4F78A

Crystal structure of vancomycin resistance d,d-dipeptidase vanxyg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
251
Chain Sequence
GMMKTIELEKEEIYCGNLLLVNKNYPLRDNNVKGLVPADIRFPNILMKRDVANVLQLIFEKISAGNSIVPVSGYRSLEEQTAIYDGSLKDNGEDFTRKYVALPNHSEHQTGLAIDLGLNKKDIDFIRPDFPYDGICDEFRRAAPDYGFTQRYARDKEEITGISHEPWHFRYVGYPHSKIMQENGFSLEEYTQFIKAYLEDNKYLFEQAHRAEIEIYYVPAKDDKTLIKIPENCVYQISGNNIDGFVVTIWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D,D-dipeptidase/D,D-carboxypeptidase
publication title Structural basis for the evolution of vancomycin resistance D,D-peptidases.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Hydrolase
total genus 71
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02557 VanY D-alanyl-D-alanine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.180 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f78A01
3.30.1380.10 Alpha Beta 2-Layer Sandwich Muramoyl-pentapeptide Carboxypeptidase; domain 2 Muramoyl-pentapeptide Carboxypeptidase; domain 2 4f78A02
1VHHA 2VO9A 2WFQA 4C4MA 2WFRA 4MUSA 4JIDA 3K7GB 4NT9A 1LBUA 4MUTA 4D0YA 4OAKA 3M1NA 2WG4A 3N1FA 2WFXA 3N1GA 3K7HB 3N1PB 3D1MA 2IBGE 4MUQA 3N1MB 1R44A 4C4NA 1TZPA 4OX5A 3N1QA 3K7IB 4F78A 3N1RA 4MPHA 3N1OA 3HO5H 3MXWA 1U10A 4MURA 4OXDA 4OX3A 3K7JB 5HNMA 2WG3A
chains in the Genus database with same CATH superfamily
4M3QA 4FEUA 3F69A 2W17A 3DB8A 2Y8OA 2QONA 3GC0A 2V7OA 2ITYA 2PULA 4FV2A 3NUYA 3O71A 4MHAA 3BU3A 4KSPA 1AD5A 1M2QA 4ERKA 5E8SA 5EM7A 3THBA 2PVJA 2VNWA 4O7VA 3TCPA 3LXNA 5HD4A 3IG7A 2XNNA 4YPSA 5ANEA 5AUVA 1GY3A 1Q5KA 2JD5A 2XKFA 4XYFA 3UOLA 4KBKA 5H8GA 2W1HA 3QU0A 1YOJA 3ANRA 2HW7A 3BYVA 3EFLA 4MX9A 4TW9A 4YBKA 2WMVA 3LXPA 3OP5A 5HE3A 4FIIA 5E8ZA 4AA5A 2C6MA 5HBEA 4CFXA 4RIWA 5CU0A 1OKYA 5HVKA 2ZMCA 3EFWA 3AQVA 1M2RA 3MA3A 3CPBA 4FEQA 5HZNA 3LLAA 1NT2A 4C35A 2WFQA 4I24A 3VUIA 3DAEA 4PNIA 5AA9A 4ZJJA 4DGLC 4NZWB 2CMWA 5F4NA 1E1VA 3TNHA 4F9WA 2PZIA 2WFXA 4GSBA 1Q8TA 2J7TA 3BHVA 3FKLA 1UV5A 2IW8A 3V6SA 4AGDA 4AZTA 1YXSA 4ONAA 2BPMA 4ARKA 5JGDA 1NVSA 2W1IA 3UP7A 2C68A 4E4XA 4S32A 3GC7A 2O0UA 3BBTB 1CM8A 2IWIA 2PUIA 3JY9A 3D0EA 1R3CA 2RIOA 4KWPA 4E20A 5M57A 3GFEA 4L7SA 3C0IA 3WF7A 4OTWA 5CEKA 2GS7A 3UZPA 1FMOE 1OPKA 2FO0A 4A9UA 4DFNA 2XK9A 1V0OA 3QQFA 2BAKA 3QCSA 4RX9A 2QLQA 4R1VA 3IDBA 1FPUA 4RVLA 3IECA 3I5NA 3QD0A 1UNHA 4BCFA 2Q0BA 3T8OA 4QP1A 2UW5A 1BKXA 2X8DA 5T68A 1AGWA 2O8YA 3M1NA 4X6RA 3QC9A 1BI8A 3NFFB 4ZXTA 4F0FA 5HO7A 4CSVA 3NNUA 1FVTA 3LJ1A 4I5CA 2RF9A 2WEIA 3ORMA 5AP5A 3CUEB 2QOOA 2X0GA 2F2UA 3MB6A 4FKOA 5D10A 3W2CA 4E4MA 2PVFA 3EKNA 1JWHA 3HO5H 4OR5A 4AA4A 2UZDA 4HPTE 2C5OA 1NXKA 2C30A 2QOHA 3D7TB 3DXPA 4FV3A 4IWQA 4E73A 4FEXA 1CSNA 4IFGA 3OT8A 3A4OX 4BDEA 5BUJA 2HCKA 3QLFA 5JRSA 5TO8A 3LXLA 3Q4ZA 3H10A 1M17A 4WG4A 5EW9A 1IA9A 3R30A 3GU7A 3KRLA 4IAAA 4EOQA 2BRGA 2J0JA 4PL4A 4XNEA 2BRBA 3MYGA 3ZLSA 4RWKA 3ZRKA 3AT2A 2BTRA 1FBNA 1WBWA 1Z5MA 3DKCA 3DT1A 3D2IA 3MFRA 4O6LA 4DE4A 2PZRA 4MXXA 4OBPA 4L9IA 4WHZA 4IB5A 2VWUA 3G51A 2ONLC 2GQRA 5JKGA 4GJ2A 3OBGA 3MGYA 3QA8A 4NW5A 1KUTA 4AW1A 4V05A 2V7AA 3HL7A 4ZMFA 1H1RA 4OTDA 3VS1A 1OB3A 3COMA 3ZDIA 4BCQA 5BUEA 5CEIA 3BBWA 5C8NA 4O7SA 3HV5A 3H0ZA 3HP5A 3KXGA 4GFMA 4NKAA 4YJPA 3WIGA 2QURA 4RLLA 1UWJA 5J9YA 5C01A 4EUTA 3R04A 4BGGA 4O22A 4LOQA 4AP7A 1H27A 2JFMA 4G6NA 2CHLA 2IPXA 4BCJA 4R7HA 2J9MA 5J87A 3UO6A 1W84A 4EL9A 5E1EA 5ETCA 3POZA 5F94A 5CANA 2YDKA 3COKA 4RJ6A 3TNQB 5IISA 4LMUA 1PXIA 3DJ7A 3QZGA 1KOAA 3PG3A 2OF4A 3ODYX 4FK3A 5CWZA 4BI2A 4DEBA 4MURA 3PE1A 3KRRA 4QT1A 4R1YA 4HYHA 4V0GB 3QTXA 1DAWA 2WQOA 2CJMA 3DTWA 4E5BA 2ZB1A 2X1NA 3K7GB 3FXWA 4I5HA 1G8SA 3Q5IA 4FSNA 3TACA 3KEXA 3GOPA 2YIQA 3QTUA 4EHGA 5D9HA 3PXYA 3D7TA 1OMWA 3BHTA 3OWJA 5TT7A 1XBBA 5DWRA 2KULA 2OIBA 2C0OA 3E7OA 5BVDA 3R1QA 3LW0A 3KVWA 4ITJA 3I0QA 1F5QA 1ZLTA 2CGXA 5TR6A 2R3QA 1WVWA 4K77A 4ZY5A 3C5IA 3EB0A 4J53A 2BDWA 3TUDA 4F9AA 3ZLWA 3G6GA 3ZFXA 2WMWA 3PJ3A 3C4WA 3RAKA 4H36A 4IHPA 5FD2A 4I4EA 3JPVA 4BZDA 4QTDA 5H2UA 3PG1A 4BDBA 3H3CA 3MY5A 4FG7A 2QKRA 2OJJA 4AGUA 4FTQA 4Z9LA 4F7NA 2YM5A 4YZBA 4DH7A 1OGYA 2B1PA 3F82A 3JVSA 4GMYA 2PMNX 4TYGA 4BY9E 1RJBA 4PV0A 4F99A 3HUCA 3HMMA 3ERKA 3PXFA 4Q9ZA 2O65A 4TYJA 5LVPA 2A0CX 3OVVA 4FTNA 4BYJA 2QVSE 5AIKA 2UW3A 4FG9A 2I0VA 1XJDA 3BPRA 2EB3A 3FY2A 4RJ8A 5EKOA 3V6RA 4BDDA 2OIQA 4FVRA 5FTQA 4GJ3A 4DDIA 4EWQA 3QCYA 3DGKA 3OF0A 4RA4A 4QQTA 1WBPA 3NEWA 4XV9A 3HV6A 3RCDA 2BJNA 3NCZA 2UZTA 3JR1A 3UG2A 3VHKA 4XV3A 3VS2A 2ZOQA 4DH3A 2Y7JA 4C36A 4V01A 3V51A 3NS9A 4V0GA 4CRSA 2ACXA 4Q5HA 4DLIA 3Q96A 1PY5A 2ITTA 1KE7A 5CAQA 4NH1A 3IS5A 3AC4A 3NLBA 1YI3A 4L8MA 5EOLA 3UDSA 3OUNB 4FV4A 2F49A 3EYGA 4FKUA 4CZUA 4EZ7A 3HMPA 4ACHA 3ENHA 4U9AA 4CVAA 3GCUA 3RNYA 4DFZE 1W83A 4FZAB 5DBXA 3EKKA 4XJ0A 2W05A 2XIYA 2CKEA 4G5PA 4HYSA 4U97A 2W9ZB 4TKSA 2WEVA 2X7GA 4R3RA 3U9NA 3NMUF 3N1FA 2IZTA 3C4EA 3UP2A 1ERKA 4DT8A 4QMQA 4HGEA 2XNPA 4LI5A 4RJ3A 3TM0A 5JFVA 3ZS5A 4XP2A 2YACA 4YHJA 4OBQA 4WO5A 5AM6A 4D4RA 1PMEA 5IQHA 2XMYA 4YJSA 3PVWA 1HOWA 1H1SA 4N0SA 4X3FB 4XBRA 2OXXA 2VRXA 2ZM4A 1ZMWA 2YZLA 2VO6A 3DBEA 3LAUA 5E92A 1IASA 5H9BA 4BBFA 3V5QA 4MF1A 3ZOSA 2ZDTA 2HXQA 5BVWA 4HNIA 4DHZA 5IMEA 3W33A 1W98A 2E9PA 1NY3A 4FV8A 1H0VA 2VAGA 4IH8A 3BYOA 3DBDA 1NVRA 3HNGA 2VTHA 5CAUA 3FV8A 1ZOGA 1YWNA 3KMMA 1UVRA 4IACA 3VULA 5DRDA 2BKKA 3VUHA 5HBHA 1U46A 3ZH8A 4C4EA 3S00A 2GQGA 1SVHA 4AE6A 5AWMA 3W0MA 4YC6A 5M09A 2WQBA 5EI6A 1JOWB 4GU6A 5LOHA 1QPDA 2OLCA 3S95A 1PJKA 3PXZA 2BZIB 2YITA 4XHKB 3MJ2A 5L2WA 3OTUA 4AN9A 2Z7SA 4XBUA 3DTCA 4W4WA 2ITUA 4R7IA 1Y8GA 4PDPA 3V5TA 3VS5A 3DDPA 4ACCA 1JKKA 5HTBA 2XS0A 2OBJA 3LIJA 2ZJWA 5HHWA 3C9WA 1OIYA 5TOZA 2FH9A 5CEQA 4IE9A 3SHEA 1O6YA 2B55A 2JAMA 3AD4A 4FTKA 4DG3E 3F6XA 5FLFA 3ZRMA 3GU5A 4OX5A 5GINE 2OJGA 4ASXA 2Y4IB 2ZYBA 2YWVA 3D5WA 4JR3A 3IOPA 4O84A 4U42A 4ANSA 4ORKA 4ASZA 4IMYA 3EIDA 4B0GA 2W4OA 4JR7A 1OKVA 5FEEA 4CTBA 1YVJA 1FOTA 2YDJA 5I9ZA 2QOKA 2C6IA 4F7LA 3QQKA 4MXOA 3VNTA 1P4OA 3BGZA 3E64A 5CI6A 2WTVA 4DINA 5A9UA 2KTYA 3SGCA 1R39A 5GNKA 4A9YA 5CT0A 3ALOA 5HBJA 4E1ZA 5CAPA 2IZSA 1OKWA 2VTSA 3R8PA 1UU9A 5FGKA 2J3TB 3F3TA 3G5DA 4X3FA 4I92A 2Y0AA 3EQFA 3VBVA 4AX8A 4BKJA 2I1MA 4D5HA 4ANQA 3KN5A 4MPHA 1GZ8A 2PVRA 3RM7A 3E3BX 3EJ1A 4DC2A 4TXCA 3AMBA 4IAFA 3LXKA 4V04A 1OI9A 2WTKB 3A60A 4LRMA 3LCKA 5JEBA 4EWHA 4RZVA 4UEUA 1H00A 4JVGA 4KSQA 3LCDA 5H8BA 1RQQA 1H24A 3JVRA 3CY2A 4P4CA 3UNKA 4GH2A 2O2UA 3RHXA 4HOKA 4ENXA 3RWPA 4ZTSA 3ORZA 3Q6WA 2QU5A 4FSZA 1APME 1ZY4A 4IX6A 5CS6A 4QYGA 5B7VA 4BR3A 3DJ5A 5F1ZA 2C6OA 3E8CA 2OGVA 2P33A 5LVOA 1JVPP 1R1WA 2JKOA 4FYOA 4IWPA 3EQPA 5F20A 5BNJA 4F7SA 1UU3A 3O51A 4XP3A 3C51A 3A62A 3CSVA 4I0SA 5FBOA 4CMOA 3OW4A 3PIYA 4P90A 5HNMA 3NNXA 3IW4A 1Q8WA 3H0YA 4FKIA 5HLPA 1S9JA 3OC1A 2NYAA 3R9OA 3QD4A 2OH0E 3R8VA 4EOPA 5JFSA 4RJ4A 3OY3A 2VTMA 3FZSA 4FSTA 2PVNA 5A4LA 2X2LA 3R9RA 4G6OA 2AEGA 3R7EA 3HA6A 4IZAA 3HMIA 3BYMA 3O0GA 4C59A 3RK5A 3TV6A 4EZ3A 3GC8A 1WBNA 3II5A 3OXTA 5AM7A 4AN2A 1Y91A 1E1XA 4FKQA 3SXRA 3AC8A 4O81A 5JZNA 4F9BA 5IQEA 2FSLX 4J1RA 1Q8UA 4J71A 3DFAA 5JQ5A 4G17A 2VD5A 4YC8A 4BTFA 4FTTA 4D9UA 3T3UA 5EDRA 2YHVA 3G0EA 3WBLA 5J1VA 4P5ZA 4LQMA 2QQ7A 5ICPA 2GDOA 5EYMA 2QO2A 4XV2A 4IIRA 2QOLA 4R5YA 3BCEA 2E2BA 5J9ZA 1JBPE 4FNZA 2XJ0A 3GT8A 2RFNA 3DFCB 2W5HA 3W0NA 2J3TA 4AXAA 3EMGA 4ASDA 5JRQA 4BHNA 2WFYA 2WU7A 3LKMA 3R8UA 5IDNA 3FZOA 3KF4A 4G34A 2F7EE 2W5AA 5DGZA 5BVOA 3C0GA 1R44A 5CNOA 4BIEA 3NNVA 1PMUA 1UNGA 2CNVA 2EUFB 4NCTA 3TNWA 4NW6A 4MH7A 4FKTA 3HMOA 4C62A 3RGFA 3POOA 4R6VA 4KIQA 4HZSA 5M08A 1Y6BA 2JLDA 3Q9ZA 2BVAA 4O0UA 4BI0A 3BU6A 4FV6A 2WTIA 3GCSA 5IEYA 5HE0A 4DAWA 3QWJA 4IEBA 4WRSA 1XO2B 3R7OA 4AF3A 4EYJA 4JDHA 1YKRA 4M68A 3BX5A 4BC6A 4C02A 3UQGA 5DEYA 4AXDA 4TL0A 1Q3WA 4NUSA 1OZ1A 3UOJA 2BDJA 2HOGA 1XMLA 5KKRB 2C69A 4YURA 2X2KA 3F3ZA 4G3CA 2PVMA 4JX3A 5F9EA 4D5KA 2QO7A 5IZFA 4NIFB 1Q8YA 2YJSA 2PPQA 3E8EA 3MPAA 3QTWA 3CQWA 5A4QA 5AV1A 3ORLA 3MI9A 3KF7A 4IX3A 1H1PA 2J5EA 3HVCA 2Y6MA 2WOTA 2XIZA 2PU8A 4BVUA 3LM5A 3G9NA 4FGRA 1A06A 4I20A 3F5XA 3IGOA 2X6DA 1WFCA 2HW6A 3F61A 3GFWA 5JH6A 3A2CA 4RVMA 3SOCA 1G5SA 3KMWA 4KKEA 4ZTNA 2VWVA 4FV9A 4ZS4A 1GZKA 1TKIA 3FUPA 1GIJA 3KN6A 3NIEA 3B8RA 3FPQA 1UKHA 1SZ7A 1J7IA 3I6WA 4OW8A 3FWQA 5GIOE 2W99B 2VTLA 5AV4A 3TUBA 3QRTA 4R3PA 4LFIA 5TF9A 1PXMA 4J97A 4FMQA 4EOSA 3R02A 3N1OA 3C4FA 2RG5A 5EK7A 3UPZA 4RIOA 1VYWA 2G01A 3WYXA 2WTJA 3UVRA 1R0EA 5EDQA 3KXNA 3V8SA 3FLSA 5IU2A 4D1XA 1ZAOA 2C3JA 3EN5A 3P23A 5BVEA 5HE2A 5E7RA 3N4TA 5D12A 4F0GA 1ZMVA 2V5QA 5D7AA 3T9TA 3BQRA 2BAQA 2R3PA 1ZZ2A 3UE4A 1U5QA 4DTBA 1ZYSA 4N6YA 3BYUA 3FYJX 4U79A 4S33A 5C03A 2CCHA 5IDPA 2H6DA 3SDJA 1SMHA 5D7VA 1SZMA 3MTFA 3FQHA 3MVJA 1H28A 3R8ZA 1T46A 3H9OA 3SG9A 3UIUA 1QPCA 2W5BA 3QGWA 3GP0A 2XEZA 4JOAA 4JDIA 1G8JA 4L7FA 4LL5A 2CGWA 4FEWA 4O7LA 5AEPA 3AGLA 4XG8A 5GJGA 4GEOA 2X6EA 4KNBA 4LMNA 1PYEA 4DGGA 3LVPA 3UNJA 3FEGA 3QHRA 4WG5A 2GNGA 4I93A 4DTKA 2P2IA 5ANIA 1OVEA 4JLCA 4MK0A 2YCFA 3ZBFA 4FIJA 3FL4A 3Q9XA 2HZNA 1SNXA 4YSJA 2UW7A 3EH9A 5IA1A 5IQBA 3TZMA 4JJRA 4RIXB 3F66A 3OT3A 4APPA 4DH1A 4AW5A 3C4XA 5FRIA 4D1ZA 2RFSA 3E3PA 3FMMA 4ALUA 3I79A 1OPJA 2ZM3A 4J98A 4YLJA 5CX9A 2EVAA 4IDTA 2XANA 3KQ7A 3N4VA 5HE1A 3VONA 3A7GA 3FLWA 5E8XA 4ZTLA 4RFMA 2C3IB 3ORTA 5CZHA 3W8LA 2XJ1A 4YZMA 1P14A 2HWPA 4I94A 4ZEGA 2JKKA 2F57A 3CD8A 2CNQA 2Z2WA 2WTWA 4FUXA 1XMMA 1Y8YA 4ZTHA 4RIWB 3NYOA 1XH7A 2I40A 3QD2B 3TMOA 3JS2A 3CKWA 4F1OA 4MBJA 5HIBA 3DZOA 3SW7A 4ZSJA 4GK2A 3E93A 4YJQA 3ENMA 3WE8A 4WT6A 3V5WA 5A6OA 4WNMA 2W06A 5HORA 2QOBA 3QTQA 3I60A 1SNUA 2OIDA 3QKKA 5EYKA 2XK8A 1ZRZA 3CD3A 2XNOA 3CQUA 5ACBC 5AAEA 5B2LA 2R0IA 3AC3A 4W4VA 2JKMA 5LXMA 5ANKA 3F5GA 4GW8A 3B2TA 3E63A 4XV1A 5IA2A 2R3KA 3F3WA 2QOCA 3ORNA 3P86A 3QXOA 2GTMA 4DA5A 3ZTXA 3DNDA 5CVHA 2DWBA 2YM4A 1KWPA 3OCTA 4AT4A 1P5EA 1YHSA 2XK4A 3HECA 3KREA 1OL7A 5G1XA 3NUSA 4D2RA 4S31A 2IVSA 4ZY6A 3R73A 4O83A 4BICA 4F6SA 3QALE 3OCGA 3ZHPC 4QP6A 4EJNA 2FSTX 1ND4A 3ZDUA 3PPZA 3F7ZA 3LCTA 3FE3A 4HNFA 2VV9A 4I21A 4II5A 4UB7A 3D7ZA 3OOMA 3PXRA 4L6QA 4IC7A 4O0WA 4TWCA 3SOAA 2J6MA 4Q9SA 5CY3A 3VJNA 4ZZOA 2J50A 4ALWA 2VTQA 3BE2A 4F6WA 3UMXA 4PDSA 4YMJA 4YO4A 2C5VA 3RAHA 2VX0A 4TYIA 4F1TA 4BDKA 5LVMA 2A2AA 4JQ7A 3OFMA 4WBBB 2WIPA 3EN7A 4FIHA 4QQ5A 2WZJA 1YDRE 3H9RA 3IPHA 3PWYA 4K1BA 4U41A 5J8IA 3EFKA 2R3NA 4RIXA 4E8AA 2B4SB 2PYWA 5KX8A 2GTNA 1BX6A 4OTQA 2XVDA 4RX7A 3RINA 1EH4A 2R3RA 5EQYA 4AQKA 2C6DA 4G31A 4KABA 4E5WA 5HX6A 5IEVA 4IVAA 3GI3A 3W8QA 3PFYA 3CJFA 5J95A 3V5JA 3DA6A 4O82A 3L9LA 4EH8A 4OBOA 3F3UA 4YJNA 3P0MA 3TWJA 3H30A 5IA4A 2UW4A 3FY0A 3DS6A 1WBVA 2QG5A 3KU2A 4YLKA 5LCJA 4CG9A 4QQCA 4EHVA 4EI4A 2YERA 5DA3A 3TG1A 3AKJA 4ERWA 2ETMA 4HGSA 5KO1A 2Z7QA 2C5NA 2X7OA 2JEDA 3BLHA 4NFMA 3JXWA 2NRYA 4QMXA 4XX9A 1CKJA 4YC3A 2VWXA 3UZTA 2XNBA 5FBNC 4AW0A 1H0WA 5GJDA 2OICA 4F7JA 1YW2A 3QZIA 4ANLA 3R9DA 3NUNA 2XBJA 4O7ZA 2BTSA 2J51A 5JMSA 1NVQA 2UVZA 1VHHA 2BAJA 4ZSGA 4XOZA 5FG8A 4RPVA 3VS6A 2VN9A 1W82A 3ZUVA 2VUWA 1G8KA 1YXXA 3HGKA 5IQCA 3VBTA 4CQEA 3VS3A 2E9VA 3PLSA 3DXNA 4YZDA 3TZ7A 4C4IA 4YTHA 5L3AA 2XIXA 1PYXA 2AYPA 4KRDA 3VIDA 5A4TA 5AP3A 5DPVA 3HA8A 4ZSAA 2WHBA 5M4FA 3PA5A 3BEAA 4HCUA 3HDMA 5BVKA 1H8FA 1OM1A 3ALNA 5IMXA 1JSVA 4QYEA 3KRJA 1YDSE 3UZRA 4AAAA 3MTLA 2CLQA 3KB7A 4TYHB 3FI8A 2YCRA 3FDNA 5AX3A 2ETKA 2REIA 3CTQA 3TJCA 4E6CA 3UGCA 5M44A 1Q4LA 2BALA 2WQEA 2Z7RA 3HKOA 3LOKA 4JX7A 2OSDA 2WG3A 3DBFA 3NVMB 4FSMA 3G6HA 4FI1A 4FZ7A 3EZVA 3VO3A 4M7IA 1GJOA 4AS0A 5EW3A 2W1EA 4AG8A 3I0OA 4NL0A 1H1WA 1LEWA 2I7QA 4M15A 4E6DA 2YABA 4TNDA 2C0TA 3FMJA 3UPXA 2GS2A 3ACJA 1URWA 4Y95A 4I1ZA 4EZ5A 3O5AA 4IAYA 5AP6A 4FV7A 5KNJA 2CN5A 3BU5A 1TQIA 3DJ6A 4UX9A 2CFHA 2IVUA 1Z9XA 5KBRA 1KV2A 3DOGA 3EN6A 4LDTA 3R0TA 1TFFA 3Q9YA 3VBWA 1GNGA 3VW8A 4X0MA 2WMAA 4AOJA 5HG9A 4X7QA 3TZ8A 2OFUA 1XBCA 3PIZA 3VUKA 4HCVA 4FSYA 4O91A 4W4YA 4WKQA 2ERZE 4NWMA 4RLKA 4EKKA 2W1CA 3NJCA 1VJYA 5LJJA 4IAZA 2UVXA 3HYHA 3HX4A 5EM8A 5L8LA 4LG4A 1ZMUA 4FKVA 1X8BA 3ITZA 4JDKA 5ETFA 5ETIA 5KBQA 2XM9A 4KAOA 4RC2A 2GU8A 4F70A 4G2FA 5LVLA 2V55A 3PP1A 4QYHA 4D4SA 4MUQA 3L8XA 1BUHA 3IK3A 4DFYA 5KMMA 3TUCA 5C27A 3LHJA 5KMIA 2GPHA 2CN8A 4XP0A 3DAJA 5I9UA 4XG6A 3EQDA 4D58A 2G1TA 3R9HA 4XH6A 4JBOA 4Y73A 2JBOA 2QCSA 2PUPA 4FE2A 1U5RA 2HK5A 5C8MA 3UTOA 5M06A 1FMKA 3MBLA 4R78A 1OBDA 4L44A 5C4KA 5HICA 3AKLA 1L3RE 3HAVA 3TYKA 3ZCLA 2YFXA 2IN6A 3GBZA 1PF8A 2NNWB 1UU7A 3PIXA 3L9MA 3A99A 4TYHA 4GL9A 4M0YA 4UYAA 4U0IA 5A54A 2Y9QA 5CEMA 4ZLZA 2CKOA 1F3MC 3KK8A 4FT5A 4Y8DA 3F9NA 3G15A 3VRYA 4RWJA 3OS3A 3VS7A 4YZNA 2WD1A 3AC5A 2BIKB 3P5KA 3HRFA 3ORXA 4IVDA 1ZYDA 1JNKA 2GHMA 3EQCA 4JRNA 4GT3A 4UYNA 4QMTA 2IW6A 4C7TA 1YRPA 5D41A 5L2SA 5DIAA 3PXQA 4HJOA 3ZONA 5DYJA 3B8QA 3TTIA 4PUZA 4GYIA 5EFQA 4A4OA 5E8UA 4MNEA 4BDHA 5BYZA 3OCBA 3R7YA 2GNIA 4XG2A 4DG0E 1ST0A 5I5ZA 2CDZA 4ZAUA 5E4HA 4YHTA 5FXSA 3MH2A 4NSTA 2JIIA 3PP0A 4Y46A 5EHLA 2XEYA 4XCUA 3K7IB 4MBLA 2FGIA 4H05A 4U80A 2E9NA 3BHUA 2B9FA 4GCJA 1WBSA 3UIMA 4ALVA 3RNIA 4HVHA 2VX3A 4BYIA 3MA6A 2W1DA 4O2ZA 4MXCA 4J99A 4DF3A 4A06A 4PNKA 2VNYA 4HGLA 3KCFA 2V22A 2XBAA 4FIFA 5M4CA 3FMLA 3TI1A 3D5XA 5HEZA 4PF4A 3ZEPA 2P0CA 4GVAA 3M1SA 4CXAA 3TIYA 3PSCA 2LAVA 5L6WL 1SVGA 3IW5A 2YIRA 2WTDA 5EDPA 3QTRA 5ETAA 4FT9A 2WKMA 3QWKA 4FC0A 3L8SA 3VC4A 2G2IA 3GC9A 3O96A 3Q2MA 3H9FA 4O0SA 4MWHA 4M0ZA 3FI2A 4O21A 3ORKA 4BI1A 3KCKA 4XG9A 5KMLA 4WOVA 2XYUA 2HENA 3NFGB 3ORPA 4QDEA 5E9EA 4DN5A 5CQWA 2OI4X 4UXLA 1O6LA 1JKTA 1URCA 4XUFA 5DG5A 2FYSA 1ZYJA 1NA7A 2OJFE 3FLYA 3NWWA 4FK6A 5E8VA 5FXQA 1SYKA 2XAOA 3OUKA 3QFVA 4GT5A 5JSMA 3FSKA 1J1BA 3G0FA 4M14A 5DLSA 3A61A 3OBJA 4WNOA 3SXFA 4YR8A 4LGHA 1YXUA 1J7LA 3MN3A 2WMSA 3LMIA 1H25A 3C13A 4F65A 4QTEA 2JDVA 2H8HA 3IGGA 1PMVA 3S2PA 3Q32A 3QQLA 4XEYA 4X6QC 2YEXA 2IJMA 2F7ZE 5IA0A 4HYIA 3ANQA 4GK3A 2B52A 3G90X 5EG3A 2PVKA 4FL3A 3UC4A 2UZNA 5EI2A 4EJ7A 4D0YA 1PKGA 3IO7A 3RALA 3R01A 3QA0A 1J7UA 3WYYA 3TT0A 2UW8A 3ZUUA 3VQUA 4FZDB 3EQGA 4H58A 4YGAA 2ITOA 3RCJA 3QF9A 1PXLA 4GYGA 3GNIB 3OWPA 5LQFA 4FVPA 2X4FA 4CTCA 4B8MA 3QYZA 3R22A 5H8EA 2OSCA 2XB7A 1XH6A 1ZOHA 3DDQA 3EQHA 4PTCA 4LM5A 1LPUA 4IB1A 3WOWA 4ASEA 2ITNA 5HLNA 2W4KA 3E7VA 4MWIA 3AMYA 3QD3A 4U6RA 3LPBA 4B7TA 4UXQA 2C1AA 4PMPA 2WMUA 5E91A 3RK9A 2R64A 5D1JA 4IB0A 4EH2A 4QMVA 3T9IA 3ZLYA 4UZDA 5JFXA 3LFQA 2CGUA 4RG0A 4WD5A 5CSXA 5DI1A 2B53A 2X9FA 4JXFA 4M84A 3LCOA 5IF1A 2FUMA 2VTOA 3U9CA 3N9XA 3CJGA 2GSFA 3SVVA 3PFQA 4L52A 4LL0A 3UDBA 4CG8A 5DHJA 5J1WA 3KULB 1FVVA 2OXYA 1DAYA 2BZHB 3QUPA 1H1QA 4AOTA 2ZM1A 2WOUA 4GKIA 2UUEA 4I6QA 2JDSA 4BCMA 4C4GA 2J0KA 5A14A 4RWIA 5HNBA 4HVDA 2ZAZA 4F0IA 4H3QA 1QCFA 1QPJA 2HELA 4FR4A 5IA3A 5T6KA 4OX3A 4FT7A 2WIHA 2O64A 2OO8X 4G3FA 4MD8E 5B2KA 4DEGA 3A8XA 3EOCA 3NIZA 5EYCA 4C58A 3TDWA 2QLUA 3FYKX 4DGNA 2FVDA 3A7HA 4Y5QA 4EOKA 3UO5A 4X3FC 4QP7A 1MRYA 5JQ8A 1JPAA 2C0IA 3QRKA 4HZRA 3D9VA 1JSUA 2GCDA 4G1WA 4L00A 4CFWA 3DXQA 3NUXA 4IX4A 4BCOA 4YBJA 4R7BA 5ANDA 1OIQA 3UNZA 3LCSA 4PP7A 3S1HA 5M07A 3OCSA 3R1YA 4BTJA 2LGCA 4C3PA 1U10A 2J0IA 3LFEA 4QNYA 5E8TA 2J0LA 2WMBA 3L9PA 3FQEA 1NW1A 3FL5A 3W0QA 5J5SA 4NM0A 2UW0A 2JDRA 4XG4A 4BCKA 4FTIA 4GV1A 2XRUA 2QODA 3VBXA 1OUYA 1H07A 3ULIA 2W4JA 3NAXA 2O3PA 4M97A 4FKPA 2F4JA 4BN1A 2WG4A 1PHKA 3JYAA 2J0MB 3NPCA 4QNAA 2A19B 2JIVA 3W0SA 1JAMA 3HV4A 3QL8A 2YA9A 3P78A 3LQ5A 4F9YA 4C33A 4PL3A 4C38A 2BRHA 3UJGA 4QP3A 3GOKA 3VUDA 2QR7A 3ZC5A 2PTKA 3HZTA 4WG3A 4YJVA 2G2HA 1U59A 3O7LB 3U4WA 4ANBA 1YHVA 3DV3A 4MKCA 4L53A 1WBTA 2R3IA 4X2FA 2QD9A 4ZTQA 4IX5A 4EOLA 2VTJA 4AFJA 4NM7A 5CSWA 3FMKA 5A46A 5KZIA 5EH0A 3COHA 3KULA 2C1BA 3SXSA 4RFYA 1XQZA 4EHEA 4I5PA 1W7HA 2G9XA 2R7IA 3PRFA 2P2HA 2Y4IC 3SAYA 3ZXZA 4TYEA 4FODA 4RJ5A 4F08A 3UODA 3FXXA 3F2NA 3R21A 5EM5A 1R78A 4MBIA 5CSHA 2ITPA 3KL8A 3VBQA 1J3HA 2G15A 4FTAA 3KKVA 2GS6A 3I1AA 3HDNA 2VTPA 4I22A 3VHEA 2IVVA 2VTNA 3LFBA 2I0EA 2W1ZA 3UMWA 4G6LA 4XOYA 2GQSA 1U4DA 2VX1A 4DEEA 1PKDA 4GG5A 3W32A 2RFDA 3LE6A 4KBCA 5B2MA 2RGPA 4BZNA 2R4BA 3O2MA 4IJ9A 4ZK5A 1IAJA 4QMYA 5K3YA 1OL5A 3D15A 4OTIA 3U6HA 3GCVA 4KUJA 1ZOEA 1B38A 3O8PA 4UY9A 1B39A 3BHYA 3T3VA 5CZIA 1BL7A 4GUBA 1Z57A 1H01A 3C5UA 4RA5A 3ELJA 3VQHA 3CR0A 3EQIA 4EUUA 5HU9A 2WTKC 4Z7GA 3U51A 3DBQA 3OROA 4QPSA 3CTHA 1K2PA 4NCTC 3G9LX 4O0TA 3QCQA 2UV2A 4ANMA 5HTCA 1YOMA 3VW6A 1I09A 2WU6A 3CGOA 3MJ1A 5HX8A 5AUTA 5CVGA 2HAKA 3R7VA 3QQHA 3KFAA 5FTGA 3FMDA 4HCTA 1Q24A 3BGPA 5AJQA 3U87A 3WF9A 5CF5A 3MVMA 3PZEA 2WXVA 2HY81 2HZIA 3PXKA 4ZP5A 4AA0A 5BMSA 2NPQA 2ZB0A 2JDTA 4YO6A 3D14A 4EQCA 4K11A 3VN9A 4DYMA 5IQDA 2CPKE 3G33A 1OL1A 5HD7A 1GZOA 3KIOC 5J7HA 3C0HA 2P55A 3D5VA 4O7RA 2P3GX 5HO8A 3V8TA 4AT5A 4EH5A 4Z16A 2RKUA 2OZOA 3GU6A 5G6VA 4KB8A 1O6KA 3P4KA 3MXWA 3MFUA 4FTOA 4RRVA 3QKMA 4PDYA 3RP9A 4MAOA 4DEAA 4JBPA 3C1XA 1GAGA 4L01A 1LUFA 3MSSA 2XNGA 3K3IA 3V3VA 2QOQA 2WMQA 2BRNA 4C4FA 3IOKA 5A4EA 4IVCA 3P7AA 4JAIA 2JC6A 2XM8A 3MIYA 4KINA 4LV8A 4QO9A 4YNEA 3BWFA 5EQEA 2XKDA 4A07A 3BELA 3L9NA 4I6LA 2PE2A 2WTCA 5AUUA 2JDOA 4D0WA 5J9LA 1YXVA 3MFSA 5L6OA 2BFYA 4FKJA 1QL6A 2DYLA 3NAYA 3RJCA 3AC2A 2BKZA 4JIAA 5AUYA 4F64A 1TQPA 4E4LA 5LMKA 1YI6A 3KXCA 4WRGA 5KE0A 2OWBA 5AX9A 4RX5A 4M67A 4R77A 4RZWA 3RK7A 4EKLA 4UBAA 3O50A 2VO0A 5CYIA 4OT5A 4DDGA 5IQFA 4FTCA 3SLSA 2ZFYA 2UW6A 1VR2A 1ZYLA 4H1MA 3CIKA 5KMKA 4BDGA 4EQUA 4DTAA 5HNIX 3BIZA 3K7HB 1V0PA 2VTTA 3SQQA 3F7WA 3UC3A 2YAKA 4DGOA 3PE2A 4BDCA 2H9VA 3DK3A 2XUUA 4X2JA 2XA4A 1H26A 4Q2AA 5LVNA 3UIBA 2H34A 3LMHA 2JITA 1ZWSA 3QXPA 3UDTA 5KMNA 4FBXA 4JL9A 3BGQA 3DK6A 2WMTA 4KIOA 4QP4A 2VZ6A 5KKRC 2OKRA 3A4PA 5CT7A 5AUXA 4DCEA 2OZAA 3K5UA 3ZSHA 3NCGA 3TN8A 3MY1A 3MWUA 4FKWA 3W0OA 2IG7A 2R3JA 4PTGA 4K8AA 3E8NA 3BI6A 2CGVA 4Q5EA 3D1MA 2JBPA 3CS9A 3K3JA 3VS0A 4AN3A 5CU6A 5CXHA 4GRBA 4IM2A 1J1CA 1XKKA 2BZJA 3NUAA 4YUQA 2QOFA 2XIRA 3LFFA 3IONA 4BDIA 3KMUA 3E5AA 5CAOA 4RVTA 1OPLA 2PVYA 2QKWB 2PY3A 4TNBA 3ULZA 2UW9A 4QP9A 2DUVA 4JI9A 3KC3A 4JNWA 4IANA 4USDA 4RC4A 5DNRA 5HKMA 4CRLA 4BDFA 4TY1A 4ZLYA 4JT3A 4O96A 2RL5A 4E7WA 4EC9A 1M52A 3BL9A 4XG7A 1IAHA 3P5JC 5JGBA 3NW7A 4WUNA 4QTBA 3MIAA 2FB8A 3MDYA 3HLLA 3C7QA 3L8VA 3QQUA 5ITAA 3BQCA 4F63A 4DCAA 5CENA 1PXJA 3TDVA 5JFWA 4YHFA 5HIDA 3TV7A 4TTHB 2ITVA 3LFSA 3RM6A 4RQVA 1RE8A 1XH4A 3FMEA 3OTVA 2VWBA 2PMLX 4EOJA 1WZYA 2XNMA 4FT0A 3WIKA 3MESA 4MXAA 4QRCA 4GIIA 2R3FA 3CY3A 2W1GA 1IA8A 4NK9A 1MRUA 4GVJA 4X21A 5FDXA 1PXNA 3U55A 4L3JA 4S30A 3HAMA 4RC3A 4EHZA 1H4LA 4BIDA 4HVGA 1SM2A 1DS5A 2PZ5A 4OAKA 5EHOA 4KS8A 4NM3A 4IM0A 4DEDA 3SV0A 3UIXA 5KUPA 5IEXA 5TKDA 4C3FA 3EYHA 1CKIA 5AADA 4AT3A 5A6NA 2QC6A 2J5FA 4N57A 3ZO3A 4X3JA 5BYYA 4JQ8A 5IG1A 2BDFA 2UZEA 3BL7A 4BF2A 2O63A 3QQJA 4MQ1A 4UALA 3FJQE 3Q5ZA 1U54B 4FKRA 2I0HA 2YDIA 3CTJA 4QP8A 4MXZA 3VUMA 3MH1A 1ATPE 4ZJIA 4MUSA 3EL7A 3E62A 2PVHA 4EBWA 1YI4A 3VJOA 4QMZA 5GJFA 4L46A 5DR2A 2CNUA 3ZC6A 4KKGA 3PA4A 2EWAA 3O7LD 4NT4A 3UOHA 4LYNA 3P08A 2YN8A 3OXIA 3U54A 3V04A 3DKFA 4EH3A 3D4QA 2B7AA 1ZARA 5DT3A 2IW9A 3R7IA 3BLAA 3UYSA 3CBLA 5DH3A 3QTIA 4FTUA 4EONA 3Q4TA 4GS6A 4HPUE 3G2FA 4RIYA 5IA5A 4QMPA 4FGBA 2VTRA 4B4LA 3SA0A 2J3RA 4BGHA 5HG8A 5LCKA 1JKSA 3EHAA 3TJDA 3WE4A 2V0DA 4I6BA 4XLVA 5AP4A 5EKNA 3ACKA 5CLPA 2HWOA 4XMOA 2R9SA 4GG7A 2R3OA 3DKGA 3EL8A 4I6FA 2BROA 4QMUA 3RMFA 1MUOA 1VEBA 5AIRA 4O0RA 4ZOGA 1KE8A 5EHYA 4U45A 2QOIA 3MPTA 3MB7A 1PRYA 4TWPA 4U81A 4WSYA 3W2PA 2B9HA 3A7FA 3AGMA 3EWHA 3REPA 2CSNA 3RAIA 3L8PA 4L42A 2PE0A 4GFGA 4LUDA 4L67A 5FP6A 2PK9A 5IH5A 4FSUA 5T3QA 3CKXA 3NYNA 3ET7A 5KZ0A 1W8CA 3GCQA 3S3IA 4C2WA 5JZJA 3BWJA 2BRMA 2NRUA 2C3LA 3IKAA 4FSQA 1VYZA 4FTMA 4K0YA 4KD1A 1Y57A 4FUYA 4I4FA 2JAVA 3F5PA 5DT4A 1HCKA 3GCPA 3QZHA 3PZHA 5HCXA 5LMBA 4CKRA 4CT1A 1JLUE 5AV2A 4WNPA 3FZRA 5D11A 5KCVA 2J3WB 1RW8A 3PJ2A 2GMXA 4CNHA 3JY0A 2ZMDA 5JGAA 2XK3A 3D94A 3FZTA 3O17A 1AQ1A 3R00A 4D0XA 3O8TA 5DEWA 4EK8A 4DITA 4PWNA 3N1GA 4NJDA 4AGWA 4RFZA 4JBQA 1XWSA 4MVFA 4HVSA 1Q8ZA 4USEA 4O0YA 4OT6A 4OLIA 2W1FA 2UZVA 1REJA 2GFSA 2XARA 1U54A 2BCJA 3Q4UA 1ZYCA 2PUNA 3AXWA 3I81A 3ZFYA 5KHXA 2WMXA 5BUIA 4YZCA 4PTEA 5M4IA 4TPTA 3R2YA 1WMKA 2QNJA 1R0PA 4GKHA 3CXWA 2JIUA 4YTFA 1BLXA 3M42A 4FZ6A 5AP2A 4QMNA 4CFVA 4Z55A 3KRXA 4EEVA 4QMLA 4DHFA 2VO3A 2YCQA 1LP4A 4CKJA 3I4BA 4IZ5A 1JKLA 4CFUA 4TT7A 5BV3A 4JIDA 4F9CA 3DNEA 2ERKA 2R7BA 3IW6A 3Q60A 3SC1A 4BBEA 2CFHC 3CGFA 5CSPA 3DBCA 3FLZA 5CEPA 3IW7A 3CCNA 5BVFA 2V62A 3PA3A 4FL2A 4FIGA 4IM3A 3S4QA 3R1SA 4O0VA 3TIZA 4JMQA 3OWLA 4OTRA 4MNEB 4BTMA 4I23A 3UQCA 2JKQA 5CTPA 3ATTA 4NKSA 3QUEA 3B2WA 4FVQA 3TNIA 4ENYA 1KE5A 3PVGA 4M12A 5DN3A 3QUDA 3EQBA 3ORIA 5BQ0A 4HYUA 4TZRA 3PSBA 2DQ7X 4RQKA 4XRJA 2YWPA 1Q97A 4CFNA 2JGZA 4FZFB 4IJPA 4YJRA 1HCLA 4YLLA 3ZM4A 4X2GA 4ZTMA 3QRJA 4AZSA 3O23A 3OD6X 5A3XA 3AC1A 2ZVAA 1ZZLA 3BEGA 1MP8A 2B54A 4P5QA 3EFJA 4QMWA 1MQBA 4E93A 4M69B 3BZ3A 4CCUA 3VAPA 5I9VA 4IAIA 4BRXA 2X9EA 2YIXA 3TNPC 4C0TA 4M13A 2C6LA 3I7CA 1H08A 3GENA 3NDMA 2XALA 5K9IA 1VZOA 4DEIA 2ONLA 3FMHA 2PHKA 4IZ7A 4FICA 3UVQA 4HGTA 3ZEWA 4Z7HA 4GIHA 5I9YA 3M2WA 4UZHA 1K9AA 1OKZA 2P4IA 3CP9A 3RI1A 5JT2A 3RKBA 4EYMA 4G5JA 4N6ZA 4U43A 3ZBXA 3FQSA 4IVBA 5AA8A 2GFCA 3O8UA 3SX9A 1KOBA 1ZXEA 4KRCA 4CV9A 4CLJA 2XRWA 4J96A 1CDKA 4RVKA 3UYTA 3D5UA 2XNEA 3ZSIA 1M2PA 4ZSLA 4B9DA 2GHGA 2OJ9A 3ZFMA 3MS9A 2PZPA 3BV3A 2H96A 4QEBA 1OGUA 2FA2A 2XIKA 2OK1A 3AKKA 3SRVB 4IAKA 2OSOA 4D4YA 3LZBA 4JAJA 4D9TA 1OUKA 3QCXA 4MD9E 5CU3A 4F6UA 4DH5A 3PLAE 3HEGA 4FT3A 4OGRA 2CKPA 4YP8A 5L2IA 2PMIA 2ITWA 2PVLA 1MQ4A 2YCSA 3HRCA 4E4NA 4O6EA 4K33A 5HGIA 3HRBA 4MEDA 5FQDC 3R28A 5AV0A 2IBGE 1A48A 4Y72A 4JRVA 5M51A 4NJ3A 3NW6A 4KS7A 4ITIA 2QR8A 2ITZA 3TTJA 5AP1A 4BCGA 1GIIA 2PUUA 1IRKA 2ETRA 3FAAA 2Z7LA 1FGIA 3PVBA 5FXRA 3MVHA 1XHAA 5HI2A 3EZRA 2HZ0A 3K2LA 3DKOA 3PUPA 3R83A 2WMRA 3I6UA 3WI6A 3UVPA 3DLZA 3WARA 4H39A 4C61A 1XH5A 4Y85A 2C0JB 2W96B 3KXMA 4GFOA 5HQ0A 4PP9A 1TVOA 4LUEA 2OW3A 2YM3A 3PWDA 4IQ6A 3BKBA 2A4LA 2BR1A 2VTIA 1YXTA 5EW8A 4A7CA 3TL8A 2VWYA 4BBMA 1ZY5A 2E9OA 5EYDA 5HU3A 4ZSEA 3FZ1A 1TQMA 3CEKA 2VWZA 4BGQA 2Z8CA 4Z3VA 3PRIA 2R5TA 4AE9A 3QKLA 2WNTA 2WGJA 4C37A 1REKA 1DI8A 2VO7A 4AACA 3NZ0A 2HYYA 2XH5A 3QC4A 4IW0A 4RJ7A 5AMNA 3ZLXA 4EC8A 3NSZA 1KE6A 5C1QB 4C3RA 5K5XA 2UZBA 4R3CA 2XZSA 4K9YA 2IZUA 5I9WA 3GQIA 3M11A 4QPAA 1G8AA 4PL5A 4A9TA 4LRKA 5LWNA 4EOIA 4YJOA 2ITXA 4QDVA 5HLWA 2AUHA 3HMNA 5GHVA 3FMNA 3N51A 4RBLA 5CF8A 3SRVA 2C4GA 4B8LA 3UQFA 5DOSA 3W55A 4Y83A 3QYWA 1YQJA 3FBVA 1PXOA 4J95A 4F4PA 3WF8A 4W4XA 3ZXTA 3ZSGA 4FEVA 5HG5A 3FXZA 4ITHA 4C34A 3NRMA 5FP5A 3NUPA 4FTJA 4W8DA 3CLYA 2GNHA 2Q0NA 4O27B 2IO6A 4P2KA 2PL0A 4L45A 2Q83A 4N4SA 4GUEA 5EOBA 5CASA 5BPYA 3FHIA 4AXCA 2XKEA 2W9FB 2C6TA 4AAYA 5C8KA 3VWAA 3QAME 4TRLA 3FZPA 3IDPA 3PDTA 1UWHA 3FPMA 3R71A 3R63A 4BTKA 5IUHA 3WZDA 3GQLA 1VLRA 4YTIA 2QHNA 3QRUA 4I6HA 3ZUTA 4EK3A 2OF2A 5AAGA 3OZ6A 4GT4A 3I7BA 3D2KA 2C0JA 1BYGA 3C50A 4K2RA 3LQ3A 3SG8A 1P4FA 3CQEA 3TXOA 5HESA 4CV8A 4HW7A 2X8IA 1CMKE 4G3EA 3F88A 2FSOX 4FNXA 4U8ZA 4U44A 4BCPA 3ZMMA 1J91A 2XF0A 4ZTRA 5K4JA 3FI3A 3PJ1A 4QMSA 3LJ0A 1T45A 2J4ZA 4ZLOA 2R0UA 3HUBA 4D4VA 5CAVA 2XAMA 3EN4A 3FLQA 4H3PA 3DB6A 5ANOA 5AAFA 4MYGA 4D55A 5A4CA 3N1QA 3OHTA 4JBVA 4O7YA 3R8LA 4WA9A 4CFMA 2G2FA 2W0JA 3ZU7A 3HP2A 4RX8A 5DRBA 4O7TA 4CD0A 1LEZA 4TWNA 3QHWA 4GK4A 3W2RA 1PMNA 2YJRA 4BDAA 5H3QA 3W10A 4YU2A 2J3WD 4NU1A 4FJVA 1I44A 5E8YA 4A4LA 4APCA 3F2RA 2QG7A 1L8TA 1OECA 2CLXA 3F5UA 3F3VA 3MH0A 2VWIA 3OEFX 3Q3BA 3PVUA 1IEPA 4XS2A 4D1SA 4X2KA 3IQ7A 4JS8A 4JG6A 2PMOX 4XLIA 2Z60A 3K54A 3DPKA 4EK6A 3VF8A 3OG7A 5B0XA 5C9CA 3TEIA 4J7BA 4UWBA 3QGYA 4FKLA 3WILA 2UVYA 3RPSA 1B6CB 4WBOA 4G16A 3MH3A 3N1MB 3Q53A 2ZV2A 4JQEA 4L3LA 2QU6A 4I41A 5HCZA 5HG7A 3ROCA 4BCHA 3W18A 4CMTA 3QX4A 4AZEA 4DFBA 4KIPA 4U3YA 2BFXA 4FA2A 2VGOA 3MPMA 4IZYA 3U8WA 4YZ9A 2WQMA 3FI4A 3RPOA 4AXEA 3AG9A 4IDVA 4ZY4A 4Y5HA 3RPYA 4AZWA 2WELA 4FOBA 5CU4A 3NYXA 2WAJA 3UO4A 4DHJA 4F09A 4C4JA 3R1NA 3BLQA 3DY7A 1M7NA 4ZS0A 3P1AA 2WFRA 1MRVA 3PJCA 3PY3A 3CUED 4E6QA 5L6PA 3PY0A 3NW5A 4NM5A 2BZKB 4NT9A 4AW2A 3COIA 1LBUA 4PRJA 4B99A 3FKNA 2IVTA 4FIEA 4AZVA 4DGMA 1WVXA 4KA3A 5CXZA 4JIKA 4W8EA 4TN6A 4ACMA 1XR1A 1W0XC 4ZJVA 4OUCA 2PWLA 3KGAA 4FKGA 5KMJA 3Q04A 5CF6A 4K6ZA 5CF4A 3N1RA 3K5VA 2WB8A 3LM0A 2C5YA 5IQIA 3OOGA 4N70A 3BYSA 4E26A 1Q41A 1Q62A 1SVEA 2GNFA 3ODZX 3OMVA 4IWDA 4WIHA 5DR6A 2C6KA 2R3MA 3RAWA 4BHZA 3K7JB 1YWRA 4FNYA 3BV2A 2XK6A 2F2CB 3SD0A 3FSFA 3PYYA 3R6XA 4H1JA 4CMUA 3AMAA 2UZLA 4HVIA 4EBVA 4YPDA 4FNWA 3PPJA 4JDJA 4PMTA 2C5XA 3FHRA 3QZFA 4WUAA 4YNOA 4DBNA 3CPCA 1M14A 1YDTE 1IG1A 4CT2A 3A8WA 1CKPA 4IBMA 3ID6C 4QYFA 5DE2A 3TV4A 4XRLA 4MNFA 1O9UA 2EB2A 4FV5A 3KVXA 4QYYA 3RHKA 3RTPA 2F9GA 4XG3A 3RWQA 2B0QA 1TZPA 2X7FA 2HZ4A 2QO9A 3IW8A 4IB3A 2B9IA 4CFFA 3QTZA 5K4IA 4LOPA 3GUBA 5CI7A 3KY2A 3TKUA 2R3GA 5LMAA 4O7WA 2X39A 3P9JA 4LV7A 5KMOA 4KBAA 3GXLA 1WVYA 3LFAA 4CGAA 5FDPA 3AOXA 2YM8A 3NX8A 4B6LA 3NVKI 3W2SA 2RFEA 4BIBA 5M53A 3VVHA 3WZKA 1GIHA 1Q3DA 4C2VA 2XP2A 5I4NA 5KHWA 2VWWA 1V1KA 4ZZMA 3V5LA 5EQPA 3BE9A 3QQGA 1WBOA 4FTRA 2YM6A 4J52A 4L3PA 2X8EA 4R5SA 5M55A 4C4HA 4YJUA 3WF6A 1KSWA 1KV1A 4MQ2A 4QTAA 4AQCA 4DFUA 5BVNA 1OBGA 4G9CA 5E8WA 3OEZA 5IUIA 4C4NA 1F0QA 2FSMX 5EI8A 3V01A 2CCIA 3LFDA 3QLGA 4QP2A 3JUHA 3EQRA 4MD7E 2SRCA 3UOKA 4U3ZA 3VF9A 4O7NA 3PSDA 4WNKA 4AXFA 3DLSA 3Q4CA 4OXDA 3TZ9A 2EXCX 1BL6A 3QX2A 3KXZA 3E87A 3L1SA 3PPKA 5LARA 4EH6A 2OH4A 2VTAA 3H4JA 3NR9A 4DFLA 3W1FA 1XH9A 2NP8A 1WC9A 3RVGA 2OFVA 4PDOA 4BB4A 4ID7A 5DT0A 3ZRLA 2NO3A 1A9UA 2OG8A 4NFNA 4DT9A 1QPEA 4RWLA 2I0YA 4TWOA 3BLRA 2IZRA 3F2AA 3LFNA 5JN2A 4K18A 5CEOA 2OZAB 4EK5A 3ZO2A 5L2TA 3DQXA 3DZQA 3ZO1A 3W2QA 3GU8A 3W0PA 5FM2A 3C4CA 4RMZA 4IC8A 2WQNA 4NTSA 2C6EA 3DCVA 4DFXE 2VU3A 4BCIA 2J2IB 5HCYA 1YHWA 3PY1A 4EOOA 2UZOA 2F7XE 3UG1A 5HVJA 5IH6A 4BJJB 3LFCA 3GEQA 4CKIA 2DS1A 4MUTA 4OTHA 4O86A 2PSQA 4CLIA 4DLJA 5C26A 2R2PA 3AD6A 2OXDA 2C3KA 2EU9A 4NTTA 5IUGA 3WZUA 4PQNA 3AT4A 3OW3A 2XCKA 3DK7A 3ML1A 4S2ZA 1Q61A 3R8MA 1XH8A 2JFLA 3N1PB 4YJTA 1E9HA 1UA2A 4LV5A 3AT3A 3Q52A 1WAKA 5L8JA 3A7IA 3E88A 4U7ZA 4DHIB 1RDQE 2R3LA 3MV5A 3KXCC 4ZIMA 4BZOA 5LMKC 3LMGA 5ACKA 1P2AA 3LLTA 5M56A 3Q6UA 5HVYA 2VGPA 2YM7A 4FL1A 3P7CA 3R2BA 5E1SA 3VBYA 4AUAA 4EH9A 2X4ZA 3EN9A 1OIUA 3OY1A 1BMKA 2Z02A 5C4LA 3PJ8A 3ZO4A 1PW2A 1STCE 3IDCA 2VO9A 2PE1A 1M7QA 4P7EA 2J90A 4EH7A 5HNGA 4FKSA 3U6JA 4QOXA 3SKCA 3GGFA 3VRZA 3WZJA 2ESMA 3RZBA 4X2NA 1DM2A 2WO6A 1OIRA 3KA0A 2HIWA 5CNNA 5DFPA 1KE9A 3Q2JA 1UU8A 3A7JA 3NNWA 4EH4A 5HIEA 5FUTA 4DH8A 5CVFA 3C4ZA 3R7UA 2PZYA 3UDZA 1OITA 4CZTA 3UBDA 2UZWE 3KK9A 4DBXA 5BX0A 2XK7A 1FQ1B 3MFTA 1GZNA 3NYVA 2YISA 2ZV9A 4BCNA 4EK4A 4DEHA 3RPRA 5AP0A 2ZV7A 2O5KA 1Y6AA 2HY0A 3FC1X 4IFCA 3V5PA 4USFA 4M8TA 3N4UA 1G3NA 1JQHA 3CC6A 3DAKA 3AD5A 2A1AB 5I9XA 2I6LA 2BUJA 2EXMA 3FKOA 4O38A 4RT7A 5FEDA 3ETAA 4JG8A 5F95A 4ZMEA 1BI7A 1FGKA 2QHMA 4A9RA 4QMMA 1UKIA 5IQAA 1ST4A 2ITQA 3FLNC 1Q99A 3S0OA 4G3DA 4FV0A 4ACDA 4BJJA 4PX6A 2YIYA 2QI8A 4KKHA 1PXKA 1S9IA 3R9NA 1WCCA 4FV1A 5AP7A 4EOMA 1UNLA 4UWYA 3WZEA 2BIYA 3I5ZA 3DQWA 4U5JA 4AOIA 4PMMA 4CEGA 3HV3A 5CALA 5E90A 2XJ2A 4RIYB 1DI9A 4RSSA 2YIWA 2J3RB 3W2OA 2X81A 5AFVA 3ZZWA 1JSTA 2Y6OA 1K3AA 1GOLA 3KRWA 2C47A 5CQUA 4YSMA 4AGCA 2W7XA 1IR3A 2OJIA 5FTOA 4AZFA 4EQMA 2UZUE 1FVRA 5CU2A 5IH4A 2BHHA 1OL2A 3ZZEA 5DVRA 4FSRA 3P79A 1XBAA 3ATSA 4J8NA 3LQ8A 2E9UA 1CTPE 2ZDUA 2R3HA 3MY0A 5ANGA 1OL6A 4D2SA 3GU4A 4QTCA 5AUZA 2AC3A 3DU8A 5I0BA 3W16A 3SW4A 4I3ZA 5DR9A 1FINA 4ACGA 4BDJA 2GHLA 4PMSA 4AU8A 2YZAA 4EORA 5LWMA 2AC5A 3OXZA 4FYNA 3BRBA 4E5AX 3HV7A 5BYLA 3RPVA 4GU9A 2OU7A 3MW1A 4MCVA 4QQJA 4RGJA 2ZV8A 4FOCA 5JK3A 5M4UA 1LR4A 4FSWA 2RG6A 4I5MA 4L43A 4LRJA 5FEQA 4O0XA 4UN0C 4UV0A 3W0RA 4LOOA 4JG7A 2BILB 5FM3A 4MTAA 2XKCA 3GB2A 3BHHA 3KXXA 2BHEA 4G9RA 3VS4A 3QBNA 4IADA 3PUFC 2YAAA 3MVLA 4YTCA 4NYEA 4J8MA 3OWKA 5EM6A 5CSVA 3E92A 3FC2A 4F78A 4A4XA 4CCBA 4FG8A 3U4UA 3E8DA 1QMZA 2GNLA 3GVUA 3Q9WA 4E6AA 5IPJA 4MXYA 5L8KA 2B9JA 3U6IA 4O2PA 4OTFA 3LJ2A 1YWVA 4IWOA 5AUWA 4ZZNA 5K5NA 4FTLA 4PY1A 4AWIA 2GNJA 4DG2E 5AV3A 5IQGA 3ZM9A 2PWNA 1V0BA 4C4MA 3PTGA 4G3GA 4L68A 3CE3A 1PXPA 4LGGA 3TKIA 3NUUA 5BMMA 4AFEA 3D83A 3QTSA 1YOLA 1WC8A 3NGAA 4U40A 3KXHA 4I0TA 4S34A 3TKHA 2CKQA 4D28A 3QRIA 2BMCA 2XYNA 3ZYAA 3P7BA 4FX3A 4OTGA 3ROYA 2XCHA 2WPAA 4UWCA 5ANJA 3V8WA 4QMOA 3WF5A 4I0RA 2HXLA 2Y4PA 5GIPE 2A27A 4H3BA 3VUGA 2X2MA 4F1MA 4A9SA
chains in the Genus database with same CATH topology
4M3QA 4FEUA 3F69A 2W17A 3DB8A 2Y8OA 2QONA 3GC0A 2V7OA 2ITYA 2PULA 4FV2A 3NUYA 3O71A 4MHAA 3BU3A 4KSPA 1AD5A 1M2QA 4ERKA 5E8SA 5EM7A 3THBA 2PVJA 2VNWA 4O7VA 3TCPA 3LXNA 5HD4A 3IG7A 2XNNA 4YPSA 5ANEA 5AUVA 1GY3A 1Q5KA 2JD5A 2XKFA 4XYFA 3UOLA 4KBKA 5H8GA 2W1HA 3QU0A 1YOJA 3ANRA 2HW7A 3BYVA 3EFLA 4MX9A 4TW9A 4YBKA 2WMVA 3LXPA 3OP5A 5HE3A 4FIIA 5E8ZA 4AA5A 2C6MA 5HBEA 4CFXA 4RIWA 5CU0A 1OKYA 5HVKA 2ZMCA 3EFWA 3AQVA 1M2RA 3MA3A 3CPBA 4FEQA 5HZNA 3LLAA 1NT2A 4C35A 2WFQA 4I24A 3VUIA 3DAEA 4PNIA 5AA9A 4ZJJA 4DGLC 4NZWB 2CMWA 5F4NA 1E1VA 3TNHA 4F9WA 2PZIA 2WFXA 4GSBA 1Q8TA 2J7TA 3BHVA 3FKLA 1UV5A 2IW8A 3V6SA 4AGDA 4AZTA 1YXSA 4ONAA 2BPMA 4ARKA 5JGDA 1NVSA 2W1IA 3UP7A 2C68A 4E4XA 4S32A 3GC7A 2O0UA 3BBTB 1CM8A 2IWIA 2PUIA 3JY9A 3D0EA 1R3CA 2RIOA 4KWPA 4E20A 5M57A 3GFEA 4L7SA 3C0IA 3WF7A 4OTWA 5CEKA 2GS7A 3UZPA 1FMOE 1OPKA 2FO0A 4A9UA 4DFNA 2XK9A 1V0OA 3QQFA 2BAKA 3QCSA 4RX9A 2QLQA 4R1VA 3IDBA 1FPUA 4RVLA 3IECA 3I5NA 3QD0A 1UNHA 4BCFA 2Q0BA 3T8OA 4QP1A 2UW5A 1BKXA 2X8DA 5T68A 1AGWA 2O8YA 3M1NA 4X6RA 3QC9A 1BI8A 3NFFB 4ZXTA 4F0FA 5HO7A 4CSVA 3NNUA 1FVTA 3LJ1A 4I5CA 2RF9A 2WEIA 3ORMA 5AP5A 2QOOA 2X0GA 2F2UA 3MB6A 4FKOA 5D10A 3W2CA 4E4MA 2PVFA 3EKNA 1JWHA 3HO5H 4OR5A 4AA4A 2UZDA 4HPTE 2C5OA 1NXKA 2C30A 2QOHA 3D7TB 3DXPA 4FV3A 4IWQA 4E73A 4FEXA 1CSNA 4IFGA 3OT8A 3A4OX 4BDEA 5BUJA 2HCKA 3QLFA 5JRSA 5TO8A 3LXLA 3Q4ZA 3H10A 1M17A 4WG4A 5EW9A 1IA9A 3R30A 3GU7A 3KRLA 4IAAA 4EOQA 2BRGA 2J0JA 4PL4A 4XNEA 2BRBA 3MYGA 3ZLSA 4RWKA 3ZRKA 3AT2A 2BTRA 1FBNA 1WBWA 1Z5MA 3DKCA 3DT1A 3D2IA 3MFRA 4O6LA 4DE4A 2PZRA 4MXXA 4OBPA 4L9IA 4WHZA 4IB5A 2VWUA 3G51A 2ONLC 2GQRA 5JKGA 4GJ2A 3OBGA 3MGYA 3QA8A 4NW5A 1KUTA 4AW1A 4V05A 2V7AA 3HL7A 4ZMFA 1H1RA 4OTDA 3VS1A 1OB3A 3COMA 3ZDIA 4BCQA 5BUEA 5CEIA 3BBWA 5C8NA 4O7SA 3HV5A 3H0ZA 3HP5A 3KXGA 4GFMA 4NKAA 4YJPA 3WIGA 2QURA 4RLLA 1UWJA 5J9YA 5C01A 4EUTA 3R04A 4BGGA 4O22A 4LOQA 4AP7A 1H27A 2JFMA 4G6NA 2CHLA 2IPXA 4BCJA 4R7HA 2J9MA 5J87A 3UO6A 1W84A 4EL9A 5E1EA 5ETCA 3POZA 5F94A 5CANA 2YDKA 3COKA 4RJ6A 3TNQB 5IISA 4LMUA 1PXIA 3DJ7A 3QZGA 1KOAA 3PG3A 2OF4A 3ODYX 4FK3A 5CWZA 4BI2A 4DEBA 4MURA 3PE1A 3KRRA 4QT1A 4R1YA 4HYHA 4V0GB 3QTXA 1DAWA 2WQOA 2CJMA 3DTWA 4E5BA 2ZB1A 2X1NA 3K7GB 3FXWA 4I5HA 1G8SA 3Q5IA 4FSNA 3TACA 3KEXA 3GOPA 2YIQA 3QTUA 4EHGA 5D9HA 3PXYA 3D7TA 1OMWA 3BHTA 3OWJA 5TT7A 1XBBA 5DWRA 2KULA 2OIBA 2C0OA 3E7OA 5BVDA 3R1QA 3LW0A 3KVWA 4ITJA 3I0QA 1F5QA 1ZLTA 2CGXA 5TR6A 2R3QA 1WVWA 4K77A 4ZY5A 3C5IA 3EB0A 4J53A 2BDWA 3TUDA 4F9AA 3ZLWA 3G6GA 3ZFXA 2WMWA 3PJ3A 3C4WA 3RAKA 4H36A 4IHPA 5FD2A 4I4EA 3JPVA 4BZDA 4QTDA 5H2UA 3PG1A 4BDBA 3H3CA 3MY5A 4FG7A 2QKRA 2OJJA 4AGUA 4FTQA 4Z9LA 4F7NA 2YM5A 4YZBA 4DH7A 1OGYA 2B1PA 3F82A 3JVSA 4GMYA 2PMNX 4TYGA 4BY9E 1RJBA 4PV0A 4F99A 3HUCA 3HMMA 3ERKA 3PXFA 4Q9ZA 2O65A 4TYJA 5LVPA 2A0CX 3OVVA 4FTNA 4BYJA 2QVSE 5AIKA 2UW3A 4FG9A 2I0VA 1XJDA 3BPRA 2EB3A 3FY2A 4RJ8A 5EKOA 3V6RA 4BDDA 2OIQA 4FVRA 5FTQA 4GJ3A 4DDIA 4EWQA 3QCYA 3DGKA 3OF0A 4RA4A 4QQTA 1WBPA 3NEWA 4XV9A 3HV6A 3RCDA 3NCZA 2UZTA 3JR1A 3UG2A 3VHKA 4XV3A 3VS2A 2ZOQA 4DH3A 2Y7JA 4C36A 4V01A 3V51A 3NS9A 4V0GA 4CRSA 2ACXA 4Q5HA 4DLIA 3Q96A 1PY5A 2ITTA 1KE7A 5CAQA 4NH1A 3IS5A 3AC4A 3NLBA 1YI3A 4L8MA 5EOLA 3UDSA 3OUNB 4FV4A 2F49A 3EYGA 4FKUA 4CZUA 4EZ7A 3HMPA 4ACHA 3ENHA 4U9AA 4CVAA 3GCUA 3RNYA 4DFZE 1W83A 4FZAB 5DBXA 3EKKA 4XJ0A 2W05A 2XIYA 2CKEA 4G5PA 4HYSA 4U97A 2W9ZB 4TKSA 2WEVA 2X7GA 4R3RA 3U9NA 3NMUF 3N1FA 2IZTA 3C4EA 3UP2A 1ERKA 4DT8A 4QMQA 4HGEA 2XNPA 4LI5A 4RJ3A 3TM0A 5JFVA 3ZS5A 4XP2A 2YACA 4YHJA 4OBQA 4WO5A 5AM6A 4D4RA 1PMEA 5IQHA 2XMYA 4YJSA 3PVWA 1HOWA 1H1SA 4N0SA 4X3FB 4XBRA 2OXXA 2VRXA 2ZM4A 1ZMWA 2YZLA 2VO6A 3DBEA 3LAUA 5E92A 1IASA 5H9BA 4BBFA 3V5QA 4MF1A 3ZOSA 2ZDTA 2HXQA 5BVWA 4HNIA 4DHZA 5IMEA 3W33A 1W98A 2E9PA 1NY3A 4FV8A 1H0VA 2VAGA 4IH8A 3BYOA 3DBDA 1NVRA 3HNGA 2VTHA 5CAUA 3FV8A 1ZOGA 1YWNA 3KMMA 1UVRA 4IACA 3VULA 5DRDA 2BKKA 3VUHA 5HBHA 1U46A 3ZH8A 4C4EA 3S00A 2GQGA 1SVHA 4AE6A 5AWMA 3W0MA 4YC6A 5M09A 2WQBA 5EI6A 1JOWB 4GU6A 5LOHA 1QPDA 2OLCA 3S95A 1PJKA 3PXZA 2BZIB 2YITA 4XHKB 3MJ2A 5L2WA 3OTUA 4AN9A 2Z7SA 4XBUA 3DTCA 4W4WA 2ITUA 4R7IA 1Y8GA 4PDPA 3V5TA 3VS5A 3DDPA 4ACCA 1JKKA 5HTBA 2XS0A 2OBJA 3LIJA 2ZJWA 5HHWA 3C9WA 1OIYA 5TOZA 2FH9A 5CEQA 4IE9A 3SHEA 1O6YA 2B55A 2JAMA 3AD4A 4FTKA 4DG3E 3F6XA 5FLFA 3ZRMA 3GU5A 4OX5A 5GINE 2OJGA 4ASXA 2Y4IB 2ZYBA 2YWVA 3D5WA 4JR3A 3IOPA 4O84A 4U42A 4ANSA 4ORKA 4ASZA 4IMYA 3EIDA 4B0GA 2W4OA 4JR7A 1OKVA 5FEEA 4CTBA 1YVJA 1FOTA 2YDJA 5I9ZA 2QOKA 2C6IA 4F7LA 3QQKA 4MXOA 3VNTA 1P4OA 3BGZA 3E64A 5CI6A 2WTVA 4DINA 5A9UA 2KTYA 3SGCA 1R39A 5GNKA 4A9YA 5CT0A 3ALOA 5HBJA 4E1ZA 5CAPA 2IZSA 1OKWA 2VTSA 3R8PA 1UU9A 5FGKA 3F3TA 3G5DA 4X3FA 4I92A 2Y0AA 3EQFA 3VBVA 4AX8A 4BKJA 2I1MA 4D5HA 4ANQA 3KN5A 4MPHA 1GZ8A 2PVRA 3RM7A 3E3BX 3EJ1A 4DC2A 4TXCA 3AMBA 4IAFA 3LXKA 4V04A 1OI9A 2WTKB 3A60A 4LRMA 3LCKA 5JEBA 4EWHA 4RZVA 4UEUA 1H00A 4JVGA 4KSQA 3LCDA 5H8BA 1RQQA 1H24A 3JVRA 3CY2A 4P4CA 3UNKA 4GH2A 2O2UA 3RHXA 4HOKA 4ENXA 3RWPA 4ZTSA 3ORZA 3Q6WA 2QU5A 4FSZA 1APME 1ZY4A 4IX6A 5CS6A 4QYGA 5B7VA 4BR3A 3DJ5A 5F1ZA 2C6OA 3E8CA 2OGVA 2P33A 5LVOA 1JVPP 1R1WA 2JKOA 4FYOA 4IWPA 3EQPA 5F20A 5BNJA 4F7SA 1UU3A 3O51A 4XP3A 3C51A 3A62A 3CSVA 4I0SA 5FBOA 4CMOA 3OW4A 3PIYA 4P90A 5HNMA 3NNXA 3IW4A 1Q8WA 3H0YA 4FKIA 5HLPA 1S9JA 3OC1A 2NYAA 3R9OA 3QD4A 2OH0E 3R8VA 4EOPA 5JFSA 4RJ4A 3OY3A 2VTMA 3FZSA 4FSTA 2PVNA 5A4LA 2X2LA 3R9RA 4G6OA 2AEGA 3R7EA 3HA6A 4IZAA 3HMIA 3BYMA 3O0GA 4C59A 3RK5A 3TV6A 4EZ3A 3GC8A 1WBNA 3II5A 3OXTA 5AM7A 4AN2A 1Y91A 1E1XA 4FKQA 3SXRA 3AC8A 4O81A 5JZNA 4F9BA 5IQEA 2FSLX 4J1RA 1Q8UA 4J71A 3DFAA 5JQ5A 4G17A 2VD5A 4YC8A 4BTFA 4FTTA 4D9UA 3T3UA 5EDRA 2YHVA 3G0EA 3WBLA 5J1VA 4P5ZA 4LQMA 2QQ7A 5ICPA 2GDOA 5EYMA 2QO2A 4XV2A 4IIRA 2QOLA 4R5YA 3BCEA 2E2BA 5J9ZA 1JBPE 4FNZA 2XJ0A 3GT8A 2RFNA 3DFCB 2W5HA 3W0NA 4AXAA 3EMGA 4ASDA 5JRQA 4BHNA 2WFYA 2WU7A 3LKMA 3R8UA 5IDNA 3FZOA 3KF4A 4G34A 2F7EE 2W5AA 5DGZA 5BVOA 3C0GA 1R44A 5CNOA 4BIEA 3NNVA 1PMUA 1UNGA 2CNVA 2EUFB 4NCTA 3TNWA 4NW6A 4MH7A 4FKTA 3HMOA 4C62A 3RGFA 3POOA 4R6VA 4KIQA 4HZSA 5M08A 1Y6BA 2JLDA 3Q9ZA 2BVAA 4O0UA 4BI0A 3BU6A 4FV6A 2WTIA 3GCSA 5IEYA 5HE0A 4DAWA 3QWJA 4IEBA 4WRSA 1XO2B 3R7OA 4AF3A 4EYJA 4JDHA 1YKRA 4M68A 3BX5A 4BC6A 4C02A 3UQGA 5DEYA 4AXDA 4TL0A 1Q3WA 4NUSA 1OZ1A 3UOJA 2BDJA 2HOGA 1XMLA 5KKRB 2C69A 4YURA 2X2KA 3F3ZA 4G3CA 2PVMA 4JX3A 5F9EA 4D5KA 2QO7A 5IZFA 4NIFB 1Q8YA 2YJSA 2PPQA 3E8EA 3MPAA 3QTWA 3CQWA 5A4QA 5AV1A 3ORLA 3MI9A 3KF7A 4IX3A 1H1PA 2J5EA 3HVCA 2Y6MA 2WOTA 2XIZA 2PU8A 4BVUA 3LM5A 3G9NA 4FGRA 1A06A 4I20A 3F5XA 3IGOA 2X6DA 1WFCA 2HW6A 3F61A 3GFWA 5JH6A 3A2CA 4RVMA 3SOCA 1G5SA 3KMWA 4KKEA 4ZTNA 2VWVA 4FV9A 4ZS4A 1GZKA 1TKIA 3FUPA 1GIJA 3KN6A 3NIEA 3B8RA 3FPQA 1UKHA 1J7IA 3I6WA 4OW8A 3FWQA 5GIOE 2W99B 2VTLA 5AV4A 3TUBA 3QRTA 4R3PA 4LFIA 5TF9A 1PXMA 4J97A 4FMQA 4EOSA 3R02A 3N1OA 3C4FA 2RG5A 5EK7A 3UPZA 4RIOA 1VYWA 2G01A 3WYXA 2WTJA 3UVRA 1R0EA 5EDQA 3KXNA 3V8SA 3FLSA 5IU2A 4D1XA 1ZAOA 2C3JA 3EN5A 3P23A 5BVEA 5HE2A 5E7RA 3N4TA 5D12A 4F0GA 1ZMVA 2V5QA 5D7AA 3T9TA 3BQRA 2BAQA 2R3PA 1ZZ2A 3UE4A 1U5QA 4DTBA 1ZYSA 4N6YA 3BYUA 3FYJX 4U79A 4S33A 5C03A 2CCHA 5IDPA 2H6DA 3SDJA 1SMHA 5D7VA 1SZMA 3MTFA 3FQHA 3MVJA 1H28A 3R8ZA 1T46A 3H9OA 3SG9A 3UIUA 1QPCA 2W5BA 3QGWA 3GP0A 2XEZA 4JOAA 4JDIA 1G8JA 4L7FA 4LL5A 2CGWA 4FEWA 4O7LA 5AEPA 3AGLA 4XG8A 5GJGA 4GEOA 2X6EA 4KNBA 4LMNA 1PYEA 4DGGA 3LVPA 3UNJA 3FEGA 3QHRA 4WG5A 2GNGA 4I93A 4DTKA 2P2IA 5ANIA 1OVEA 4JLCA 4MK0A 2YCFA 3ZBFA 4FIJA 3FL4A 3Q9XA 2HZNA 1SNXA 4YSJA 2UW7A 3EH9A 5IA1A 5IQBA 3TZMA 4JJRA 4RIXB 3F66A 3OT3A 4APPA 4DH1A 4AW5A 3C4XA 5FRIA 4D1ZA 2RFSA 3E3PA 3FMMA 4ALUA 3I79A 1OPJA 2ZM3A 4J98A 4YLJA 5CX9A 2EVAA 4IDTA 2XANA 3KQ7A 3N4VA 5HE1A 3VONA 3A7GA 3FLWA 5E8XA 4ZTLA 4RFMA 2C3IB 3ORTA 5CZHA 3W8LA 2XJ1A 4YZMA 1P14A 2HWPA 4I94A 4ZEGA 2JKKA 2F57A 3CD8A 2CNQA 2Z2WA 2WTWA 4FUXA 1XMMA 1Y8YA 4ZTHA 4RIWB 3NYOA 1XH7A 2I40A 3QD2B 3TMOA 3JS2A 3CKWA 4F1OA 4MBJA 5HIBA 3DZOA 3SW7A 4ZSJA 4GK2A 3E93A 4YJQA 3ENMA 3WE8A 4WT6A 3V5WA 5A6OA 4WNMA 2W06A 5HORA 2QOBA 3QTQA 3I60A 1SNUA 2OIDA 3QKKA 5EYKA 2XK8A 1ZRZA 3CD3A 2XNOA 3CQUA 5ACBC 5AAEA 5B2LA 2R0IA 3AC3A 4W4VA 2JKMA 5LXMA 5ANKA 3F5GA 4GW8A 3B2TA 3E63A 4XV1A 5IA2A 2R3KA 3F3WA 2QOCA 3ORNA 3P86A 3QXOA 2GTMA 4DA5A 3ZTXA 3DNDA 5CVHA 2DWBA 2YM4A 1KWPA 3OCTA 4AT4A 1P5EA 1YHSA 2XK4A 3HECA 3KREA 1OL7A 5G1XA 3NUSA 4D2RA 4S31A 2IVSA 4ZY6A 3R73A 4O83A 4BICA 4F6SA 3QALE 3OCGA 3ZHPC 4QP6A 4EJNA 2FSTX 1ND4A 3ZDUA 3PPZA 3F7ZA 3LCTA 3FE3A 4HNFA 2VV9A 4I21A 4II5A 4UB7A 3D7ZA 3OOMA 3PXRA 4L6QA 4IC7A 4O0WA 4TWCA 3SOAA 2J6MA 4Q9SA 5CY3A 3VJNA 4ZZOA 2J50A 4ALWA 2VTQA 3BE2A 4F6WA 3UMXA 4PDSA 4YMJA 4YO4A 2C5VA 3RAHA 2VX0A 4TYIA 4F1TA 4BDKA 5LVMA 2A2AA 4JQ7A 3OFMA 4WBBB 2WIPA 3EN7A 4FIHA 4QQ5A 2WZJA 1YDRE 3H9RA 3IPHA 3PWYA 4K1BA 4U41A 5J8IA 3EFKA 2R3NA 4RIXA 4E8AA 2B4SB 2PYWA 5KX8A 2GTNA 1BX6A 4OTQA 2XVDA 4RX7A 3RINA 1EH4A 2R3RA 5EQYA 4AQKA 2C6DA 4G31A 4KABA 4E5WA 5HX6A 5IEVA 4IVAA 3GI3A 3W8QA 3PFYA 3CJFA 5J95A 3V5JA 3DA6A 4O82A 3L9LA 4EH8A 4OBOA 3F3UA 4YJNA 3P0MA 3TWJA 3H30A 5IA4A 2UW4A 3FY0A 3DS6A 1WBVA 2QG5A 3KU2A 4YLKA 5LCJA 4CG9A 4QQCA 4EHVA 4EI4A 2YERA 5DA3A 3TG1A 3AKJA 4ERWA 2ETMA 4HGSA 5KO1A 2Z7QA 2C5NA 2X7OA 2JEDA 3BLHA 4NFMA 3JXWA 2NRYA 4QMXA 4XX9A 1CKJA 4YC3A 2VWXA 3UZTA 2XNBA 5FBNC 4AW0A 1H0WA 5GJDA 2OICA 4F7JA 1YW2A 3QZIA 4ANLA 3R9DA 3NUNA 2XBJA 4O7ZA 2BTSA 2J51A 5JMSA 1NVQA 2UVZA 1VHHA 2BAJA 4ZSGA 4XOZA 5FG8A 4RPVA 3VS6A 2VN9A 1W82A 3ZUVA 2VUWA 1G8KA 1YXXA 3HGKA 5IQCA 3VBTA 4CQEA 3VS3A 2E9VA 3PLSA 3DXNA 4YZDA 3TZ7A 4C4IA 4YTHA 5L3AA 2XIXA 1PYXA 2AYPA 4KRDA 3VIDA 5A4TA 5AP3A 5DPVA 3HA8A 4ZSAA 2WHBA 5M4FA 3PA5A 3BEAA 4HCUA 3HDMA 5BVKA 1H8FA 1OM1A 3ALNA 5IMXA 1JSVA 4QYEA 3KRJA 1YDSE 3UZRA 4AAAA 3MTLA 2CLQA 3KB7A 4TYHB 3FI8A 2YCRA 3FDNA 5AX3A 2ETKA 2REIA 3CTQA 3TJCA 4E6CA 3UGCA 5M44A 1Q4LA 2BALA 2WQEA 2Z7RA 3HKOA 3LOKA 4JX7A 2WG3A 3DBFA 3NVMB 4FSMA 3G6HA 4FI1A 4FZ7A 3EZVA 3VO3A 4M7IA 1GJOA 4AS0A 5EW3A 2W1EA 4AG8A 3I0OA 4NL0A 1H1WA 1LEWA 2I7QA 4M15A 4E6DA 2YABA 4TNDA 2C0TA 3FMJA 3UPXA 2GS2A 3ACJA 1URWA 4Y95A 4I1ZA 4EZ5A 3O5AA 4IAYA 5AP6A 4FV7A 5KNJA 2CN5A 3BU5A 1TQIA 3DJ6A 4UX9A 2IVUA 1Z9XA 5KBRA 1KV2A 3DOGA 3EN6A 4LDTA 3R0TA 1TFFA 3Q9YA 3VBWA 1GNGA 3VW8A 4X0MA 2WMAA 4AOJA 5HG9A 4X7QA 3TZ8A 2OFUA 1XBCA 3PIZA 3VUKA 4HCVA 4FSYA 4O91A 4W4YA 4WKQA 2ERZE 4NWMA 4RLKA 4EKKA 2W1CA 1VJYA 5LJJA 4IAZA 2UVXA 3HYHA 3HX4A 5EM8A 5L8LA 4LG4A 1ZMUA 4FKVA 1X8BA 3ITZA 4JDKA 5ETFA 5ETIA 5KBQA 2XM9A 4KAOA 4RC2A 2GU8A 4F70A 4G2FA 5LVLA 2V55A 3PP1A 4QYHA 4D4SA 4MUQA 3L8XA 1BUHA 3IK3A 4DFYA 5KMMA 3TUCA 5C27A 3LHJA 5KMIA 2GPHA 2CN8A 4XP0A 3DAJA 5I9UA 4XG6A 3EQDA 4D58A 2G1TA 3R9HA 4XH6A 4JBOA 4Y73A 2JBOA 2QCSA 2PUPA 4FE2A 1U5RA 2HK5A 5C8MA 3UTOA 5M06A 1FMKA 3MBLA 4R78A 1OBDA 4L44A 5C4KA 5HICA 3AKLA 1L3RE 3HAVA 3TYKA 3ZCLA 2YFXA 2IN6A 3GBZA 1PF8A 2NNWB 1UU7A 3PIXA 3L9MA 3A99A 4TYHA 4GL9A 4M0YA 4UYAA 4U0IA 5A54A 2Y9QA 5CEMA 4ZLZA 2CKOA 1F3MC 3KK8A 4FT5A 4Y8DA 3F9NA 3G15A 3VRYA 4RWJA 3OS3A 3VS7A 4YZNA 2WD1A 3AC5A 2BIKB 3P5KA 3HRFA 3ORXA 4IVDA 1ZYDA 1JNKA 2GHMA 3EQCA 4JRNA 4GT3A 4UYNA 4QMTA 2IW6A 4C7TA 1YRPA 5D41A 5L2SA 5DIAA 3PXQA 4HJOA 3ZONA 5DYJA 3B8QA 3TTIA 4PUZA 4GYIA 5EFQA 4A4OA 5E8UA 4MNEA 4BDHA 5BYZA 3OCBA 3R7YA 2GNIA 4XG2A 4DG0E 1ST0A 5I5ZA 2CDZA 4ZAUA 5E4HA 4YHTA 5FXSA 3MH2A 4NSTA 2JIIA 3PP0A 4Y46A 5EHLA 2XEYA 4XCUA 3K7IB 4MBLA 2FGIA 4H05A 4U80A 2E9NA 3BHUA 2B9FA 4GCJA 1WBSA 3UIMA 4ALVA 3RNIA 4HVHA 2VX3A 4BYIA 3MA6A 2W1DA 4O2ZA 4MXCA 4J99A 4DF3A 4A06A 4PNKA 2VNYA 4HGLA 3KCFA 2V22A 2XBAA 4FIFA 5M4CA 3FMLA 3TI1A 3D5XA 5HEZA 4PF4A 3ZEPA 2P0CA 4GVAA 3M1SA 4CXAA 3TIYA 3PSCA 2LAVA 5L6WL 1SVGA 3IW5A 2YIRA 2WTDA 5EDPA 3QTRA 5ETAA 4FT9A 2WKMA 3QWKA 4FC0A 3L8SA 3VC4A 2G2IA 3GC9A 3O96A 3Q2MA 3H9FA 4O0SA 4MWHA 4M0ZA 3FI2A 4O21A 3ORKA 4BI1A 3KCKA 4XG9A 5KMLA 4WOVA 2XYUA 2HENA 3NFGB 3ORPA 4QDEA 5E9EA 4DN5A 5CQWA 2OI4X 4UXLA 1O6LA 1JKTA 1URCA 4XUFA 5DG5A 2FYSA 1ZYJA 1NA7A 2OJFE 3FLYA 3NWWA 4FK6A 5E8VA 5FXQA 1SYKA 2XAOA 3OUKA 3QFVA 4GT5A 5JSMA 3FSKA 1J1BA 3G0FA 4M14A 5DLSA 3A61A 3OBJA 4WNOA 3SXFA 4YR8A 4LGHA 1YXUA 1J7LA 3MN3A 2WMSA 3LMIA 1H25A 3C13A 4F65A 4QTEA 2JDVA 2H8HA 3IGGA 1PMVA 3S2PA 3Q32A 3QQLA 4XEYA 4X6QC 2YEXA 2IJMA 2F7ZE 5IA0A 4HYIA 3ANQA 4GK3A 2B52A 3G90X 5EG3A 2PVKA 4FL3A 3UC4A 2UZNA 5EI2A 4EJ7A 4D0YA 1PKGA 3IO7A 3RALA 3R01A 3QA0A 1J7UA 3WYYA 3TT0A 2UW8A 3ZUUA 3VQUA 4FZDB 3EQGA 4H58A 4YGAA 2ITOA 3RCJA 3QF9A 1PXLA 4GYGA 3GNIB 3OWPA 5LQFA 4FVPA 2X4FA 4CTCA 4B8MA 3QYZA 3R22A 5H8EA 2OSCA 2XB7A 1XH6A 1ZOHA 3DDQA 3EQHA 4PTCA 4LM5A 1LPUA 4IB1A 3WOWA 4ASEA 2ITNA 5HLNA 2W4KA 3E7VA 4MWIA 3AMYA 3QD3A 4U6RA 3LPBA 4B7TA 4UXQA 2C1AA 4PMPA 2WMUA 5E91A 3RK9A 2R64A 5D1JA 4IB0A 4EH2A 4QMVA 3T9IA 3ZLYA 4UZDA 5JFXA 3LFQA 2CGUA 4RG0A 4WD5A 5CSXA 5DI1A 2B53A 2X9FA 4JXFA 4M84A 3LCOA 5IF1A 2FUMA 2VTOA 3U9CA 3N9XA 3CJGA 2GSFA 3SVVA 3PFQA 4L52A 4LL0A 3UDBA 4CG8A 5DHJA 5J1WA 3KULB 1FVVA 2OXYA 1DAYA 2BZHB 3QUPA 1H1QA 4AOTA 2ZM1A 2WOUA 4GKIA 2UUEA 4I6QA 2JDSA 4BCMA 4C4GA 2J0KA 5A14A 4RWIA 5HNBA 4HVDA 2ZAZA 4F0IA 4H3QA 1QCFA 1QPJA 2HELA 4FR4A 5IA3A 5T6KA 4OX3A 4FT7A