4F78A

Crystal structure of vancomycin resistance d,d-dipeptidase vanxyg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
251
Chain Sequence
GMMKTIELEKEEIYCGNLLLVNKNYPLRDNNVKGLVPADIRFPNILMKRDVANVLQLIFEKISAGNSIVPVSGYRSLEEQTAIYDGSLKDNGEDFTRKYVALPNHSEHQTGLAIDLGLNKKDIDFIRPDFPYDGICDEFRRAAPDYGFTQRYARDKEEITGISHEPWHFRYVGYPHSKIMQENGFSLEEYTQFIKAYLEDNKYLFEQAHRAEIEIYYVPAKDDKTLIKIPENCVYQISGNNIDGFVVTIWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords D,D-dipeptidase/D,D-carboxypeptidase
publication title Structural basis for the evolution of vancomycin resistance D,D-peptidases.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 71
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02557 VanY D-alanyl-D-alanine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.180 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f78A01
3.30.1380.10 Alpha Beta 2-Layer Sandwich Muramoyl-pentapeptide Carboxypeptidase; domain 2 Muramoyl-pentapeptide Carboxypeptidase; domain 2 4f78A02
4OX5A 3N1OA 4NT9A 3K7IB 2WFQA 4C4MA 3K7GB 4MUSA 4MUTA 3N1QA 3N1RA 1TZPA 3N1GA 4OAKA 4OX3A 3D1MA 4MUQA 2VO9A 3K7HB 1LBUA 4C4NA 2WG4A 5HNMA 1VHHA 3MXWA 4MPHA 3N1FA 3K7JB 1U10A 3N1MB 1R44A 4F78A 4MURA 3M1NA 3HO5H 4JIDA 2WFRA 4OXDA 4D0YA 2IBGE 2WFXA 2WG3A 3N1PB
chains in the Genus database with same CATH superfamily
4F70A 3BPRA 4BDGA 3F2AA 4GJ3A 3VS6A 3LFSA 3HMNA 4BYJA 3RJCA 2JBPA 3A7IA 4GMYA 4M12A 3RNYA 2O2UA 1V0PA 2YABA 2CN8A 2EB2A 2NRYA 2R7BA 5CU2A 2Q0BA 1JQHA 1W0XC 2BFYA 4F6UA 2C6OA 4JVGA 3GFEA 4O0YA 3FPQA 1ZMUA 2UZUE 3ZO1A 2PUPA 4L42A 4FV7A 4D4YA 2XNPA 4H39A 4O7VA 5CZHA 3RI1A 1Q97A 2UW7A 2YZAA 3OP5A 2JIIA 2BIYA 2JEDA 3NSZA 5J87A 1Q3DA 2BZJA 3BE2A 2GHGA 2R3MA 4C4FA 4ZS0A 3CE3A 4RJ5A 4EOIA 2ZJWA 2XNNA 4ZAUA 3QHRA 2XJ2A 3K5UA 3VNTA 1JBPE 2R7IA 5BYYA 3H9FA 4CZTA 2GS2A 4JDHA 2JBOA 4JBPA 3ML1A 3HMIA 5CSHA 5FP5A 5J5SA 5LQFA 2PVRA 3HA6A 4AZSA 5I9YA 3A4OX 3N9XA 5AP3A 4AT3A 1U54B 2YA9A 4IFGA 4C7TA 3WZEA 4RIOA 1GOLA 2VGOA 1R78A 2GNIA 3BEGA 3ZSGA 4GUBA 3R8MA 1UNHA 4QPAA 5K3YA 5ANEA 5JRSA 5IUGA 4ITJA 4WNKA 5D9HA 3QKKA 3BGQA 4EOPA 4CFWA 4BBEA 4TYGA 4TRLA 3OXIA 2XIXA 3UDZA 4YMJA 3DGKA 4I4FA 2PZRA 2YN8A 4EK4A 4PDPA 3RAIA 2XNBA 1DM2A 3FZ1A 1OGUA 2QOQA 4XG8A 2GU8A 3G0EA 4P2KA 2J2IB 4A4XA 4IM0A 1EH4A 4HPUE 3Q5IA 3RK7A 2JKMA 4YZ9A 2Z60A 3JVRA 3NEWA 3E7OA 1OKYA 4X3FB 3C4ZA 1Q8UA 4OT6A 4XLVA 4HPTE 4YHFA 4BKJA 3TYKA 4YZMA 3TNQB 2ITNA 4NTSA 4L43A 5HBHA 3UP2A 5AV3A 3TIYA 5DI1A 4JJRA 1IR3A 5DR2A 3TKUA 3VVHA 4CV9A 5CI6A 5K5XA 3JVSA 5EDPA 4HNIA 3L9MA 4I5PA 5L2SA 4HNFA 3HEGA 2Z8CA 3P5JC 5AAGA 5LCJA 4O7LA 4ZZOA 4FEUA 4DG0E 5M06A 2A2AA 3ZRKA 4RIXA 3ZO3A 3C4WA 3PY1A 3QZHA 4UWYA 3BWJA 5TO8A 4IX6A 2C5YA 2NRUA 4OTGA 5FRIA 2X7GA 1ZYCA 2WMQA 3PJ2A 3GNIB 3I7CA 5ETAA 5LCKA 3SD0A 3VC4A 2VV9A 4GVJA 1ATPE 4B8LA 4KBCA 2HWPA 2XKDA 3LXLA 3QX2A 3GQLA 4C02A 3KXCA 4U7ZA 3L1SA 4PUZA 2BALA 5KHWA 1M14A 3QU0A 2IPXA 3UZTA 4R3CA 2WTDA 2R3PA 2YCFA 2X9EA 3N1PB 2ZYBA 3VN9A 3DLSA 4BIBA 2GNJA 1SM2A 2PVHA 2OIBA 4F0IA 2QODA 1FINA 1M17A 1YI6A 4FGRA 3UO6A 5BYZA 2JFMA 4PNKA 2X81A 2OZOA 4W4YA 2FO0A 4IWQA 2OZAB 5H8GA 3SXFA 2C3KA 2E9NA 4IB5A 4ACGA 4E6AA 1XBAA 3H9OA 1OB3A 4J98A 3Q53A 2CSNA 5HTCA 2QOOA 1ZAOA 3PPZA 3W0SA 4F9YA 5AA9A 3Q5ZA 5FM3A 3JS2A 3WIGA 5J1WA 3VO3A 1GIJA 3WZKA 3KVWA 3AC4A 4IZ5A 2IVSA 3V01A 4P7EA 4Z7HA 5H3QA 3QZGA 4FICA 4EH4A 5K4IA 3P7CA 2QO7A 5E91A 5FEEA 2CN5A 2JD5A 3MIAA 4BCMA 4K18A 3DXQA 3BL7A 3G6HA 4O0UA 3AG9A 1PYEA 3MFRA 4Y5QA 3QYWA 4FODA 4P4CA 3R30A 1ZOHA 1L3RE 3FMEA 1S9IA 5L3AA 2C0JB 2BKZA 3VBYA 3VUGA 2WD1A 3E7VA 3S95A 2WG4A 4FNWA 5EQEA 3QRJA 3TV7A 3ZSIA 4MX9A 4F99A 3OCSA 5JN2A 3BQCA 1B38A 4GJ2A 2J5FA 3G33A 3MXWA 5IA2A 3PA5A 5D11A 3K54A 4DH5A 5CAQA 3PIZA 4MCVA 3UVPA 2CCHA 5DOSA 1ND4A 3VJOA 3MIYA 1H25A 5DT0A 3TNPC 4OGRA 2QOKA 3SOAA 4BCHA 4TYIA 3GU4A 4D9UA 3KRJA 2IN6A 1H08A 3IPHA 4FZ7A 4JRVA 4P5ZA 3IK3A 5CXHA 4BDHA 3S2PA 1OUYA 2XM9A 4II5A 1VR2A 3R8PA 3ZM9A 1J1CA 5AP4A 1KSWA 4V01A 2E9UA 3UGCA 4F9AA 3UC4A 4BIDA 2EVAA 3PJ8A 4FIGA 4PL4A 3L8PA 4FUXA 4AZVA 3KVXA 1CKIA 3MJ1A 5KZIA 4BTJA 1Q8YA 4CD0A 3F82A 2IZRA 2W9ZB 3UC3A 2CKOA 3BI6A 4PDOA 4U6RA 4ZSLA 4FKTA 3GT8A 4L01A 2BZIB 3K2LA 5HE2A 2GDOA 4AW2A 4JNWA 1LUFA 2ONLC 2C5OA 3R7UA 1H24A 3FY2A 4GT3A 4KABA 3AMYA 2VTPA 3LFDA 4CQEA 5FM2A 2X6DA 4A07A 3VF9A 4NM0A 4FSQA 2OKRA 4IM3A 3DBFA 4FSMA 3LFBA 3P08A 1SMHA 4IAZA 4MUSA 2OGVA 3E63A 3D7TB 3HGKA 2BJNA 2CGXA 3O51A 2ZB1A 3D5XA 3PWDA 3EQIA 4EORA 5EYKA 2OXYA 5CLPA 2PPQA 1SZMA 3R01A 2Y9QA 1P4FA 5KCVA 4YJUA 3CD3A 3OMVA 3GGFA 3RPOA 2XIYA 5DN3A 2BZKB 4QP1A 3D0EA 3OTUA 3E93A 4FT9A 3BHVA 2WIPA 4FYOA 1FPUA 3E92A 1ZOGA 3R9RA 4I6LA 2XA4A 4DHZA 1H4LA 1U54A 5M4IA 2I0HA 4H1JA 3O8PA 1URWA 1XHAA 3V6SA 4IWPA 4IAFA 4RSSA 4AUAA 4BDFA 4R3RA 3UIXA 3N4UA 2CKEA 2YIWA 1H0VA 4QDEA 3TDWA 3UODA 3MY1A 4HVIA 2CMWA 3TWJA 2XALA 4EUTA 3CEKA 2P0CA 5I5ZA 4OTRA 2BAQA 4R5YA 3R8ZA 2X2KA 3PPJA 3DA6A 3NIZA 3A8XA 2VNYA 2WB8A 4BHZA 4E73A 3RMFA 3Q4CA 5IQHA 3T9IA 3IOPA 3DJ6A 1H1RA 2Z7LA 3BV2A 4TYHB 5LMKA 3BIZA 3ERKA 2OXDA 4LRKA 3MVMA 3BHYA 4DT8A 4RX9A 3GU5A 4RWIA 3AT3A 3EN6A 4GRBA 5CF4A 4DGOA 4YUQA 2VN9A 2P33A 1GY3A 4USDA 4GG7A 1LEZA 4PMTA 3PIYA 3V5LA 2J4ZA 4ANBA 3OXTA 3MVJA 2XKEA 1WMKA 3LFFA 3ORIA 2X1NA 5EFQA 1WC9A 3SAYA 4QQJA 2VTMA 1H0WA 2UV2A 3SOCA 4D4RA 2XK8A 4RA5A 4RJ8A 2IW9A 3L8SA 1TZPA 4ZTQA 4MQ2A 5AADA 4YU2A 4QMOA 5M08A 4F1OA 3EQDA 4QNYA 5E1SA 4C4EA 3AMAA 1YVJA 3QL8A 4K77A 2GSFA 5FLFA 1JKLA 3VHEA 2QONA 2O64A 2HENA 2XS0A 3W0RA 4I23A 3FBVA 2A4LA 4RVLA 4ZEGA 2J6MA 5DWRA 3WILA 1ZYSA 4FTAA 5KMOA 3QRUA 4BJJB 3OEZA 5F1ZA 5AV2A 5HU9A 1ZYDA 1Q41A 5AV0A 3RGFA 2WG3A 3DKOA 1NVQA 3DKFA 3P9JA 1NXKA 3VW6A 2VWXA 2HZ4A 2R0UA 4QYFA 4L52A 1ZY4A 3FAAA 3LJ1A 5D12A 3BV3A 2VO6A 4IQ6A 3FYJX 1FVTA 1Y8GA 3EFLA 2GQGA 4MXOA 5DYJA 3H0ZA 5BUEA 4RWJA 2PTKA 2CCIA 4S31A 5IQBA 5KE0A 3NYVA 3KMWA 4RC4A 3MYGA 4I1ZA 3RWQA 4OTQA 2PVNA 2VTIA 3ID6C 3IKAA 4AFEA 5AA8A 5A9UA 3VBWA 4E20A 2HK5A 4HYUA 4EI4A 3KMUA 5CALA 4JQ8A 3NYXA 4L46A 4RIWB 5EDRA 3QUDA 4AXAA 4YLLA 4E5AX 4DYMA 5GJFA 1UU7A 4RX7A 4MBIA 3A4PA 4I93A 5E1EA 3Q04A 2WTVA 1UU9A 5AAFA 5L8LA 2XAMA 4HVSA 2XNMA 3LMGA 3POZA 2OG8A 4O2ZA 4FK3A 5HNGA 3WYYA 4O83A 1ZOEA 3D9VA 4F6WA 3FXWA 3HL7A 2WMVA 1A9UA 2CHLA 2C6DA 2LGCA 3FKNA 4IX5A 3QTIA 4JDIA 4IAYA 3A62A 3M11A 1S9JA 3OUKA 4N57A 3WE8A 3ZXZA 4E4LA 4QT1A 5L2WA 5AV1A 4GS6A 1Y91A 2OFVA 2C0JA 3DOGA 1E1VA 1Z57A 1YI4A 1B6CB 3RAKA 3BWFA 4D4SA 3QTSA 5E8SA 5JZNA 4O0TA 5HHWA 4O82A 1BMKA 4MF1A 3FZRA 3TG1A 4BIEA 2QR7A 4DGGA 5JK3A 3LCSA 3OF0A 4FKJA 4B9DA 2Y8OA 3FLWA 2F7EE 4WBOA 3UZPA 5CAUA 2QU6A 3PVUA 4YJVA 2WMAA 3OCGA 4YHTA 4CV8A 3FLSA 3DBQA 3LOKA 4ALWA 2W1ZA 3GEQA 4YR8A 2EXCX 3UMXA 4RC2A 3R8VA 1KE9A 5TOZA 3Q32A 3GCUA 2YCQA 2YZLA 3QUEA 5CVFA 4MNEB 4L68A 3N4VA 3M1SA 1H1WA 3QTZA 5C1QB 2X4FA 3AT4A 4H3BA 5EM6A 4NFNA 1H01A 4QQTA 3GC9A 3I81A 4XRLA 4XOZA 3QGYA 5E8UA 4CGAA 3SLSA 4I20A 2G2IA 3ULIA 3NWWA 3I5ZA 4K9YA 5DH3A 5DNRA 4FEXA 3W2SA 4RZVA 5I9XA 5TKDA 3HAVA 2F4JA 5CASA 4O0WA 1Y6AA 4EHEA 4UB7A 2O8YA 3BU6A 3G9NA 4XG4A 4FZAB 3RCJA 4XG9A 4D2RA 5HE3A 3C1XA 1SVHA 2QQ7A 4LV5A 4OTHA 3W0PA 1VHHA 3NUPA 2CJMA 1YXXA 4L44A 4GU9A 3D15A 2YITA 1J1BA 4ZSEA 4RQVA 5C9CA 3OT8A 5BVOA 4ZLYA 2VO7A 3NAXA 4RC3A 1IEPA 3UYTA 3P7BA 1PW2A 5HLWA 2IBGE 4FKRA 4W8EA 3VS2A 2BDWA 5J9LA 1BI8A 3KL8A 4HYSA 2EU9A 4XHKB 3Q4ZA 2XJ0A 4R1YA 4FTIA 4RIYB 3VUIA 5IF1A 3HKOA 3W10A 1SNUA 3MH2A 2BTSA 3UQGA 5DEWA 3QYZA 3HUBA 4YJRA 2QO2A 2GPHA 2X8IA 1E1XA 4K2RA 5LWNA 3Q6UA 1ZLTA 2QU5A 4M15A 4WOVA 3LQ5A 2IW8A 4DEBA 5HCYA 3ZFMA 3F3VA 3DLZA 4PMSA 3TZ7A 3MW1A 4FT3A 4UALA 4XBUA 4LG4A 4F4PA 2R3HA 3LLAA 4TL0A 4GKIA 2XIKA 4O81A 3I79A 3WZJA 3TZ9A 5L6PA 3RP9A 3DAKA 3QQJA 5H9BA 4DITA 4O6LA 3CC6A 2VX0A 4TYHA 1B39A 3AKKA 1AQ1A 3ZC5A 4ONAA 4V04A 2XNGA 4EOLA 3LHJA 4NCTA 3A7GA 3LM0A 1IASA 2VTNA 3MJ2A 4TXCA 2BPMA 4G9RA 3ENMA 4NWMA 4QP7A 5CU4A 3DXNA 3ZOSA 4DDGA 3BZ3A 4ZIMA 3POOA 5M57A 3V5QA 4DEDA 5HE0A 5HORA 1T45A 3UOLA 2WTKB 4NW6A 4GIHA 1PF8A 4EJNA 4DN5A 2C4GA 2WMBA 2JAMA 2VD5A 2VWWA 2ZV8A 5CSXA 1WC8A 3MB7A 3UNKA 4RFYA 4BVUA 1P2AA 3KEXA 3P78A 2UW8A 2WHBA 3HYHA 4BCOA 3IGOA 3VS3A 5K5NA 5KBQA 3E8NA 5CQWA 2HYYA 3PA4A 4W4XA 2WELA 4FOBA 4FVQA 3QXOA 4A4OA 2YISA 3BYUA 4GK3A 4BJJA 5HG8A 3K7HB 3FLNC 3NW5A 4AGCA 4C0TA 2REIA 4I94A 2YEXA 2IWIA 2I6LA 3MESA 3AD5A 2NYAA 4LOQA 3R9NA 4CSVA 4FVRA 1W82A 4J7BA 3TACA 4G6OA 3FQHA 4HCTA 3EL8A 3R7OA 3PSDA 4FA2A 4U80A 3UDSA 3D7ZA 4EH7A 1YDRE 2PUIA 2PHKA 5HLNA 4DAWA 3I5NA 4JQEA 5HG5A 5CT0A 2R3LA 2QKWB 4C38A 4ACMA 3EZRA 1ZRZA 2R9SA 3QHWA 5E8ZA 1Q99A 2WMUA 3CIKA 3PJ3A 1KE6A 2GFSA 2UUEA 3FL5A 4FTJA 5HKMA 4RIWA 1Q24A 5L2IA 2IJMA 3HRCA 4BCKA 4I24A 4NH1A 1M7NA 2R3OA 1IA9A 2PMOX 4AA4A 1KV2A 4O7RA 2FUMA 2QG7A 2J51A 3K5VA 4GUEA 4C36A 4CTCA 4FKGA 4FTKA 4I0TA 2ZM3A 4LFIA 3RHXA 3AXWA 2BROA 1H1PA 3OWJA 5JGBA 2ZM4A 5CEPA 1V0OA 5AWMA 2PSQA 4WBBB 4FKPA 3UG2A 4V05A 4AZEA 4XG2A 4PV0A 2F9GA 5FBNC 3EFJA 3B8QA 4DEEA 3TEIA 2HZIA 4EQUA 2W0JA 3CD8A 3OWPA 2A27A 3P79A 3LXKA 1LEWA 5F20A 3T3VA 3D2IA 5ANKA 1I44A 2PYWA 3MH0A 1P5EA 1PXIA 4KBKA 4JX7A 4EOJA 3DDQA 5A4QA 2EUFB 3H4JA 2B9FA 3LJ0A 2W5AA 4Q9SA 4EL9A 5I0BA 4MXCA 3FPMA 4JLCA 3DNEA 1UNLA 2J50A 4FL2A 4PDYA 4W8DA 5HBJA 4U0IA 4DFLA 3PXFA 3COKA 2C6IA 4U81A 5JFWA 2XH5A 3HV6A 4MNEA 4AA0A 1OGYA 3MB6A 4ENYA 2A19B 4QMVA 4O38A 4U42A 3TNHA 2VUWA 2R2PA 2UZDA 1BUHA 3OFMA 4JDKA 3OOGA 3VWAA 4A9UA 5L8KA 3A7JA 1ZZLA 3PXKA 4PMMA 4FI1A 1WBPA 2OLCA 1Q3WA 4FUYA 3K7JB 1W7HA 3DU8A 4YLKA 1JKSA 1ZYJA 1IAJA 1PY5A 1WFCA 2XK7A 3QQUA 1DI8A 4EWHA 3HECA 5CU3A 4HVGA 2IG7A 3QQGA 1JNKA 4IDVA 2V55A 2NP8A 3AC8A 5KKRC 3E8DA 5CF8A 3GCQA 1TVOA 3VW8A 3BYSA 1J91A 3C5UA 4LI5A 4W4WA 5JGAA 1WAKA 1WCCA 2ZOQA 3MTFA 3GC7A 2ZV2A 1KE5A 3HDNA 3QALE 3VAPA 2W7XA 4QMWA 4YO4A 4ZLZA 4WUAA 4BDBA 5LVMA 2JDVA 3SW7A 3N1GA 2Y4PA 3TIZA 4ASDA 4IZAA 4G3CA 1P4OA 3CUED 4NW5A 5EYCA 5LXMA 4O2PA 5D7VA 4MPHA 5BVNA 2H9VA 4RIYA 2ZMCA 4HGTA 4LQMA 3O0GA 4EQCA 5EI8A 1O6KA 4MEDA 4FEVA 3D2KA 3ETAA 2BRBA 3R71A 4WNOA 5M4FA 4BCGA 2YACA 3LIJA 2PWLA 2AYPA 3FKOA 4DH8A 1G5SA 4X6RA 2WMWA 1YHWA 2WPAA 3PRFA 3SKCA 3ZLWA 1YWNA 4AA5A 3F5UA 4N6YA 3FZOA 2BRMA 1M2PA 4RJ3A 4CVAA 1QPJA 4NU1A 1H28A 2UW6A 4GEOA 2Y6MA 2CKPA 4J8NA 4EHGA 3QCQA 2YWPA 2QC6A 4P5QA 5JGDA 4M97A 3DQWA 3H9RA 4EOSA 3UQFA 4U8ZA 3QKLA 3TV4A 4M7IA 4IWOA 4FV8A 5C27A 2PZYA 3VUHA 2X0GA 5B7VA 3OW4A 3VUKA 3ALOA 2JFLA 1OBDA 2WMSA 4GCJA 4FTQA 4HGLA 2JDOA 4CTBA 2IVUA 5DHJA 5HBEA 4AN3A 4DFXE 4LRMA 3RZBA 4F08A 3KULB 3BRBA 3ZRMA 4ANMA 3FHIA 3U6JA 4D5KA 2E9PA 3R02A 4G3GA 1G8KA 4KKHA 3QUPA 3UOHA 3PSCA 4EZ3A 5J9YA 1TQPA 1Y57A 1VYZA 1YXSA 3LAUA 4KKEA 3WI6A 5EM7A 3NJCA 4FKUA 1M2RA 2GQRA 2XAOA 4FV1A 1G8JA 2ERZE 1SNXA 4PTCA 2XARA 5M4UA 3OXZA 4AW5A 3EN7A 3IONA 2FSOX 3MTLA 3NAYA 4GFMA 4O0SA 5H8BA 4EK5A 4WG5A 4IAKA 2AC5A 4TWPA 4F7LA 1RJBA 4FZ6A 4EKKA 4IC8A 4QTAA 2CNUA 5CQUA 3UIBA 4JI9A 4QMLA 3K3IA 4DEAA 4KNBA 3DKGA 4XV1A 4M67A 3IW6A 3F2NA 3IQ7A 3NNVA 3R04A 2WEVA 3NUUA 4APCA 1XH5A 4LGGA 2OJIA 3L9LA 2QOFA 3BHUA 3FMJA 2OIDA 4JG6A 4OTDA 4R5SA 3O50A 1ZY5A 4XP2A 1GZ8A 3RPSA 1Y8YA 2ITPA 3R0TA 2VTOA 2R3QA 1FVRA 5E92A 4J97A 4RX5A 3DK7A 1H1SA 2P2HA 1NW1A 4KUJA 3R7IA 3ET7A 2CNQA 3HUCA 1YOMA 2Q0NA 4KRDA 4NSTA 4QMPA 4XLIA 1CSNA 4D9TA 5A6OA 4JL9A 5LMBA 5CWZA 2V22A 3QA0A 3QCYA 4FEQA 4CT1A 4DTAA 2PZ5A 2Z02A 3VS4A 5EI6A 5K9IA 3C4XA 3FDNA 5HX8A 3OHTA 1DS5A 2YFXA 3RALA 1Z9XA 5CXZA 4C2WA 2XIZA 4X2FA 3H30A 3KXHA 3R1NA 1JSUA 2WAJA 4IC7A 1YWVA 2GHLA 4F63A 3NNXA 3ZDIA 1JVPP 3EYGA 3DKCA 1WVYA 5J1VA 4OUCA 4X2GA 5TT7A 3MSSA 3QTUA 3ACKA 5I9VA 2UVZA 3VBTA 2J0LA 2J0KA 4QMSA 2G1TA 1O6YA 2QI8A 1ST4A 2B55A 1IG1A 2F2UA 1XH6A 2DYLA 2VTAA 4QNAA 2GS6A 3QAME 2BAJA 5HICA 2YIRA 4KIPA 3HLLA 4FNZA 3V5PA 3BE9A 4YJSA 4DHIB 5LOHA 3EYHA 4WD5A 4NJDA 3MPMA 3MBLA 1PJKA 4E1ZA 5ANOA 2I0EA 2A0CX 4UEUA 2WQMA 4Y83A 2UZWE 5EHLA 4DTBA 1IAHA 4FKSA 3DBEA 4KAOA 4B6LA 3CGFA 4BICA 5JT2A 4I5MA 4TWNA 3N1RA 3Q2MA 1SYKA 2V62A 2XCHA 2R3JA 4XP0A 3ZUUA 1PYXA 1NY3A 4L45A 4C37A 4ZY5A 4UYAA 5EW3A 4EUUA 1WBVA 3DK3A 4DE4A 2FH9A 2V7OA 1ZXEA 3RNIA 3OOMA 4S32A 3ZEPA 4QYGA 3IW5A 5CVGA 4FG9A 4QRCA 4BDCA 3NYNA 1U4DA 2H34A 3ROCA 4YZBA 4EBVA 5HTBA 3OEFX 4D0YA 4QTDA 2BTRA 4QO9A 1MRUA 2J3WD 5HGIA 1DAYA 4YLJA 3V8WA 2BUJA 1BYGA 2WMRA 2W4OA 4G3EA 3ROYA 2ZVAA 4GT4A 2C6KA 2VTSA 3MDYA 2OFUA 3W2OA 3QRIA 3CCNA 1MRVA 2W5BA 4CLJA 3CLYA 4FSYA 2J5EA 2H6DA 2J9MA 4AWIA 4W4VA 4R7BA 4YTCA 4FSNA 5LMKC 2ESMA 3M42A 3R1YA 4KIOA 4AXCA 2UVXA 5EG3A 2C68A 3DBCA 4BDIA 5CEQA 5M09A 4YURA 3UDTA 2ETRA 4ENXA 4WKQA 3V04A 4D1ZA 3UOKA 3UP7A 3RK5A 3COHA 3L8XA 5HVYA 3RVGA 4DCEA 5EKNA 4EH3A 4R7IA 5HU3A 2OK1A 4FL3A 2VGPA 4X21A 4G31A 2G2FA 2OF2A 3V5JA 4NT9A 3G15A 3U54A 3DZOA 5BVDA 1UKIA 4HGEA 3LXNA 2R5TA 4ZTSA 3ZLYA 4DA5A 2C69A 3UPXA 4KSPA 2OJ9A 4BCJA 3GFWA 2Y6OA 4QMMA 4M14A 4TTHB 5E8WA 3SGCA 3NZ0A 2G2HA 2BKKA 3O96A 3FE3A 4R77A 2YM5A 3GXLA 5AX3A 2QVSE 2V0DA 2ZMDA 4I6QA 2X7FA 5EQYA 3W32A 4FSWA 3QLFA 3THBA 5CY3A 3VS1A 4AXFA 2ZB0A 2JKQA 3R1QA 4MD7E 2C5XA 5IQAA 3D5UA 1QCFA 3QQHA 4DFNA 4FZDB 5LVOA 3SDJA 4BI2A 2OIQA 2JAVA 4L6QA 4DHJA 2O65A 3S3IA 3HX4A 3FJQE 4GG5A 3AOXA 5DBXA 5L8JA 3WF8A 2PVKA 2X2MA 4CLIA 4D0WA 1MRYA 3GCPA 3I1AA 4FTTA 3KULA 3D4QA 3NUYA 4WG3A 4PP9A 3KQ7A 1OMWA 4QQ5A 3U9NA 2R3GA 5JSMA 1RQQA 3OWLA 5HESA 3CGOA 4WUNA 4Z7GA 2GTMA 4OW8A 1UWJA 3FXZA 3V3VA 3QZFA 3QX4A 2X6EA 3C4CA 4BR3A 4DH7A 4XMOA 4C3FA 3DFCB 4YNEA 5M55A 2CNVA 4ANLA 3ORXA 2XYUA 3IDCA 3NUNA 4AZTA 3CQUA 4EH6A 4FV3A 5FTOA 4QMNA 3U6IA 4I6HA 2ITOA 3DK6A 4TYJA 5CTPA 3VRZA 4M69B 3VBQA 2HZ0A 4R1VA 2BRHA 3HV4A 3UJGA 3VJNA 4KS8A 3NYOA 3QQFA 2B7AA 3MGYA 3LCKA 1LP4A 4JBVA 5CSPA 1QPEA 3G51A 5B2KA 4N4SA 4NM7A 5J7HA 3ATSA 3F3UA 4CCUA 3EQRA 4RFMA 1JAMA 3QWJA 4M8TA 2FSLX 4APPA 3ZC6A 3R7YA 4IE9A 4F7JA 2QHMA 4QMQA 2OJGA 3ZUTA 4E93A 3Q9XA 4J95A 4IMYA 3W33A 1U5QA 1Q4LA 5C8NA 4PMPA 2R3RA 4JXFA 3FMMA 4FV0A 4KWPA 3UO5A 3WF5A 2OU7A 1XWSA 3F6XA 4AZFA 3COMA 3ZUVA 4X3FA 3AQVA 2VO9A 3FL4A 3KRWA 2B53A 2P55A 2XEYA 2JIVA 2QOLA 3FC1X 3KXZA 3NMUF 3MWUA 4A9SA 4L00A 3ULZA 2W1FA 3FMDA 2I0YA 2VTLA 2XVDA 2YM3A 4X3JA 3LCTA 3PP0A 4R7HA 5EOLA 3NUSA 4U40A 3EKNA 3ZO4A 1BLXA 4BGHA 2XEZA 3LKMA 4CRSA 4ZJVA 2OF4A 5BVEA 4MXAA 4E6CA 1WBSA 4CKIA 2O0UA 1VLRA 1YI3A 5ETFA 3DXPA 4NYEA 4GYIA 1XBCA 2PZPA 4DEIA 1R0PA 3IG7A 3NCGA 3KRLA 1Z5MA 3FHRA 3N1OA 1H1QA 1YHSA 3W0QA 1QL6A 4R6VA 3GOPA 4TKSA 5FBOA 2F7XE 5IG1A 3EFWA 4I3ZA 4UV0A 3OW3A 4O96A 3BLQA 4YC8A 4RJ4A 2FGIA 4YPSA 4RJ6A 3DDPA 5HNBA 4K0YA 3R7VA 4ACHA 4F9BA 4XUFA 3E64A 4ORKA 3QFVA 4I92A 2HY81 3RINA 4KKGA 4B8MA 2Z2WA 4YJQA 5LVPA 3GCVA 4H3PA 4IZ7A 4N70A 3WZDA 5GINE 3PXRA 5DRDA 3NVKI 4M0ZA 2ONLA 4Y46A 5IQIA 5F4NA 4QTCA 2OZAA 3TZ8A 2WMXA 2ETKA 3EB0A 3TNWA 3JR1A 4J8MA 3FSKA 4KB8A 2PVJA 4LYNA 4QP3A 4Y8DA 4ZOGA 3PJCA 3SRVB 2ITUA 4FTOA 2XK9A 5IUIA 3U6HA 3TDVA 5BYLA 2YHVA 4B0GA 2ITQA 5IH6A 3PY3A 3DZQA 3UO4A 1GJOA 5A4CA 2XCKA 1TQMA 4FV6A 3PZEA 2QOBA 2JLDA 5AP0A 3D94A 2B54A 3ENHA 3F7WA 5IQFA 1REKA 3F5PA 3QD3A 3PVBA 5BQ0A 4FKOA 1XH4A 4Q5EA 4DEGA 5B2LA 3DAJA 5IU2A 3EKKA 3Q60A 4A4LA 5FTGA 5HG9A 3UNJA 5L6WL 5KX8A 4UX9A 5CF6A 5DR9A 4YP8A 3VS7A 3FMKA 2WKMA 2IW6A 2UW0A 4GFGA 3BX5A 4IH8A 1OL7A 2RFNA 3LJ2A 3PTGA 3KF7A 4H05A 4H58A 4JIAA 1PMEA 4N0SA 5E4HA 3L9PA 2AC3A 3F69A 1HCKA 2UZEA 4BZNA 1J7IA 2YM6A 4MKCA 2VNWA 3DCVA 3EMGA 3I60A 5LVLA 2UZNA 4ANQA 3B2TA 5HD4A 4BDAA 4IB3A 4F0FA 2OJFE 4GV1A 5HG7A 4AW1A 1K3AA 3HNGA 3PG1A 4G16A 4PTGA 3E62A 4DC2A 3O2MA 3BCEA 4FSRA 3W8QA 3ZRLA 5M07A 3KRXA 2WTIA 5EHYA 3EL7A 3IDPA 4F9WA 3TM0A 3W2PA 5H2UA 3S0OA 1RE8A 2R3IA 3PDTA 4MVFA 5KUPA 3P0MA 2O3PA 4RX8A 3DY7A 4M68A 3D5VA 4ZXTA 2WGJA 1XJDA 3QQLA 3EHAA 2YIXA 4BCIA 2GNLA 2CFHC 1F0QA 2I0VA 3RHKA 3PRIA 3W2RA 3CS9A 3ZDUA 4HCUA 4DF3A 5HVKA 4XJ0A 5KBRA 5BNJA 4DGNA 2XNOA 1CKJA 2JKKA 1WBTA 4CFNA 4YZCA 2PMLX 2WEIA 2YJRA 3WF9A 3E87A 2X39A 1GIHA 5JMSA 4QMXA 1ZMWA 4JT3A 3CTHA 4FKQA 5L6OA 3KK9A 4IVBA 3SX9A 4G3FA 3D7TA 4D1XA 3QLGA 5AIKA 3NFFB 1BX6A 1PXOA 4FYNA 3CR0A 1OL1A 3W0NA 1OI9A 4E5BA 2WZJA 3DT1A 4ERKA 3O17A 4QTBA 1MP8A 2RFEA 4ZY4A 1UNGA 5KMKA 4JAJA 2XANA 4IJPA 4C4MA 2B52A 4C62A 4RMZA 1STCE 4F0GA 2VAGA 3B2WA 3DB6A 4FOCA 4ASEA 4WA9A 3UG1A 1OUKA 1OIUA 4JX3A 4TT7A 3O5AA 4FSZA 2GHMA 2O5KA 4IDTA 3OWKA 4S33A 4NFMA 5T3QA 4BI1A 4BGGA 1CTPE 3LFEA 2NNWB 5EDQA 5E9EA 3HMPA 3QC4A 5AMNA 4X0MA 1OIQA 3OCBA 4AOJA 4FBXA 1TQIA 5GIPE 1XH7A 2KULA 3BBTB 4EKLA 1SZ7A 2ZM1A 2JDTA 2YAAA 4J99A 3TZMA 4AP7A 2XM8A 2IZUA 3LMHA 4A9RA 2J90A 3FUPA 3JUHA 3BKBA 3ORNA 3K7GB 4O86A 2XYNA 2ZFYA 3NUAA 4OX3A 3R6XA 4UWCA 5EOBA 4A06A 3R63A 3QGWA 4LL5A 4LRJA 4O91A 3VS0A 2B9HA 4O7SA 4BB4A 3R9OA 4L7FA 5IEVA 4XYFA 4O7ZA 1YDTE 3TUCA 5J95A 2FSTX 3R83A 5CEKA 2CGVA 3EQPA 4CG9A 3DPKA 3ZMMA 4EH5A 2RFDA 5JFSA 5FXQA 4NM5A 4XEYA 4M3QA 5DEYA 2QOCA 4AACA 4PNIA 1W83A 5AP2A 1GIIA 3QTXA 4HYHA 4RPVA 2PZIA 2QHNA 3FZSA 3QTRA 4AOIA 1PKDA 2ZV9A 2FVDA 3BGPA 3QD0A 2JDRA 1IRKA 2XBAA 4KS7A 3NW7A 3N4TA 2XRWA 4AQCA 4BC6A 2A1AB 4M0YA 4ZSAA 3G90X 1QPCA 3Q4UA 2XK4A 4O27B 5IQGA 2PY3A 1ERKA 5C03A 3R2YA 2PVYA 1R44A 3FI8A 5D10A 1JKTA 5DT3A 5AUYA 3RPVA 1W98A 3SXSA 1J7LA 3VBXA 4AGDA 4MBJA 3ZM4A 3LVPA 4BDDA 5DG5A 2GMXA 2W1DA 1G8AA 3HAMA 3VS5A 4E4NA 5M56A 4CCBA 5FDXA 4ASZA 4J71A 2B1PA 3SG9A 4CMUA 1NVSA 4XV9A 2WIHA 3KXXA 4D4VA 4AE6A 2C0OA 2BFXA 4FGBA 2WFQA 4IJ9A 2W1IA 4GK2A 3GCSA 3ZONA 3P86A 2YDIA 4L3PA 2EB3A 2GTNA 3BLHA 5BUJA 3RM7A 4M84A 2OBJA 3CQEA 2BRNA 4ZTLA 4C33A 5IMEA 4ZSJA 4LGHA 4CXAA 3LE6A 2BIKB 3ALNA 4HJOA 4Y95A 2RIOA 2H8HA 4FKVA 4OTFA 5IZFA 2IZSA 4X7QA 1PXMA 3TMOA 3ZCLA 4YZNA 4CFVA 3W2QA 3ODYX 3B8RA 3EQGA 3NR9A 1PXKA 4L7SA 5EH0A 5IQEA 5C4LA 4KBAA 3SRVA 3KA0A 1GZNA 5JQ8A 5DR6A 4D55A 5DFPA 3UOJA 2J0JA 2FA2A 3R8UA 3U87A 3VULA 4L3JA 3GQIA 3HRFA 4MTAA 5IDPA 1WBWA 3FLQA 3PFYA 5BVFA 5IISA 1WVXA 3KF4A 5FTQA 2W17A 4X2JA 2RKUA 2J3RB 4GVAA 4RWLA 1UA2A 2HOGA 3PP1A 2VTQA 1XKKA 2Y4IC 5GNKA 3VIDA 4IAAA 4EWQA 1YW2A 1L8TA 5BMMA 5IDNA 4L67A 5IA0A 4PX6A 3CPBA 2BZHB 5AM6A 4QP4A 2C3IB 4FK6A 1OPKA 4PDSA 4I6BA 3UIUA 1Y6BA 4FTCA 4O21A 2WFRA 4N6ZA 3WYXA 2X8DA 3GB2A 2W5HA 4PY1A 3JPVA 5HE1A 4C4GA 3NDMA 4XS2A 5AM7A 3MI9A 4EH8A 5A6NA 4C2VA 3DJ5A 4F7NA 1UU3A 3OVVA 3UBDA 2PE0A 2UVYA 3OTVA 4JIKA 3GVUA 4C34A 5J8IA 3F2RA 1TKIA 4LMNA 4UXQA 4NL0A 3AT2A 4AF3A 5F9EA 3R9DA 2PWNA 2ERKA 4WRGA 3TT0A 3BGZA 4A9YA 2V7AA 3V8TA 3KRRA 4NIFB 3FMLA 3QQKA 5DLSA 4QEBA 4FT0A 5C26A 3BELA 3DV3A 1YHVA 4ACDA 2XKFA 4RVMA 4YPDA 2ITWA 2YM7A 4CT2A 4QYEA 4F1TA 2B4SB 2ZDTA 3PXQA 2CKQA 3ACJA 2GNFA 3BYMA 5AUVA 3T9TA 3ZTXA 3QD4A 3QTQA 4QMTA 4D1SA 3BU5A 5CX9A 4C61A 3UTOA 5G6VA 3FZTA 1Q8TA 4XH6A 4F9CA 4D5HA 4E8AA 3GBZA 1UU8A 4G34A 4FZFB 2IVVA 4FTNA 3EWHA 3BLRA 2BILB 2ITXA 3NX8A 4J1RA 2C5NA 3TN8A 5HIEA 3NS9A 5IA4A 2W4JA 4DG3E 4QQCA 5IMXA 4FTLA 5AUZA 4DG2E 1R0EA 4TN6A 3QRKA 4DBXA 2QNJA 5AV4A 2WQNA 3I4BA 3ZH8A 3QKMA 4O22A 3KCKA 3H0YA 3RCDA 4ANSA 2UW4A 3HV3A 4OT5A 3KFAA 4B99A 5CU0A 2UW9A 4UYNA 2P3GX 4J96A 2E9OA 4U43A 5AUWA 2KTYA 2YIYA 2WTCA 2GNHA 2ZAZA 3Q9YA 4EH9A 4O0VA 3KK8A 3OS3A 3CTQA 4AG8A 4BCQA 5JKGA 1YOJA 3QCSA 3WOWA 5A4TA 2VWYA 1QPDA 4AW0A 5H8EA 4LM5A 4HGSA 4JBOA 4WSYA 3ZBFA 3FY0A 1CM8A 4F6SA 2B9IA 4DFUA 1FBNA 4G6LA 4MWHA 2VWUA 4GT5A 4BN1A 3NCZA 5AUTA 3MPAA 1FGKA 4JG7A 1OIYA 3KXCC 4Q5HA 3E8CA 4DGLC 5EKOA 3P7AA 1OM1A 3TJDA 5IEXA 4Y5HA 4B4LA 5ITAA 3VUDA 4RWKA 5EK7A 4CG8A 2OH0E 1LR4A 2ETMA 4TWOA 5JQ5A 2UZOA 3ORKA 2FB8A 5ANIA 2C3LA 3SC1A 3MH3A 4JDJA 4OR5A 3NUXA 5EYDA 3COIA 5LMAA 3A7FA 2VZ6A 4O0XA 3U4UA 5HEZA 2X9FA 2JGZA 5DGZA 4BCNA 3IS5A 3FZPA 4G17A 3PWYA 4FV2A 2W06A 3BYOA 4G2FA 4YC3A 5BMSA 2PUUA 3PFQA 5DT4A 4I0SA 3C7QA 5JH6A 1SVEA 5BUIA 5KMMA 2RF9A 3GI3A 3HDMA 4FEWA 4UWBA 1ZMVA 2UW3A 2JITA 3LLTA 3UQCA 4ASXA 3MA3A 4DBNA 3RAHA 2VWZA 3F3WA 4Y72A 4OX5A 3V5TA 3UNZA 5KMIA 1R1WA 4KINA 4E6QA 1Q62A 2WOTA 2VTTA 3FSFA 3PXYA 4NJ3A 5HLPA 4ACCA 4AU8A 5B2MA 5AUXA 1OVEA 2C0TA 3DTWA 3D1MA 2R3NA 3ORTA 2V5QA 2W96B 4YO6A 1ZZ2A 5IQDA 2X8EA 4BGQA 2IZTA 1MUOA 2XB7A 1OL6A 5DVRA 3A2CA 2C1BA 3O71A 3H10A 2F49A 4E7WA 3O7LB 3R2BA 3N1MB 4QMYA 5HD7A 5EW8A 5HI2A 5M44A 2R4BA 4AN9A 4E5WA 4WRSA 1O6LA 3HV7A 4PL3A 2BR1A 2CPKE 3LCDA 3GUBA 1PXNA 4NM3A 4DINA 4EYMA 1XMMA 2C47A 4DEHA 4V0GB 4O7NA 4BCFA 3DNDA 4FT7A 2SRCA 3NFGB 4B7TA 2BHHA 4JS8A 3I0QA 4TW9A 1YXTA 3OY3A 4YGAA 2QLQA 2X7OA 3O8TA 3PZHA 4YBKA 4PWNA 4QMZA 4S34A 4K33A 2BDFA 3ZU7A 2HY0A 3CP9A 3ORPA 5CF5A 4YC6A 2NO3A 3ZXTA 3H3CA 4NZWB 5CEIA 4OTWA 4MURA 4KA3A 3D14A 3C4FA 1XMLA 3DS6A 3I0OA 4NK9A 3MFTA 4KD1A 5BPYA 2RG5A 3E5AA 4YTHA 4PQNA 5GJGA 2J3RA 4PTEA 3EH9A 5CT7A 2BMCA 3UIMA 3HMOA 2ITZA 4RLKA 4NT4A 1RDQE 2W1HA 4EK8A 5CYIA 2G9XA 5FUTA 4IVCA 2W1CA 4AX8A 4BDKA 2UZTA 1OPJA 4BDEA 2QLUA 5HIBA 3TTIA 2R64A 4I5HA 4L53A 4MUQA 3EN4A 3FQEA 4BTFA 3A60A 4M13A 3LZBA 4JOAA 2C6EA 2QCSA 4AAAA 4IWDA 1NA7A 1KOBA 4F78A 2JDSA 4EYJA 4ZZNA 4R78A 5LJJA 1PRYA 1M7QA 3VUMA 5D7AA 3KKVA 3KMMA 4AT4A 4I41A 5GHVA 3ZLSA 1CMKE 5I9WA 2VX3A 3FC2A 4XNEA 3NPCA 5GIOE 3D5WA 1MQBA 3KB7A 4FKLA 4QMUA 3W2CA 4MD9E 5IPJA 4BRXA 4IAIA 4IVDA 4GYGA 3BEAA 5KHXA 3PLSA 3C5IA 4DFZE 3QC9A 1JSVA 3FI4A 2AUHA 2ZDUA 4JBQA 2PMIA 2UW5A 3LFNA 2X4ZA 3QRTA 4O0RA 4X2NA 5ANGA 5FQDC 4FV9A 3TJCA 4AN2A 3IW4A 4PP7A 2J3TB 4HCVA 4F65A 5JZJA 5DIAA 1U46A 4O6EA 4DT9A 4FG7A 2B9JA 3U8WA 3VRYA 2PE2A 1YOLA 4BZDA 5I9ZA 1JPAA 3TKIA 3KGAA 5HO8A 3WF7A 2QURA 5CNNA 1FMOE 5DPVA 2PU8A 3VQHA 4DFBA 2VWVA 3KN6A 3PSBA 1R39A 3ZHPC 2HIWA 3UMWA 4OLIA 2XMYA 4X3FC 5FG8A 3LM5A 3FLYA 4I22A 3HV5A 3OT3A 4I5CA 4DFYA 3BYVA 1U59A 2XK3A 4ZTRA 4CMOA 3E88A 1WBOA 4OBPA 3TI1A 3WZUA 5C01A 4F64A 1JSTA 2YDJA 3CQWA 1M52A 1JLUE 4NKSA 4TNBA 3Q96A 3NRMA 5EQPA 3DFAA 1BI7A 3F7ZA 2PVMA 3EQCA 3F3TA 3FV8A 4Z16A 2IVTA 1AD5A 3G9LX 5EM8A 5L2TA 2WFYA 1PXLA 4EOOA 2WFXA 2W4KA 3KXGA 3F5GA 2FSMX 4CFMA 2VWBA 3GP0A 3PIXA 3UVQA 3OROA 2W99B 3JYAA 4FC0A 4LOPA 4LV8A 3AC1A 2QOHA 3MH1A 4IFCA 4BYIA 2LAVA 3UYSA 4O7YA 5LARA 3MA6A 1Q8ZA 3GU8A 3QBNA 4LL0A 1REJA 2XK6A 4AGWA 5AAEA 2P4IA 2XKCA 1J3HA 3FKLA 2OWBA 4RVTA 1A48A 4ALUA 1E9HA 3KCFA 3NW6A 5ANJA 4BI0A 3AMBA 3S00A 4ZK5A 3SW4A 3HO5H 5JFXA 4RJ7A 1KUTA 2OI4X 4C35A 4USEA 2BRGA 2RG6A 4X2KA 3QA8A 3TKHA 1JWHA 4EK3A 2W1GA 2C3JA 2YCRA 4XBRA 4ZMEA 4EC9A 3QZIA 3I6UA 4JR3A 4WO5A 3WBLA 4D58A 4C3RA 2VTJA 3C0IA 4TNDA 3RTPA 4AFJA 3ZYAA 4IX3A 4BBFA 3N1QA 4K11A 3TUBA 3AC5A 2IO6A 3W0OA 2E9VA 2ITTA 4EHZA 2OICA 1BKXA 4RGJA 1VEBA 1Q8WA 4FKWA 4U97A 4QOXA 3LW0A 3GC0A 4FNXA 2HXLA 3OD6X 4FKIA 3C51A 3JY9A 4I0RA 5DE2A 5BVWA 3RPYA 4DLIA 4ZJIA 1TFFA 3EZVA 3FQSA 3SXRA 4HW7A 4FVPA 5FDPA 4YJNA 3L8VA 2XIRA 3OUNB 4ZJJA 3CBLA 3IECA 4Z3VA 3KN5A 1H8FA 3E3PA 3TTJA 3IO7A 4AOTA 4OBQA 4AS0A 2H96A 3R73A 3OBJA 4IX4A 1FMKA 2ZV7A 1MQ4A 3AKJA 2PVLA 3I7BA 4BCPA 3G6GA 4TYEA 4DLJA 5AUUA 5M51A 3C0GA 5C4KA 3DQXA 5AFVA 3A99A 4C4JA 3O23A 4JMQA 4ZTMA 4IHPA 4F09A 5ETCA 2HELA 3ELJA 1JKKA 4DTKA 1DI9A 3PPKA 4MBLA 2ACXA 4D2SA 5HNMA 4S2ZA 1HOWA 1SVGA 4BHNA 1YKRA 5EHOA 4V0GA 4Y85A 3RPRA 4EOMA 5A54A 4G6NA 3UZRA 4RFZA 4YHJA 4U5JA 1XH8A 3LPBA 4WT6A 5ANDA 4AGUA 3UVRA 4OXDA 3E3BX 3ORLA 5CSVA 2R0IA 4HZRA 4MNFA 4UZDA 3DB8A 1OZ1A 4LUDA 2J0MB 4FTMA 5CANA 1FQ1B 1BL7A 2E2BA 2ITVA 4CFUA 2DUVA 4IM2A 5ACKA 4MD8E 3DTCA 3JY0A 2Z7SA 3HA8A 3NLBA 3EJ1A 2R3FA 4OBOA 4FT5A 5I4NA 4K1BA 4ZTHA 4LOOA 5FP6A 2HZNA 3SQQA 2GQSA 4XX9A 3RKBA 2OSCA 2CGUA 2OH4A 4LDTA 3IOKA 1APME 1HCLA 1IA8A 5G1XA 4H1MA 4PF4A 5AP6A 2WTJA 3R28A 4CEGA 3W16A 4BBMA 3BLAA 3BU3A 3E8EA 4G5JA 4MHAA 1ST0A 5E8XA 2RGPA 3EQHA 4HVHA 4PRJA 2F2CB 4FSTA 4TY1A 4MWIA 4O7WA 2P2IA 4RZWA 3O7LD 4GFOA 5F95A 1KE8A 3MY5A 3LFQA 1PKGA 3MV5A 3O8UA 3Q4TA 4IACA 5C8KA 3CJFA 4YZDA 4FIHA 4TZRA 4BTMA 1XBBA 3F3ZA 3K7IB 3UPZA 4YBJA 4ZS4A 3PY0A 4GSBA 4IBMA 4EC8A 4MYGA 5TR6A 5KO1A 2F57A 4GL9A 5E7RA 3EQFA 5CSWA 3EFKA 4L8MA 2QOIA 5IA3A 1YRPA 3CPCA 5AP7A 5E8VA 3DBDA 3LCOA 1YXVA 4JQ7A 2QD9A 4QDVA 3C13A 4FL1A 4FTUA 5EM5A 2VTRA 5EW9A 2WXVA 4ARKA 4DGMA 4EK6A 4U3YA 3QF9A 4XG6A 3REPA 4CKJA 1YWRA 3W18A 4MXYA 3CY2A 5HCXA 3QCXA 4WNMA 5B0XA 2OSOA 1Q5KA 1PMUA 4L3LA 5F94A 1H27A 5I9UA 3AC3A 2WQBA 5AP5A 5KNJA 1OL5A 4MK0A 2HW6A 2J3TA 4WIHA 3L9NA 4NCTC 4QP9A 5D1JA 3RWPA 4Y73A 1FGIA 2YJSA 5CVHA 3EN5A 3F5XA 3MY0A 2XUUA 2VWIA 1OBGA 1J7UA 2GNGA 5TF9A 4PL5A 1O9UA 3U55A 3PA3A 2VO3A 3ITZA 4KRCA 3FLZA 4MQ1A 2WQEA 1U5RA 3HMMA 4K8AA 5AEPA 1OECA 3FXXA 1OPLA 5IEYA 5DRBA 1GAGA 3IGGA 3BL9A 1ZARA 2WOUA 2WMTA 3ANQA 4FTRA 2BHEA 1AGWA 4YNOA 5CS6A 4BF2A 3NIEA 4CKRA 5JEBA 4H3QA 1VZOA 1W8CA 5CAOA 1XQZA 4ID7A 3LFAA 4KIQA 4O7TA 4RQKA 3S1HA 4ERWA 1YDSE 3MN3A 4MAOA 5AIRA 3CUEB 3MVHA 4MUTA 1G3NA 1ZWSA 4BY9E 4GU6A 1T46A 2GS7A 3S4QA 4J53A 3V5WA 3CXWA 4EEVA 2QG5A 2YM8A 1KE7A 4FE2A 5DA3A 1H26A 1PMVA 4YJTA 3M2WA 5FXSA 5EI2A 5FGKA 3KIOC 4ITHA 4JIDA 4ZP5A 2Y0AA 3ORMA 3VF8A 3EN9A 3D83A 4OTIA 4USFA 1OKVA 4BTKA 2R3KA 4K6ZA 5IA1A 3F61A 3V51A 4XP3A 2VO0A 5LWMA 2OJJA 2J7TA 2I40A 3WE4A 3Q9WA 3A7HA 4NUSA 4DH3A 4EHVA 4MXXA 2B0QA 1RW8A 5KMLA 1GZOA 4ALVA 1KOAA 4QPSA 5FEDA 2I7QA 3EQBA 4EQMA 3NNUA 4XG7A 3WF6A 3QWKA 4AXEA 2PK9A 3R8LA 1LPUA 2C6MA 2JIUA 4C59A 4GH2A 3VONA 1PXPA 2EWAA 5CI7A 5M53A 3CY3A 3P23A 4AT5A 3OCTA 2VTHA 2QO9A 3Q52A 4FIEA 3ZO2A 1F5QA 2OO8X 4UN0C 2WTWA 3FMNA 4Z55A 2OSDA 1V0BA 3CSVA 3C0HA 3P5KA 4IIRA 3Q9ZA 4UBAA 4A9TA 5T6KA 3A61A 4G9CA 3DAEA 3R00A 3SG8A 2FYSA 3BBWA 1G8SA 4U79A 3T8OA 2GFCA 5KMNA 2OXXA 3ZSHA 2XNEA 3LMIA 5HVJA 4RBLA 4Z9LA 3HRBA 4BDJA 4D28A 3DJ7A 5HQ0A 4C3PA 3HVCA 2WQOA 5AP1A 2CDZA 4I21A 4RLLA 3OY1A 3OZ6A 1GZKA 2UZBA 2HCKA 4YSJA 2C6TA 4HOKA 4LMUA 4EOKA 4TPTA 1A06A 1WZYA 4IB0A 3TNIA 4TWCA 4XV3A 1NVRA 2AEGA 2RL5A 3MFSA 4XRJA 3F66A 1R3CA 3ORZA 3Q6WA 5ETIA 2WU6A 2XBJA 3C50A 4LV7A 4NKAA 2BAKA 3R9HA 4CFFA 2Y4IB 3MS9A 3BQRA 1WVWA 3CKXA 5IA5A 2GCDA 4Q2AA 1H00A 5E90A 2C30A 3VHKA 4XV2A 4QYHA 4DDIA 3EIDA 4C58A 3SA0A 5A3XA 4EJ7A 5LVNA 4OAKA 3PE2A 4FSUA 3KXNA 4G1WA 4HYIA 4FV4A 4RG0A 4U44A 4EBWA 1WBNA 3A8WA 3AGMA 3Q3BA 2Y7JA 5FEQA 2WO6A 3C4EA 1I09A 1X8BA 4XG3A 3TL8A 2JC6A 3ZZWA 4AQKA 2PUNA 2OW3A 2W9FB 4U45A 4A7CA 3KY2A 4KSQA 4U3ZA 3U51A 5KZ0A 3ZLXA 3U9CA 5CAVA 3HP2A 5M4CA 1UV5A 4WG4A 1YXUA 2YCSA 4CMTA 4WNPA 1W84A 3W55A 3QD2B 4FG8A 4IZYA 3TUDA 3PVWA 4YJOA 2XZSA 3V6RA 4FMQA 5A14A 4ITIA 5CNOA 4MXZA 3AD4A 4O84A 3PYYA 5BV3A 4P90A 4EZ5A 3R7EA 2YERA 2CFHA 2W05A 4FR4A 4JR7A 5HCZA 2G15A 1UWHA 3U4WA 4S30A 3P1AA 4F7SA 4G3DA 5KMJA 3FMHA 4G5PA 4RT7A 1XO2B 3WIKA 2HW7A 4UY9A 2YIQA 2EXMA 3IW7A 3SV0A 2NPQA 2G01A 1PMNA 4WHZA 3N51A 3VBVA 1PXJA 5KKRB 3CJGA 2PE1A 3LQ8A 3Q2JA 2CLQA 2XP2A 4ZMFA 4E4MA 3OG7A 3RAWA 4QP2A 3NNWA 3C9WA 1V1KA 5D41A 5IH5A 2HWOA 4XCUA 2YM4A 4RA4A 4DHFA 3UDBA 4F1MA 1PHKA 4E4XA 5CEOA 4HZSA 3TV6A 3AKLA 2DWBA 3LXPA 2W1EA 2C1AA 1VJYA 5CEMA 2VU3A 1OKWA 3FI3A 3PVGA 3GU6A 4HVDA 3HP5A 2QR8A 5BVKA 4D0XA 2VX1A 3KC3A 4LUEA 5FD2A 3W8LA 4R3PA 5AJQA 3WARA 3PUFC 3CKWA 3GENA 2UZVA 1M2QA 4XOYA 3SVVA 4AAYA 2J3WB 1UVRA 4ZSGA 1URCA 3W1FA 3KXMA 4QYYA 1U10A 1GNGA 3MFUA 2HAKA 4I6FA 3M1NA 1XH9A 4QP8A 3OC1A 5CU6A 4IEBA 4L9IA 1NT2A 3ATTA 3IW8A 3LQ3A 3RM6A 1FOTA 4Q9ZA 2Z7QA 2BVAA 4RIXB 2QKRA 4JRNA 3VQUA 4C4HA 2C5VA 3AC2A 5AX9A 5CENA 3AGLA 1QMZA 4IW0A 4AE9A 4UXLA 1ZYLA 2WTKC 3JXWA 2WU7A 2PULA 3GOKA 5ACBC 1BL6A 3G5DA 3QXPA 4IVAA 4J52A 5CAPA 5J9ZA 3NGAA 4CFXA 5BX0A 5CZIA 5C8MA 2UZLA 4FV5A 3OBGA 3TCPA 3G0FA 1DAWA 5EYMA 4QTEA 4GIIA 1K9AA 3ANRA 2RFSA 4C4NA 4RRVA 4FJVA 2X2LA 4YTIA 3K3JA 2XJ1A 4EZ7A 5T68A 2PVFA 3F88A 3GU7A 5A4LA 3PUPA 3KU2A 2VRXA 3ZFXA 3PJ1A 2YWVA 2BDJA 2J0IA 1JOWB 3G2FA 1F3MC 1P14A 4CZUA 2YAKA 2XRUA 4FNYA 4IANA 1UKHA 2BCJA 4E6DA 5HNIX 2C0IA 1XR1A 2DS1A 3BHHA 3MVLA 3W0MA 1OITA 2JKOA 4EONA 5E8YA 3SHEA 2HXQA 4U41A 3F9NA 2WNTA 4EH2A 4UZHA 3IDBA 5HIDA 3UE4A 5A46A 5HZNA 4ZZMA 5IUHA 4MH7A 5IQCA 1YQJA 3ODZX 3QTWA 3CTJA 3R22A 4GK4A 2O63A 5A4EA 3I6WA 5IH4A 1K2PA 2I1MA 3GC8A 3FEGA 5HO7A 4FIIA 5JFVA 1OL2A 1KWPA 4FX3A 4U9AA 3ZEWA 4RVKA 4JG8A 3ZS5A 3R21A 4IADA 4GW8A 4C4IA 4DCAA 4YTFA 3TXOA 3PLAE 1CDKA 4H36A 4IB1A 4ZTNA 5ICPA 3EOCA 4AZWA 5GJDA 4DH1A 3FYKX 1VYWA 4JAIA 3ZZEA 3BHTA 2CLXA 4YJPA 2DQ7X 2PMNX 2Z7RA 2Q83A 4NTTA 3PG3A 4BZOA 1OKZA 3ZBXA 3ZFYA 4CRLA 3P4KA 3AD6A 4AXDA 3R1SA 4FIJA 2ITYA 3RK9A 4EOQA 2C6LA 4GKHA 3V8SA 2F7ZE 3PXZA 2CGWA 1KV1A 1CKPA 3NVMB 5JRQA 1LBUA 2YDKA 3HZTA 4CNHA 5K4JA 4QP6A 1FVVA 4FIFA 4YSMA 5FXRA 3N1FA 4E26A 5E8TA 3FI2A 3II5A 3LFCA 4ZY6A 1H07A 2PL0A 3T3UA 3PE1A 3MPTA 4ZLOA 1Q61A 1OIRA 2XF0A 4I4EA 5HX6A 3FWQA 4X6QC 3KREA
chains in the Genus database with same CATH topology
4F70A 3BPRA 4BDGA 3F2AA 4GJ3A 3VS6A 3LFSA 3HMNA 4BYJA 3RJCA 2JBPA 3A7IA 4GMYA 4M12A 3RNYA 2O2UA 1V0PA 2YABA 2CN8A 2EB2A 2NRYA 2R7BA 5CU2A 2Q0BA 1JQHA 1W0XC 2BFYA 4F6UA 2C6OA 4JVGA 3GFEA 4O0YA 3FPQA 1ZMUA 2UZUE 3ZO1A 2PUPA 4L42A 4FV7A 4D4YA 2XNPA 4H39A 4O7VA 5CZHA 3RI1A 1Q97A 2UW7A 2YZAA 3OP5A 2JIIA 2BIYA 2JEDA 3NSZA 5J87A 1Q3DA 2BZJA 3BE2A 2GHGA 2R3MA 4C4FA 4ZS0A 3CE3A 4RJ5A 4EOIA 2ZJWA 2XNNA 4ZAUA 3QHRA 2XJ2A 3K5UA 3VNTA 1JBPE 2R7IA 5BYYA 3H9FA 4CZTA 2GS2A 4JDHA 2JBOA 4JBPA 3ML1A 3HMIA 5CSHA 5FP5A 5J5SA 5LQFA 2PVRA 3HA6A 4AZSA 5I9YA 3A4OX 3N9XA 5AP3A 4AT3A 1U54B 2YA9A 4IFGA 4C7TA 3WZEA 4RIOA 1GOLA 2VGOA 1R78A 2GNIA 3BEGA 3ZSGA 4GUBA 3R8MA 1UNHA 4QPAA 5K3YA 5ANEA 5JRSA 5IUGA 4ITJA 4WNKA 5D9HA 3QKKA 3BGQA 4EOPA 4CFWA 4BBEA 4TYGA 4TRLA 3OXIA 2XIXA 3UDZA 4YMJA 3DGKA 4I4FA 2PZRA 2YN8A 4EK4A 4PDPA 3RAIA 2XNBA 1DM2A 3FZ1A 1OGUA 2QOQA 4XG8A 2GU8A 3G0EA 4P2KA 2J2IB 4A4XA 4IM0A 1EH4A 4HPUE 3Q5IA 3RK7A 2JKMA 4YZ9A 2Z60A 3JVRA 3NEWA 3E7OA 1OKYA 4X3FB 3C4ZA 1Q8UA 4OT6A 4XLVA 4HPTE 4YHFA 4BKJA 3TYKA 4YZMA 3TNQB 2ITNA 4NTSA 4L43A 5HBHA 3UP2A 5AV3A 3TIYA 5DI1A 4JJRA 1IR3A 5DR2A 3TKUA 3VVHA 4CV9A 5CI6A 5K5XA 3JVSA 5EDPA 4HNIA 3L9MA 4I5PA 5L2SA 4HNFA 3HEGA 2Z8CA 3P5JC 5AAGA 5LCJA 4O7LA 4ZZOA 4FEUA 4DG0E 5M06A 2A2AA 3ZRKA 4RIXA 3ZO3A 3C4WA 3PY1A 3QZHA 4UWYA 3BWJA 5TO8A 4IX6A 2C5YA 2NRUA 4OTGA 5FRIA 2X7GA 1ZYCA 2WMQA 3PJ2A 3GNIB 3I7CA 5ETAA 5LCKA 3SD0A 3VC4A 2VV9A 4GVJA 1ATPE 4B8LA 4KBCA 2HWPA 2XKDA 3LXLA 3QX2A 3GQLA 4C02A 4U7ZA 3L1SA 4PUZA 2BALA 5KHWA 1M14A 3QU0A 2IPXA 3UZTA 4R3CA 2WTDA 2R3PA 2YCFA 2X9EA 3N1PB 2ZYBA 3VN9A 3DLSA 4BIBA 2GNJA 1SM2A 2PVHA 2OIBA 4F0IA 2QODA 1FINA 1M17A 1YI6A 4FGRA 3UO6A 5BYZA 2JFMA 4PNKA 2X81A 2OZOA 4W4YA 2FO0A 4IWQA 2OZAB 5H8GA 3SXFA 2C3KA 2E9NA 4IB5A 4ACGA 4E6AA 1XBAA 3H9OA 1OB3A 4J98A 3Q53A 2CSNA 5HTCA 2QOOA 1ZAOA 3PPZA 3W0SA 4F9YA 5AA9A 3Q5ZA 5FM3A 3JS2A 3WIGA 5J1WA 3VO3A 1GIJA 3WZKA 3KVWA 3AC4A 4IZ5A 2IVSA 3V01A 4P7EA 4Z7HA 5H3QA 3QZGA 4FICA 4EH4A 5K4IA 3P7CA 2QO7A 5E91A 5FEEA 2CN5A 2JD5A 3MIAA 4BCMA 4K18A 3DXQA 3BL7A 3G6HA 4O0UA 3AG9A 1PYEA 3MFRA 4Y5QA 3QYWA 4FODA 4P4CA 3R30A 1ZOHA 1L3RE 3FMEA 1S9IA 5L3AA 2BKZA 3VBYA 3VUGA 2WD1A 3E7VA 3S95A 2WG4A 4FNWA 5EQEA 3QRJA 3TV7A 3ZSIA 4MX9A 4F99A 3OCSA 5JN2A 3BQCA 1B38A 4GJ2A 2J5FA 3G33A 3MXWA 5IA2A 3PA5A 5D11A 3K54A 4DH5A 5CAQA 3PIZA 4MCVA 3UVPA 2CCHA 5DOSA 1ND4A 3VJOA 3MIYA 1H25A 5DT0A 3TNPC 4OGRA 2QOKA 3SOAA 4BCHA 4TYIA 3GU4A 4D9UA 3KRJA 2IN6A 1H08A 3IPHA 4FZ7A 4JRVA 4P5ZA 3IK3A 5CXHA 4BDHA 3S2PA 1OUYA 2XM9A 4II5A 1VR2A 3R8PA 3ZM9A 1J1CA 5AP4A 1KSWA 4V01A 2E9UA 3UGCA 4F9AA 3UC4A 4BIDA 2EVAA 3PJ8A 4FIGA 4PL4A 3L8PA 4FUXA 4AZVA 3KVXA 1CKIA 3MJ1A 5KZIA 4BTJA 1Q8YA 4CD0A 3F82A 2IZRA 2W9ZB 3UC3A 2CKOA 3BI6A 4PDOA 4U6RA 4ZSLA 4FKTA 3GT8A 4L01A 2BZIB 3K2LA 5HE2A 2GDOA 4AW2A 4JNWA 1LUFA 2ONLC 2C5OA 3R7UA 1H24A 3FY2A 4GT3A 4KABA 3AMYA 2VTPA 3LFDA 4CQEA 5FM2A 2X6DA 4A07A 3VF9A 4NM0A 4FSQA 2OKRA 4IM3A 3DBFA 4FSMA 3LFBA 3P08A 1SMHA 4IAZA 4MUSA 2OGVA 3E63A 3D7TB 3HGKA 2CGXA 3O51A 2ZB1A 3D5XA 3PWDA 3EQIA 4EORA 5EYKA 2OXYA 5CLPA 2PPQA 1SZMA 3R01A 2Y9QA 1P4FA 5KCVA 4YJUA 3CD3A 3OMVA 3GGFA 3RPOA 2XIYA 5DN3A 2BZKB 4QP1A 3D0EA 3OTUA 3E93A 4FT9A 3BHVA 2WIPA 4FYOA 1FPUA 3E92A 1ZOGA 3R9RA 4I6LA 2XA4A 4DHZA 1H4LA 1U54A 5M4IA 2I0HA 4H1JA 3O8PA 1URWA 1XHAA 3V6SA 4IWPA 4IAFA 4RSSA 4AUAA 4BDFA 4R3RA 3UIXA 3N4UA 2CKEA 2YIWA 1H0VA 4QDEA 3TDWA 3UODA 3MY1A 4HVIA 2CMWA 3TWJA 2XALA 4EUTA 3CEKA 2P0CA 5I5ZA 4OTRA 2BAQA 4R5YA 3R8ZA 2X2KA 3PPJA 3DA6A 3NIZA 3A8XA 2VNYA 2WB8A 4BHZA 4E73A 3RMFA 3Q4CA 5IQHA 3T9IA 3IOPA 3DJ6A 1H1RA 2Z7LA 3BV2A 4TYHB 5LMKA 3BIZA 3ERKA 2OXDA 4LRKA 3MVMA 3BHYA 4DT8A 4RX9A 3GU5A 4RWIA 3AT3A 3EN6A 4GRBA 5CF4A 4DGOA 4YUQA 2VN9A 2P33A 1GY3A 4USDA 4GG7A 1LEZA 4PMTA 3PIYA 3V5LA 2J4ZA 4ANBA 3OXTA 3MVJA 2XKEA 1WMKA 3LFFA 3ORIA 2X1NA 5EFQA 3SAYA 4QQJA 2VTMA 1H0WA 2UV2A 3SOCA 4D4RA 2XK8A 4RA5A 4RJ8A 2IW9A 3L8SA 1TZPA 4ZTQA 4MQ2A 5AADA 4YU2A 4QMOA 5M08A 4F1OA 3EQDA 4QNYA 5E1SA 4C4EA 3AMAA 1YVJA 3QL8A 4K77A 2GSFA 5FLFA 1JKLA 3VHEA 2QONA 2O64A 2HENA 2XS0A 3W0RA 4I23A 3FBVA 2A4LA 4RVLA 4ZEGA 2J6MA 5DWRA 3WILA 1ZYSA 4FTAA 5KMOA 3QRUA 4BJJB 3OEZA 5F1ZA 5AV2A 5HU9A 1ZYDA 1Q41A 5AV0A 3RGFA 2WG3A 3DKOA 1NVQA 3DKFA 3P9JA 1NXKA 3VW6A 2VWXA 2HZ4A 2R0UA 4QYFA 4L52A 1ZY4A 3FAAA 3LJ1A 5D12A 3BV3A 2VO6A 4IQ6A 3FYJX 1FVTA 1Y8GA 3EFLA 2GQGA 4MXOA 5DYJA 3H0ZA 5BUEA 4RWJA 2PTKA 2CCIA 4S31A 5IQBA 5KE0A 3NYVA 3KMWA 4RC4A 3MYGA 4I1ZA 3RWQA 4OTQA 2PVNA 2VTIA 3ID6C 3IKAA 4AFEA 5AA8A 5A9UA 3VBWA 4E20A 2HK5A 4HYUA 4EI4A 3KMUA 5CALA 4JQ8A 3NYXA 4L46A 4RIWB 5EDRA 3QUDA 4AXAA 4YLLA 4E5AX 4DYMA 5GJFA 1UU7A 4RX7A 4MBIA 3A4PA 4I93A 5E1EA 3Q04A 2WTVA 1UU9A 5AAFA 5L8LA 2XAMA 4HVSA 2XNMA 3LMGA 3POZA 2OG8A 4O2ZA 4FK3A 5HNGA 3WYYA 4O83A 1ZOEA 3D9VA 4F6WA 3FXWA 3HL7A 2WMVA 1A9UA 2CHLA 2C6DA 2LGCA 3FKNA 4IX5A 3QTIA 4JDIA 4IAYA 3A62A 3M11A 1S9JA 3OUKA 4N57A 3WE8A 3ZXZA 4E4LA 4QT1A 5L2WA 5AV1A 4GS6A 1Y91A 2OFVA 3DOGA 1E1VA 1Z57A 1YI4A 1B6CB 3RAKA 3BWFA 4D4SA 3QTSA 5E8SA 5JZNA 4O0TA 5HHWA 4O82A 1BMKA 4MF1A 3FZRA 3TG1A 4BIEA 2QR7A 4DGGA 5JK3A 3LCSA 3OF0A 4FKJA 4B9DA 2Y8OA 3FLWA 2F7EE 4WBOA 3UZPA 5CAUA 2QU6A 3PVUA 4YJVA 2WMAA 3OCGA 4YHTA 4CV8A 3FLSA 3DBQA 3LOKA 4ALWA 2W1ZA 3GEQA 4YR8A 2EXCX 3UMXA 4RC2A 3R8VA 1KE9A 5TOZA 3Q32A 3GCUA 2YCQA 2YZLA 3QUEA 5CVFA 4MNEB 4L68A 3N4VA 3M1SA 1H1WA 3QTZA 5C1QB 2X4FA 3AT4A 4H3BA 5EM6A 4NFNA 1H01A 4QQTA 3GC9A 3I81A 4XRLA 4XOZA 3QGYA 5E8UA 4CGAA 3SLSA 4I20A 2G2IA 3ULIA 3NWWA 3I5ZA 4K9YA 5DH3A 5DNRA 4FEXA 3W2SA 4RZVA 5I9XA 5TKDA 3HAVA 2F4JA 5CASA 4O0WA 1Y6AA 4EHEA 4UB7A 2O8YA 3BU6A 3G9NA 4XG4A 4FZAB 3RCJA 4XG9A 4D2RA 5HE3A 3C1XA 1SVHA 2QQ7A 4LV5A 4OTHA 3W0PA 1VHHA 3NUPA 2CJMA 1YXXA 4L44A 4GU9A 3D15A 2YITA 1J1BA 4ZSEA 4RQVA 5C9CA 3OT8A 5BVOA 4ZLYA 2VO7A 3NAXA 4RC3A 1IEPA 3UYTA 3P7BA 1PW2A 5HLWA 2IBGE 4FKRA 4W8EA 3VS2A 2BDWA 5J9LA 1BI8A 3KL8A 4HYSA 2EU9A 4XHKB 3Q4ZA 2XJ0A 4R1YA 4FTIA 4RIYB 3VUIA 5IF1A 3HKOA 3W10A 1SNUA 3MH2A 2BTSA 3UQGA 5DEWA 3QYZA 3HUBA 4YJRA 2QO2A 2GPHA 2X8IA 1E1XA 4K2RA 5LWNA 3Q6UA 1ZLTA 2QU5A 4M15A 4WOVA 3LQ5A 2IW8A 4DEBA 5HCYA 3ZFMA 3F3VA 3DLZA 4PMSA 3TZ7A 3MW1A 4FT3A 4UALA 4XBUA 4LG4A 4F4PA 2R3HA 3LLAA 4TL0A 4GKIA 2XIKA 4O81A 3I79A 3WZJA 3TZ9A 5L6PA 3RP9A 3DAKA 3QQJA 5H9BA 4DITA 4O6LA 3CC6A 2VX0A 4TYHA 1B39A 3AKKA 1AQ1A 3ZC5A 4ONAA 4V04A 2XNGA 4EOLA 3LHJA 4NCTA 3A7GA 3LM0A 1IASA 2VTNA 3MJ2A 4TXCA 2BPMA 4G9RA 3ENMA 4NWMA 4QP7A 5CU4A 3DXNA 3ZOSA 4DDGA 3BZ3A 4ZIMA 3POOA 5M57A 3V5QA 4DEDA 5HE0A 5HORA 1T45A 3UOLA 2WTKB 4NW6A 4GIHA 1PF8A 4EJNA 4DN5A 2C4GA 2WMBA 2JAMA 2VD5A 2VWWA 2ZV8A 5CSXA 3MB7A 3UNKA 4RFYA 4BVUA 1P2AA 3KEXA 3P78A 2UW8A 2WHBA 3HYHA 4BCOA 3IGOA 3VS3A 5K5NA 5KBQA 3E8NA 5CQWA 2HYYA 3PA4A 4W4XA 2WELA 4FOBA 4FVQA 3QXOA 4A4OA 2YISA 3BYUA 4GK3A 4BJJA 5HG8A 3K7HB 3FLNC 3NW5A 4AGCA 4C0TA 2REIA 4I94A 2YEXA 2IWIA 2I6LA 3MESA 3AD5A 2NYAA 4LOQA 3R9NA 4CSVA 4FVRA 1W82A 4J7BA 3TACA 4G6OA 3FQHA 4HCTA 3EL8A 3R7OA 3PSDA 4FA2A 4U80A 3UDSA 3D7ZA 4EH7A 1YDRE 2PUIA 2PHKA 5HLNA 4DAWA 3I5NA 4JQEA 5HG5A 5CT0A 2R3LA 2QKWB 4C38A 4ACMA 3EZRA 1ZRZA 2R9SA 3QHWA 5E8ZA 1Q99A 2WMUA 3CIKA 3PJ3A 1KE6A 2GFSA 2UUEA 3FL5A 4FTJA 5HKMA 4RIWA 1Q24A 5L2IA 2IJMA 3HRCA 4BCKA 4I24A 4NH1A 1M7NA 2R3OA 1IA9A 2PMOX 4AA4A 1KV2A 4O7RA 2FUMA 2QG7A 2J51A 3K5VA 4GUEA 4C36A 4CTCA 4FKGA 4FTKA 4I0TA 2ZM3A 4LFIA 3RHXA 3AXWA 2BROA 1H1PA 3OWJA 5JGBA 2ZM4A 5CEPA 1V0OA 5AWMA 2PSQA 4WBBB 4FKPA 3UG2A 4V05A 4AZEA 4XG2A 4PV0A 2F9GA 5FBNC 3EFJA 3B8QA 4DEEA 3TEIA 2HZIA 4EQUA 2W0JA 3CD8A 3OWPA 2A27A 3P79A 3LXKA 1LEWA 5F20A 3T3VA 3D2IA 5ANKA 1I44A 2PYWA 3MH0A 1P5EA 1PXIA 4KBKA 4JX7A 4EOJA 3DDQA 5A4QA 2EUFB 3H4JA 2B9FA 3LJ0A 2W5AA 4Q9SA 4EL9A 5I0BA 4MXCA 3FPMA 4JLCA 3DNEA 1UNLA 2J50A 4FL2A 4PDYA 4W8DA 5HBJA 4U0IA 4DFLA 3PXFA 3COKA 2C6IA 4U81A 5JFWA 2XH5A 3HV6A 4MNEA 4AA0A 1OGYA 3MB6A 4ENYA 2A19B 4QMVA 4O38A 4U42A 3TNHA 2VUWA 2R2PA 2UZDA 1BUHA 3OFMA 4JDKA 3OOGA 3VWAA 4A9UA 5L8KA 3A7JA 1ZZLA 3PXKA 4PMMA 4FI1A 1WBPA 2OLCA 1Q3WA 4FUYA 3K7JB 1W7HA 3DU8A 4YLKA 1JKSA 1ZYJA 1IAJA 1PY5A 1WFCA 2XK7A 3QQUA 1DI8A 4EWHA 3HECA 5CU3A 4HVGA 2IG7A 3QQGA 1JNKA 4IDVA 2V55A 2NP8A 3AC8A 5KKRC 3E8DA 5CF8A 3GCQA 1TVOA 3VW8A 3BYSA 1J91A 3C5UA 4LI5A 4W4WA 5JGAA 1WAKA 1WCCA 2ZOQA 3MTFA 3GC7A 2ZV2A 1KE5A 3HDNA 3QALE 3VAPA 2W7XA 4QMWA 4YO4A 4ZLZA 4WUAA 4BDBA 5LVMA 2JDVA 3SW7A 3N1GA 2Y4PA 3TIZA 4ASDA 4IZAA 4G3CA 1P4OA 4NW5A 5EYCA 5LXMA 4O2PA 5D7VA 4MPHA 5BVNA 2H9VA 4RIYA 2ZMCA 4HGTA 4LQMA 3O0GA 4EQCA 5EI8A 1O6KA 4MEDA 4FEVA 3D2KA 3ETAA 2BRBA 3R71A 4WNOA 5M4FA 4BCGA 2YACA 3LIJA 2PWLA 2AYPA 3FKOA 4DH8A 1G5SA 4X6RA 2WMWA 1YHWA 2WPAA 3PRFA 3SKCA 3ZLWA 1YWNA 4AA5A 3F5UA 4N6YA 3FZOA 2BRMA 1M2PA 4RJ3A 4CVAA 1QPJA 4NU1A 1H28A 2UW6A 4GEOA 2Y6MA 2CKPA 4J8NA 4EHGA 3QCQA 2YWPA 2QC6A 4P5QA 5JGDA 4M97A 3DQWA 3H9RA 4EOSA 3UQFA 4U8ZA 3QKLA 3TV4A 4M7IA 4IWOA 4FV8A 5C27A 2PZYA 3VUHA 2X0GA 5B7VA 3OW4A 3VUKA 3ALOA 2JFLA 1OBDA 2WMSA 4GCJA 4FTQA 4HGLA 2JDOA 4CTBA 2IVUA 5DHJA 5HBEA 4AN3A 4DFXE 4LRMA 3RZBA 4F08A 3KULB 3BRBA 3ZRMA 4ANMA 3FHIA 3U6JA 4D5KA 2E9PA 3R02A 4G3GA 1G8KA 4KKHA 3QUPA 3UOHA 3PSCA 4EZ3A 5J9YA 1TQPA 1Y57A 1VYZA 1YXSA 3LAUA 4KKEA 3WI6A 5EM7A 4FKUA 1M2RA 2GQRA 2XAOA 4FV1A 1G8JA 2ERZE 1SNXA 4PTCA 2XARA 5M4UA 3OXZA 4AW5A 3EN7A 3IONA 2FSOX 3MTLA 3NAYA 4GFMA 4O0SA 5H8BA 4EK5A 4WG5A 4IAKA 2AC5A 4TWPA 4F7LA 1RJBA 4FZ6A 4EKKA 4IC8A 4QTAA 2CNUA 5CQUA 3UIBA 4JI9A 4QMLA 3K3IA 4DEAA 4KNBA 3DKGA 4XV1A 4M67A 3IW6A 3F2NA 3IQ7A 3NNVA 3R04A 2WEVA 3NUUA 4APCA 1XH5A 4LGGA 2OJIA 3L9LA 2QOFA 3BHUA 3FMJA 2OIDA 4JG6A 4OTDA 4R5SA 3O50A 1ZY5A 4XP2A 1GZ8A 3RPSA 1Y8YA 2ITPA 3R0TA 2VTOA 2R3QA 1FVRA 5E92A 4J97A 4RX5A 3DK7A 1H1SA 2P2HA 1NW1A 4KUJA 3R7IA 3ET7A 2CNQA 3HUCA 1YOMA 2Q0NA 4KRDA 4NSTA 4QMPA 4XLIA 1CSNA 4D9TA 5A6OA 4JL9A 5LMBA 5CWZA 2V22A 3QA0A 3QCYA 4FEQA 4CT1A 4DTAA 2PZ5A 2Z02A 3VS4A 5EI6A 5K9IA 3C4XA 3FDNA 5HX8A 3OHTA 1DS5A 2YFXA 3RALA 1Z9XA 5CXZA 4C2WA 2XIZA 4X2FA 3H30A 3KXHA 3R1NA 1JSUA 2WAJA 4IC7A 1YWVA 2GHLA 4F63A 3NNXA 3ZDIA 1JVPP 3EYGA 3DKCA 1WVYA 5J1VA 4OUCA 4X2GA 5TT7A 3MSSA 3QTUA 3ACKA 5I9VA 2UVZA 3VBTA 2J0LA 2J0KA 4QMSA 2G1TA 1O6YA 2QI8A 1ST4A 2B55A 1IG1A 2F2UA 1XH6A 2DYLA 2VTAA 4QNAA 2GS6A 3QAME 2BAJA 5HICA 2YIRA 4KIPA 3HLLA 4FNZA 3V5PA 3BE9A 4YJSA 4DHIB 5LOHA 3EYHA 4WD5A 4NJDA 3MPMA 3MBLA 1PJKA 4E1ZA 5ANOA 2I0EA 2A0CX 4UEUA 2WQMA 4Y83A 2UZWE 5EHLA 4DTBA 1IAHA 4FKSA 3DBEA 4KAOA 4B6LA 3CGFA 4BICA 5JT2A 4I5MA 4TWNA 3N1RA 3Q2MA 1SYKA 2V62A 2XCHA 2R3JA 4XP0A 3ZUUA 1PYXA 1NY3A 4L45A 4C37A 4ZY5A 4UYAA 5EW3A 4EUUA 1WBVA 3DK3A 4DE4A 2FH9A 2V7OA 1ZXEA 3RNIA 3OOMA 4S32A 3ZEPA 4QYGA 3IW5A 5CVGA 4FG9A 4QRCA 4BDCA 3NYNA 1U4DA 2H34A 3ROCA 4YZBA 4EBVA 5HTBA 3OEFX 4D0YA 4QTDA 2BTRA 4QO9A 1MRUA 5HGIA 1DAYA 4YLJA 3V8WA 2BUJA 1BYGA 2WMRA 2W4OA 4G3EA 3ROYA 2ZVAA 4GT4A 2C6KA 2VTSA 3MDYA 2OFUA 3W2OA 3QRIA 3CCNA 1MRVA 2W5BA 4CLJA 3CLYA 4FSYA 2J5EA 2H6DA 2J9MA 4AWIA 4W4VA 4R7BA 4YTCA 4FSNA 5LMKC 2ESMA 3M42A 3R1YA 4KIOA 4AXCA 2UVXA 5EG3A 2C68A 3DBCA 4BDIA 5CEQA 5M09A 4YURA 3UDTA 2ETRA 4ENXA 4WKQA 3V04A 4D1ZA 3UOKA 3UP7A 3RK5A 3COHA 3L8XA 5HVYA 3RVGA 4DCEA 5EKNA 4EH3A 4R7IA 5HU3A 2OK1A 4FL3A 2VGPA 4X21A 4G31A 2G2FA 2OF2A 3V5JA 4NT9A 3G15A 3U54A 3DZOA 5BVDA 1UKIA 4HGEA 3LXNA 2R5TA 4ZTSA 3ZLYA 4DA5A 2C69A 3UPXA 4KSPA 2OJ9A 4BCJA 3GFWA 2Y6OA 4QMMA 4M14A 4TTHB 5E8WA 3SGCA 3NZ0A 2G2HA 2BKKA 3O96A 3FE3A 4R77A 2YM5A 3GXLA 5AX3A 2QVSE 2V0DA 2ZMDA 4I6QA 2X7FA 5EQYA 3W32A 4FSWA 3QLFA 3THBA 5CY3A 3VS1A 4AXFA 2ZB0A 2JKQA 3R1QA 4MD7E 2C5XA 5IQAA 3D5UA 1QCFA 3QQHA 4DFNA 4FZDB 5LVOA 3SDJA 4BI2A 2OIQA 2JAVA 4L6QA 4DHJA 2O65A 3S3IA 3HX4A 3FJQE 4GG5A 3AOXA 5DBXA 5L8JA 3WF8A 2PVKA 2X2MA 4CLIA 4D0WA 1MRYA 3GCPA 3I1AA 4FTTA 3KULA 3D4QA 3NUYA 4WG3A 4PP9A 3KQ7A 1OMWA 4QQ5A 3U9NA 2R3GA 5JSMA 1RQQA 3OWLA 5HESA 3CGOA 4WUNA 4Z7GA 2GTMA 4OW8A 1UWJA 3FXZA 3V3VA 3QZFA 3QX4A 2X6EA 3C4CA 4BR3A 4DH7A 4XMOA 4C3FA 3DFCB 4YNEA 5M55A 2CNVA 4ANLA 3ORXA 2XYUA 3IDCA 3NUNA 4AZTA 3CQUA 4EH6A 4FV3A 5FTOA 4QMNA 3U6IA 4I6HA 2ITOA 3DK6A 4TYJA 5CTPA 3VRZA 4M69B 3VBQA 2HZ0A 4R1VA 2BRHA 3HV4A 3UJGA 3VJNA 4KS8A 3NYOA 3QQFA 2B7AA 3MGYA 3LCKA 1LP4A 4JBVA 5CSPA 1QPEA 3G51A 5B2KA 4N4SA 4NM7A 5J7HA 3ATSA 3F3UA 4CCUA 3EQRA 4RFMA 1JAMA 3QWJA 4M8TA 2FSLX 4APPA 3ZC6A 3R7YA 4IE9A 4F7JA 2QHMA 4QMQA 2OJGA 3ZUTA 4E93A 3Q9XA 4J95A 4IMYA 3W33A 1U5QA 1Q4LA 5C8NA 4PMPA 2R3RA 4JXFA 3FMMA 4FV0A 4KWPA 3UO5A 3WF5A 2OU7A 1XWSA 3F6XA 4AZFA 3COMA 3ZUVA 4X3FA 3AQVA 2VO9A 3FL4A 3KRWA 2B53A 2P55A 2XEYA 2JIVA 2QOLA 3FC1X 3KXZA 3NMUF 3MWUA 4A9SA 4L00A 3ULZA 2W1FA 3FMDA 2I0YA 2VTLA 2XVDA 2YM3A 4X3JA 3LCTA 3PP0A 4R7HA 5EOLA 3NUSA 4U40A 3EKNA 3ZO4A 1BLXA 4BGHA 2XEZA 3LKMA 4CRSA 4ZJVA 2OF4A 5BVEA 4MXAA 4E6CA 1WBSA 4CKIA 2O0UA 1VLRA 1YI3A 5ETFA 3DXPA 4NYEA 4GYIA 1XBCA 2PZPA 4DEIA 1R0PA 3IG7A 3NCGA 3KRLA 1Z5MA 3FHRA 3N1OA 1H1QA 1YHSA 3W0QA 1QL6A 4R6VA 3GOPA 4TKSA 5FBOA 2F7XE 5IG1A 3EFWA 4I3ZA 4UV0A 3OW3A 4O96A 3BLQA 4YC8A 4RJ4A 2FGIA 4YPSA 4RJ6A 3DDPA 5HNBA 4K0YA 3R7VA 4ACHA 4F9BA 4XUFA 3E64A 4ORKA 3QFVA 4I92A 2HY81 3RINA 4KKGA 4B8MA 2Z2WA 4YJQA 5LVPA 3GCVA 4H3PA 4IZ7A 4N70A 3WZDA 5GINE 3PXRA 5DRDA 3NVKI 4M0ZA 2ONLA 4Y46A 5IQIA 5F4NA