETIA 2WOUA 4NTTA 4FKJA 3ORZA 3E3BX 4BDAA 5E8SA 5ACBC 4NK9A 4JIDA 1ATPE 2YCRA 2X1NA 3D5UA 3PUPA 3QTXA 3ETAA 4KBKA 4RWLA 5EHOA 4IJPA 4L7FA 3R04A 4FR4A 4XG4A 2YIRA 3QU0A 2W4OA 4L46A 3PDTA 3HRBA 3UVPA 3PJ1A 2YM7A 1XBAA 3QA8A 4IJ9A 2ITZA 2X2MA 1UNLA 3BLAA 4I21A 3ORTA 4CQEA 3Q96A 2C3KA 2NRYA 3BKBA 2IW8A 4IFGA 4RPVA 5EKOA 2E9UA 3MA3A 4AE6A 4I5PA 2YA9A 3UJGA 2NPQA 3A99A 3VUDA 1NVQA 2IVUA 1PYXA 5BPYA 3HV7A 4LI5A 5DT4A 1ERKA 3RI1A 4FUXA 2J2IB 3Q9YA 5B2MA 3MTLA 3KULA 4O2PA 4IIRA 4B6LA 3GFWA 3P23A 5HG7A 2XYNA 2GNGA 4USDA 4KA3A 2BALA 4FYNA 3D2IA 3EFJA 2CKEA 4FT3A 3R9HA 4L67A 4DGGA 2Z7RA 1XR1A 4GVJA 2PZRA 3OXIA 4L42A 5LVLA 5JQ5A 4FK6A 3G0EA 4FVRA 3KEXA 4DFUA 2WAJA 3E8CA 5K4JA 4FNXA 5EI8A 2WTKC 3VUHA 2CJMA 4QDVA 3DGKA 1U54A 4GU6A 4ZTMA 2Z7SA 4NJ3A 2VWXA 1UU8A 2Z2WA 3RINA 5CU4A 5EHYA 1MRVA 2UZOA 3HRCA 2QO2A 4A9RA 4O6EA 3DNEA 5HZNA 2JIVA 5FM3A 2H9VA 5M06A 2OFUA 1P4FA 5FLFA 2XM9A 2B9HA 3R2YA 4I6LA 4ITJA 3C5UA 5DRDA 4A7CA 4KKHA 5IEYA 5ANOA 4CMUA 4J96A 3NVKI 3FAAA 2DYLA 2UW3A 4FKGA 3LM5A 3PWDA 3RCJA 4M15A 1ZYLA 2PYWA 2GPHA 5DIAA 4ZZMA 3S2PA 4EC8A 1QMZA 2Q0NA 3V01A 4MAOA 2WMBA 2C30A 5H3QA 1KUTA 2WO6A 4RVMA 3FHIA 3R0TA 5DGZA 2ITNA 2VO9A 2BRBA 3GU8A 5DRBA 2YJSA 3R9RA 4RBLA 5CT7A 4FKIA 4EHGA 4BCHA 4CTCA 2NNWB 4RFYA 4FTUA 4AT4A 2XNBA 4AF3A 3HMNA 5CEKA 5M44A 5KBRA 4CEGA 2ACXA 4RJ6A 4GH2A 2CGVA 3TTJA 3UNJA 4TYHA 4BYJA 4DGLC 5JFXA 4OTFA 4TZRA 3B2WA 3MBLA 5A4LA 5I9WA 4DN5A 3FZOA 4DG3E 4FIGA 4EK3A 3UBDA 4Y8DA 4ZTLA 5C03A 2X0GA 4FUYA 4PDSA 2WTIA 4FSMA 4FE2A 3ZH8A 1BUHA 3ORXA 5DN3A 2XJ1A 5DOSA 5LJJA 5A6OA 3LQ5A 4I94A 4J8MA 2PUUA 2OIBA 1B39A 4ANBA 5IQEA 3FZTA 4YSJA 3FZRA 2W4KA 1CSNA 4BCKA 5IA0A 3FLZA 3I6UA 4G6OA 1LPUA 4KB8A 4XV1A 3PXFA 4AFEA 1RQQA 1YKRA 2P55A 1JKSA 2LGCA 2XKCA 3R63A 4NZWB 3Q4TA 3UNZA 3TDWA 3W8LA 4PP7A 3MN3A 3NVMB 1YXSA 4U3YA 3MXWA 3PTGA 2F7ZE 2GTNA 2W1DA 5HCZA 3QC4A 2ONLA 3NS9A 4NM7A 2ETKA 4Q9ZA 3OG7A 4O7TA 1BLXA 4RVLA 3VQUA 4KINA 5HIDA 5AV3A 4TWCA 3AKJA 3PPJA 3GBZA 4LL5A 4M69B 1ZWSA 4R1YA 3S00A 3UTOA 5A4CA 5AUVA 3CPCA 5HE1A 5IG1A 5BX0A 4MPHA 2ZB1A 3ORPA 3P5JC 1XJDA 2BFXA 2RFDA 5AV4A 4AFJA 3C4FA 4E20A 3UOLA 3U54A 3JVSA 4WOVA 2X39A 3KXGA 3RPSA 3WARA 3KK8A 3VUIA 3ORMA 4BDGA 2J0MB 4I22A 4EH4A 4MYGA 3V6RA 3D94A 3VWAA 3DDQA 3LXKA 1SVGA 3O7LB 4AGWA 2OFVA 3O7LD 5J8IA 4DHFA 5CTPA 5HVYA 4AGCA 4FV5A 3LIJA 1STCE 1OKYA 3PG3A 3QKLA 5E92A 2GS6A 3IW7A 5E4HA 2OJIA 1XBCA 3CQEA 3DT1A 3NX8A 3F5PA 3ZUVA 5LWMA 5J9LA 3QQFA 3TNPC 4EK4A 3C4CA 2C1BA 3GC9A 5AP3A 4GKIA 3HRFA 3D7TA 3GOPA 2UZEA 4ZSAA 3O5AA 3ZFYA 1R0PA 2BKKA 4FL3A 3HUBA 1UU3A 3UZTA 5AM7A 4FTAA 4WUAA 3SDJA 5EKNA 2WQNA 3VIDA 4N6YA 1Z57A 3V6SA 4FSYA 1XH4A 1LEZA 1PXJA 3R9NA 4IAKA 4JMQA 4EOKA 5TF9A 4HVSA 3BV3A 4E4NA 3FE3A 2BAQA 2XCHA 3BV2A 4R5SA 4V04A 2PY3A 4FEVA 5I4NA 2ZM4A 3ACKA 4JOAA 1VLRA 2Z8CA 4BGHA 3NMUF 4WBBB 4C02A 4ENXA 3GUBA 3F88A 3KULB 3ZO2A 3VBTA 2XVDA 4M8TA 5CNNA 4I6QA 3COIA 4FKRA 4FZFB 5AIRA 5A14A 2HXQA 1JAMA 3FQEA 3OCBA 1PHKA 4IAZA 4WG4A 4UN0C 4QTAA 4YTFA 4RLLA 4EQUA 4FV9A 1WVYA 2YITA 3KFAA 3Q6UA 3DOGA 2PE2A 4DFLA 1Y6AA 5BUIA 3R8LA 4DC2A 1OPLA 3WF6A 4LV8A 3NNVA 5C8MA 5HE3A 5DI1A 3TNWA 4OAKA 3E7VA 3RMFA 3OMVA 2UZLA 4EH6A 3FL4A 2HY0A 5FP6A 2JAMA 2BTSA 4RC2A 5DVRA 1QPCA 5IZFA 3RPRA 2WNTA 2C0OA 3DK7A 1K2PA 2OJJA 1MP8A 3L9LA 2OIDA 4AU8A 4CKRA 3A60A 4KBAA 2PUNA 1MUOA 1DM2A 2BRMA 3PRIA 4AG8A 4BTFA 4Q5EA 2W5BA 4FC0A 5IMXA 3MB6A 3R8VA 3PP1A 5IQBA 4CTBA 4LMUA 1Q61A 4JG7A 3QTQA 2PZIA 1G5SA 4G17A 4IB1A 3TJCA 4ALWA 5CSHA 4BB4A 4BZNA 2XIRA 4D1SA 4EOQA 5LMKC 4O0WA 2O8YA 3V51A 4MXXA 1PKGA 4AN9A 4K33A 3DK6A 4FSRA 5JK3A 5AIKA 2ITQA 5HG8A 4E4LA 3VBXA 5KHWA 4Y73A 4YO4A 2F9GA 4U3ZA 2ZV7A 4AOIA 4M14A 4DTKA 4NYEA 1ST0A 3FI4A 3TV4A 3MFSA 1JOWB 1OIRA 2R3MA 1NVRA 4MURA 3QUDA 3Q4ZA 2W96B 1YHVA 4AE9A 4D9UA 2RKUA 2WTVA 2YM5A 3BL9A 2OK1A 3E8DA 3OUNB 4J98A 4QRCA 3CTHA 4O7LA 4DH7A 4MD7E 3PIXA 3UC3A 3M11A 4R7HA 3O8PA 5CEPA 1Q4LA 3GOKA 4RRVA 4C0TA 5JZJA 3SOCA 1JKTA 3CKXA 4CG9A 1WZYA 2CGXA 3CD8A 3FMNA 3GI3A 4ITIA 2C6TA 3IW6A 4IC8A 1LR4A 2WMXA 4PMTA 3G5DA 3DK3A 3QWKA 4FT5A 5LMAA 1OL1A 1GY3A 4H05A 2GNHA 2BAKA 4U45A 1OIUA 4ZLOA 5J1WA 4NCTC 3QHRA 2C6MA 3BLHA 2WFQA 4K77A 4RMZA 4TNDA 4P2KA 4AW5A 5BNJA 1MQ4A 5D11A 4E26A 3AMAA 1LP4A 5ICPA 3L1SA 4BC6A 1FVRA 2UW7A 4UXQA 4HVGA 4NFNA 3OBGA 4FZ7A 5TOZA 3RJCA 2AC3A 4CFUA 2WTWA 3HV4A 3SOAA 4RJ4A 4CFNA 4ACCA 4DDIA 2WFXA 2IZRA 1NY3A 4F09A 2Y9QA 1UV5A 5EDRA 4ZZOA 3C4XA 4YJVA 5I9XA 2XIYA 4DT9A 3FY0A 3G6HA 4S34A 4YC6A 1FVTA 1XH7A 3HUCA 5IEVA 5CT0A 3PLSA 4J7BA 5KHXA 2O64A 3FSFA 5M4IA 2XB7A 5H8BA 4AACA 3DDPA 4WNKA 4M97A 3M42A 4JT3A 3RPOA 5EM6A 3TNHA 3W18A 4DFZE 5AEPA 2W17A 4L45A 3ZBXA 2XK7A 3QYWA 4I5CA 3HMMA 4GL9A 2VTQA 3TV6A 4RQVA 4BCOA 4OXDA 3KMMA 4O7NA 2JAVA 4EHVA 1W98A 4MD9E 4OT6A 5GIOE 4HYHA 1E9HA 2PPQA 3RAKA 3WF9A 5IDNA 4QMNA 3EJ1A 4UZDA 5B2KA 3S95A 4F08A 3BYOA 2QG5A 1M7NA 2ITOA 2WMSA 2ZDTA 3F3UA 3OT3A 4FV8A 3QQUA 4L3PA 3MVJA 4JXFA 4QP6A 4ZOGA 4IAIA 3AKKA 4QMLA 3KF4A 2DUVA 4QT1A 3O71A 3E92A 1REJA 4ZLYA 3BU5A 4PQNA 5DFPA 3TXOA 1WBOA 3NUUA 4U9AA 3TN8A 1W83A 3R1SA 4QTCA 4MWIA 3PP0A 3RHXA 2QOIA 3SVVA 3DKOA 2V0DA 3NNWA 3R7EA 2QNJA 1U5RA 3HMIA 1OBDA 2WXVA 3BCEA 3I6WA 3ORIA 5KMOA 3Q9XA 4QO9A 5IISA 5IUHA 2QO7A 3EL7A 4FV0A 1ZOGA 4PDPA 3W0SA 3SXRA 4D2RA 5CEOA 5C4LA 2C6KA 2O2UA 2H6DA 2OF4A 3FLWA 4OR5A 2CNVA 5AV2A 2YIYA 3KCFA 3QTSA 2UW6A 3PUFC 2QC6A 3A7JA 4HZSA 4IWDA 2J51A 3MV5A 2W4JA 2QOQA 1FVVA 1ZMVA 4BI1A 4YR8A 2OO8X 2YAAA 4BBEA 4F6WA 5AP0A 3UYSA 3BGQA 3ITZA 2X7FA 3ANRA 3CD3A 5ACKA 3IG7A 1BL7A 4R5YA 4PL3A 1H1QA 3DXNA 2R0IA 3PSBA 5CEIA 4E5BA 4CXAA 2Y4IB 3N4UA 4MNEA 4APPA 4F70A 4EOOA 3QC9A 3N1RA 3KVWA 3E63A 5FEEA 5AA9A 2PHKA 4GG5A 1PXMA 1V0PA 2VUWA 1OKVA 1Q5KA 2ETMA 2JD5A 2QODA 5KZIA 4OX5A 2CCIA 3EQDA 3TUBA 5FTQA 4GU9A 3TZ7A 3U9NA 2W06A 1U4DA 3DBEA 4RX5A 5A4QA 4YTIA 4EQMA 2ZV2A 1QPJA 2O3PA 3DU8A 3VF8A 4EOLA 5AUZA 4FTCA 3PXZA 3LAUA 3LCTA 4ZLZA 2PWLA 4EONA 4F7LA 5C8NA 3EN6A 2X6DA 2YDJA 1WAKA 4ZMFA 5F9EA