4F78A

Crystal structure of vancomycin resistance d,d-dipeptidase vanxyg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
251
Chain Sequence
GMMKTIELEKEEIYCGNLLLVNKNYPLRDNNVKGLVPADIRFPNILMKRDVANVLQLIFEKISAGNSIVPVSGYRSLEEQTAIYDGSLKDNGEDFTRKYVALPNHSEHQTGLAIDLGLNKKDIDFIRPDFPYDGICDEFRRAAPDYGFTQRYARDKEEITGISHEPWHFRYVGYPHSKIMQENGFSLEEYTQFIKAYLEDNKYLFEQAHRAEIEIYYVPAKDDKTLIKIPENCVYQISGNNIDGFVVTIWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the evolution of vancomycin resistance D,D-peptidases.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Hydrolase
molecule keywords D,D-dipeptidase/D,D-carboxypeptidase
total genus 71
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02557 VanY D-alanyl-D-alanine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.180 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f78A01
3.30.1380.10 Alpha Beta 2-Layer Sandwich Muramoyl-pentapeptide Carboxypeptidase; domain 2 Muramoyl-pentapeptide Carboxypeptidase; domain 2 4f78A02
2VO9A 3N1FA 4NT9A 3MXWA 4MUSA 4OAKA 4OXDA 2WFRA 3HO5H 1R44A 3N1GA 4C4NA 3M1NA 4F78A 4MUQA 2WFXA 2WG4A 3N1QA 4D0YA 2IBGE 4MPHA 3D1MA 3N1PB 3K7JB 4OX5A 4MUTA 2WG3A 1LBUA 3K7GB 3K7HB 1U10A 1TZPA 4JIDA 3K7IB 3N1RA 3N1OA 4MURA 1VHHA 4OX3A 2WFQA 5HNMA 3N1MB 4C4MA
chains in the Genus database with same CATH superfamily
2G2IA 3FQHA 4AT5A 5B2KA 2F57A 5B2LA 3F2AA 5DVRA 3ZU7A 3VWAA 5C8MA 4YJSA 1AGWA 3EQDA 3W18A 4HVDA 4ZLYA 3JVSA 4ZS4A 4L6QA 3FJQE 2WOTA 2XK6A 4IJ9A 1OPKA 4IJPA 3EFWA 4USEA 4O0WA 2J3TB 3V6RA 2PE2A 3PIYA 4C4FA 3A99A 3R8VA 1RDQE 3T9IA 4C38A 3SX9A 1MQBA 4RQVA 2Y4IC 4N0SA 2E9VA 2O5KA 4L67A 2Z7QA 3BGZA 4H3PA 3LJ0A 4XEYA 5IEXA 5KNJA 3FDNA 3PVBA 2XCKA 4F0IA 2XKCA 3EOCA 2PZYA 3OBJA 4FSUA 2DS1A 1SVEA 4CFMA 3GT8A 2CFHA 1Q3DA 4EYJA 4U7ZA 2R0IA 5CU4A 4DGGA 3PLSA 5JFXA 4O7RA 4G6NA 2CN8A 2QG5A 3GB2A 3JVRA 4QRCA 2C3KA 3BYUA 3WIGA 3KA0A 2RFSA 3FMLA 3NW5A 3QCYA 3EZVA 1KOBA 2XARA 2HZNA 3HKOA 3R0TA 1XH9A 5C9CA 5M06A 3PWDA 1B39A 4RJ5A 3ZRMA 4TZRA 5E1SA 3K7GB 1M2QA 2PZ5A 2ITTA 3QX2A 1IAHA 3VS1A 3W2QA 3LCOA 2W5AA 2C5VA 4JMQA 4XYFA 4DEDA 4ZSAA 2YIXA 3PP0A 2F4JA 2R4BA 5BUJA 4NT9A 4I0SA 5AV3A 3WZEA 2W1HA 4I6HA 3UMXA 4GYGA 4QTCA 3PE2A 3SHEA 4AT4A 4BDHA 3SDJA 3FXZA 3ORMA 5EYCA 3TT0A 1PKGA 3LCTA 5E90A 3TV7A 5CAUA 4KS7A 4RVMA 3ERKA 4WUAA 4RG0A 4LI5A 3CQUA 3UQCA 4HYIA 3RPYA 1CDKA 3IW6A 3N1RA 2GNGA 3IG7A 2BRGA 3LCKA 4CLJA 3MB7A 5I9XA 2IW9A 2WFYA 4RLKA 4GCJA 1KWPA 3QQUA 2QNJA 2JKKA 3VBWA 1BMKA 3COIA 3ZXZA 2VTIA 3P78A 5HE1A 3GU7A 4JG6A 3ZDIA 5KUPA 5LVOA 4WNMA 3FQSA 5EI8A 3WBLA 4AE9A 1RQQA 1APME 2XNOA 1Y6BA 4AT3A 3HRFA 3CTJA 2OSCA 3W2OA 3JXWA 5A9UA 3QYWA 4EZ5A 3P7BA 2R3RA 3ATSA 3S4QA 3GCQA 1OZ1A 4O0SA 2XRUA 4CFXA 1YHVA 4FNXA 3NAXA 4BHNA 5CU0A 5C4LA 1GZKA 1ZMVA 3T9TA 3MFUA 2EWAA 4JAIA 2PUPA 3LQ5A 4JR7A 4FZAB 2CJMA 2AYPA 4GSBA 4IAKA 4AGCA 4MQ1A 4YO6A 2F7ZE 3F3TA 3MH3A 4M0YA 4O38A 3V8WA 4BDCA 4K0YA 2OJFE 2WMAA 2WQEA 5CU2A 5AUYA 4EQUA 4O2ZA 4QMQA 4EBVA 3S0OA 2QOLA 3CQEA 4O22A 3PVGA 5I0BA 2ETKA 4O0TA 1SZMA 2ITOA 2XCHA 3C7QA 3W10A 2W1EA 4QP1A 3NYVA 2CGVA 4Y83A 2QR8A 3DAEA 3NX8A 4FKSA 2J3RA 3E5AA 4NM7A 3BU5A 1P4FA 4NJDA 4QMVA 2PVFA 3B8RA 4DF3A 1FGKA 5CYIA 3UNJA 4BICA 3KMUA 1M52A 3FLWA 4R7HA 4D9UA 2VNWA 5FEQA 4J8MA 3B8QA 4XG2A 1YOLA 2PMNX 4J99A 1JOWB 2VTPA 3R71A 3PJ1A 4FG7A 5DR6A 1IG1A 4I41A 1H1WA 4D4SA 2YCRA 3T3VA 4NTSA 3G15A 1CKPA 5DYJA 4B6LA 4O6LA 4B8MA 3I5ZA 4BR3A 5J5SA 3SD0A 3R04A 2JITA 4KD1A 2UW7A 1Q8WA 3AKLA 5CAQA 4RWJA 1OVEA 5KO1A 4QT1A 2XNNA 1A06A 4DH1A 5EW9A 2BIYA 2BKKA 5FDXA 4JX3A 2JBOA 4JL9A 3BE9A 3FLZA 2QODA 1MRUA 3F61A 4F0FA 2X7FA 3I0OA 4JQ8A 5JEBA 1FVRA 2IZUA 4GK4A 3FLNC 2XYUA 3E8CA 1KE9A 1PYXA 2ZV8A 5H9BA 5HIDA 3WF8A 2C68A 4F65A 4MUQA 3BGQA 4X2NA 4MWHA 3ODZX 4C33A 5C26A 4EH9A 2XJ1A 5K9IA 4JBOA 4PY1A 2JKMA 4K18A 4I0RA 3UC4A 3C1XA 4FOCA 4KKGA 2I0YA 1W8CA 2GFSA 4I5HA 2QOCA 4JDHA 4MD9E 4BCIA 4BIDA 3AD5A 2VTHA 5CNNA 3WE8A 3CLYA 1IASA 3LVPA 3ANQA 3LLTA 3CGFA 4IX5A 5F20A 4O7ZA 5HORA 5KZIA 5HU3A 3VUGA 4YJVA 5ETIA 1WBTA 3I5NA 4CLIA 3DOGA 3LMIA 4DFNA 3ZO3A 1STCE 3GFEA 5CZIA 2JFMA 4FT0A 1JKTA 2ITWA 4LMNA 3I6WA 2R3GA 4BCMA 4IVCA 2J50A 2GHMA 2JAMA 2OH0E 4FODA 4FV0A 4QMMA 2J3WD 4XLVA 4Q9ZA 5CVFA 1RJBA 2BUJA 3B2WA 5DR9A 4OW8A 2JGZA 3C4FA 3OOMA 4PDPA 3QLGA 2QOBA 4EZ7A 4UZDA 2BAKA 1FQ1B 3QRUA 2XS0A 5IEYA 2ZYBA 3DV3A 3LFFA 5CXHA 4BCGA 2J3TA 5IQFA 3DK7A 2XIZA 3R8UA 3DBCA 4IZAA 4APCA 3A60A 3OWLA 4GJ3A 1PW2A 1SM2A 4R3RA 1SYKA 3FMMA 2UW4A 4GV1A 4AXCA 2UW5A 3ULZA 2X9FA 3MDYA 4B8LA 2ITVA 3IONA 1Q41A 4RRVA 2OJJA 1PXMA 4FYOA 5K5NA 5L2IA 4FNWA 3NIZA 4ZTNA 4ZLZA 4QYYA 3RGFA 2OK1A 5CAVA 2OF2A 4QMZA 2E9NA 2EXCX 3P7CA 2UVZA 4GG5A 4U43A 4PWNA 4RVKA 2B54A 3H4JA 4E26A 4LFIA 1Q3WA 3AG9A 5AA9A 1YI6A 1ST0A 3MESA 5L2TA 1R39A 5C1QB 5AV2A 3Q4TA 3SW4A 5K4JA 4ZZOA 3UPZA 3W0PA 1WFCA 4TYJA 2CFHC 3P23A 5LARA 3HL7A 3WILA 1JSVA 3F7ZA 1XO2B 5I9YA 4BJJA 5IUHA 3F5PA 5D11A 3A7FA 5HZNA 4EZ3A 1NY3A 3II5A 4TYGA 2B52A 2A19B 3C0GA 3VNTA 2ITYA 3BYVA 3UDTA 2PZPA 2ZV9A 3AD4A 4IDTA 2CKOA 4FKTA 4O7LA 3OC1A 5ETAA 2ERZE 4TYEA 5M4IA 3Q3BA 4WBBB 4AN2A 4TW9A 5DEYA 3BIZA 3AGLA 4WRGA 3DFCB 3KL8A 2WO6A 4D4RA 5JKGA 3CQWA 2Y4IB 3OS3A 2OZOA 2E9OA 2CKQA 3FQEA 4DDGA 3HRBA 5FTOA 2OZAB 3CGOA 4U3YA 3WI6A 3U54A 4CV9A 2WTKB 4F9WA 5JK3A 5BYZA 1UVRA 4I6FA 4OBOA 1KE7A 4IVDA 4RJ6A 4EOOA 4ARKA 4Z55A 1R0EA 3THBA 4F1OA 1PXOA 5CSWA 3ZZWA 3WYXA 3PG1A 4UWBA 3VUIA 3KXCC 2Z7LA 3F7WA 4I6LA 4HPTE 2PHKA 4EYMA 2VTNA 3DLSA 4O0UA 2PULA 1IEPA 4K1BA 1TQMA 4IX6A 3U6HA 1G5SA 3FMEA 4O7NA 3TUDA 1JNKA 1VJYA 2ZMCA 3MFSA 2NRYA 1YWNA 2Z8CA 3EKKA 3HGKA 4IB1A 2ITZA 4GRBA 3EQFA 4JDIA 4QMSA 2AEGA 4D1ZA 3N1FA 3Q6UA 2ZAZA 4X2JA 3RPRA 1BL7A 2H34A 4FGRA 3RWPA 4DFLA 1WBNA 4S34A 3LFEA 5HTCA 4USFA 3CUED 3R02A 4M15A 3IDCA 4K11A 4C35A 1GIJA 5F95A 3FXXA 5IA0A 2C4GA 2F7XE 5M4UA 3N1PB 4O81A 5J9ZA 2JD5A 4O2PA 5D1JA 3FZRA 2OSDA 1OECA 3P7AA 3BEGA 4GK3A 2VGPA 3W2CA 4C3PA 4U80A 3RCDA 5J9LA 3Q04A 3CBLA 5TF9A 4C7TA 2VUWA 3R9DA 4BJJB 3LJ2A 4I4EA 1LEZA 3DXQA 3R7OA 4MHAA 2BZKB 4WBOA 3ZYAA 3BLHA 4OTRA 4F64A 4FTTA 2BHEA 3KN6A 4EOJA 3SW7A 3PSCA 4BGGA 2JBPA 3R8LA 3EFLA 4U40A 2W5BA 3L8XA 4LYNA 5CLPA 4RIXA 4EJ7A 4F09A 3ZUTA 1KE5A 2ZV7A 3FMJA 4RWIA 3ZMMA 3FXWA 3ZRKA 1OIUA 1OIYA 3AC8A 3UOHA 3UO5A 4C02A 4C58A 4F08A 3NCGA 4F99A 4CG9A 4RIYA 3LW0A 2GNLA 1IA9A 3HMNA 2PUNA 3IECA 4TNDA 4L3JA 4DTBA 4GIHA 4KUJA 2C3IB 5CSVA 5IU2A 4RIOA 4EOKA 1ZZLA 2J0IA 3ZLYA 4G3FA 3FPQA 3QC4A 4CCBA 1ND4A 1M14A 2J0MB 2J3WB 3DBEA 3ZFXA 4FC0A 3GOPA 4FV4A 1CTPE 5D41A 3K3JA 3Q53A 5IQEA 2B9JA 3CTQA 3G5DA 3TDVA 4E6AA 3DFAA 3R73A 2NP8A 4XS2A 1PXIA 3RAKA 3AMAA 1S9JA 5HVKA 3K7JB 2GDOA 5HO8A 4KA3A 1OB3A 3LFSA 4OTFA 2IVUA 3R9NA 4S2ZA 2WXVA 3PPJA 3ORLA 2OG8A 4KSPA 4D2SA 3LZBA 4CV8A 3ORIA 3AC5A 4NW5A 4YO4A 4BCNA 2CNVA 2JC6A 5M4FA 3AT4A 4E4LA 1WZYA 5HTBA 2FB8A 1YDRE 4U44A 5HGIA 3C4XA 1CKJA 1DI9A 3KCKA 4MXAA 4QTAA 5CSHA 3FY0A 3TJDA 3V01A 1JKKA 5AADA 3N1GA 4I5CA 4CFVA 2VZ6A 4AA5A 4F78A 5FGKA 3V5JA 1H28A 3KCFA 3OW4A 4H58A 5DFPA 3RTPA 2HY81 4OTGA 5CZHA 3VQUA 4DGNA 4GVAA 2O8YA 1X8BA 1W82A 3D83A 3DLZA 4QYEA 4BTKA 2WMBA 5HVJA 5IQDA 4ZSEA 3Q9YA 2FYSA 2XAOA 3F5GA 3ID6C 3E93A 4O96A 4JS8A 3Q5ZA 2C6OA 1H1SA 3IOKA 5CWZA 4ZIMA 5T6KA 4J53A 1OL5A 4GKIA 3KXGA 4C59A 2ZJWA 4DFXE 2QOHA 4K6ZA 2ETRA 5AUUA 1ZAOA 5IPJA 1PMVA 4N4SA 5ANOA 3UC3A 3ROYA 2Z2WA 4DTAA 4BZDA 4RJ4A 4GK2A 2XM9A 2VWWA 4MNFA 3VS5A 5IZFA 4CT2A 5C27A 4E7WA 4I23A 2YWVA 2C30A 1DS5A 3ZC5A 5CF5A 3IW8A 3PFQA 1QPJA 4MUTA 2I1MA 3LMGA 3V3VA 1OGYA 4W4WA 1OL6A 1JBPE 4BTMA 3QCXA 3PJ2A 4Y46A 3VHKA 5JH6A 5HD7A 3NIEA 1UWHA 4U42A 5AAFA 4W8DA 2NO3A 4WUNA 1OPLA 4Z7HA 1WBSA 4C4NA 3ZSGA 4Y5QA 5DPVA 5DRDA 1QCFA 4FSMA 4AAAA 3MGYA 4S32A 4XHKB 3UOKA 3FC2A 4KB8A 3PXQA 2IW8A 4BDEA 2GU8A 4ALUA 5HG7A 5CNOA 3FYKX 4DHZA 4N6ZA 4FSNA 3ZLWA 2WB8A 4G5JA 5CQUA 1TKIA 2GQSA 1V0OA 5KX8A 3UYTA 1SMHA 5FP5A 2C6IA 4D2RA 3D5VA 2HXQA 1WBOA 5CF8A 4EH7A 3S00A 3KXNA 4KNBA 2OIBA 3JR1A 3R9OA 4BI2A 2YZLA 2BZJA 3HMPA 4PL4A 2UZLA 4HGTA 5AA8A 5IMXA 1PYEA 4MBIA 3W0RA 3QUDA 2GHLA 4QDEA 3Q60A 4DGLC 3U51A 4AQKA 5LOHA 1R44A 3DZOA 4QP4A 3M2WA 3TN8A 4EK4A 3DJ5A 4ZLOA 2QLQA 1PJKA 2VTSA 4G3GA 4CGAA 3NUAA 5IUIA 2WMWA 4FIIA 2WMTA 4GT5A 3F6XA 3S1HA 5IF1A 4R6VA 2C1AA 2J7TA 4I5PA 4ZSJA 4EHZA 5ETCA 4NFNA 2XK3A 4Y73A 4RT7A 3UQGA 4MXYA 1A9UA 2YACA 4HGSA 4BRXA 4CEGA 5BVDA 4G16A 4IB0A 4XX9A 5DR2A 5LVPA 5E8WA 1ZOHA 4MUSA 5CSXA 5IQAA 5HCYA 4IAZA 1H1QA 3BYMA 2QOIA 3R7EA 3BBWA 2ZOQA 3IS5A 1ERKA 5AEPA 2VU3A 3OUNB 4S30A 1LPUA 2BRNA 2QHMA 1PY5A 3BE2A 5KMKA 3E87A 4QMNA 3GU8A 3E8NA 3TV4A 4R5YA 2B53A 3O23A 1SVGA 3KEXA 4AXDA 3N9XA 2PYWA 3K5UA 4NH1A 5EYMA 4OBQA 4OT5A 5L6OA 1RE8A 3E62A 3GGFA 4GMYA 4LOOA 4YHJA 3SC1A 3QGYA 4ACCA 3DT1A 4JLCA 2WQOA 4UYAA 5IEVA 2X8DA 4TY1A 2QO2A 3HLLA 3IO7A 3OXZA 5IH4A 2R3KA 2X7GA 1PRYA 3FZOA 2PMOX 2XANA 3LFQA 3O17A 3Q4UA 4BI0A 2WFRA 3WZKA 4I5MA 4XRLA 2XK8A 3WYYA 2GCDA 1Q5KA 1J7UA 3FWQA 4LGHA 4WT6A 5A4QA 5AMNA 5HIEA 4L45A 4PUZA 3SXRA 3ZEPA 2F2CB 4IACA 3NGAA 3R2BA 4FICA 2VWVA 1YWVA 2CMWA 4H36A 2C6EA 4MVFA 4JQ7A 1YRPA 2X4FA 4RZVA 4QMXA 4XV9A 1SNUA 3N1OA 4AZSA 4KAOA 1O9UA 3OCTA 3ML1A 3EL8A 2JDRA 2VTJA 5A14A 1AD5A 3NJCA 4X6RA 4IHPA 4IX4A 2XJ2A 4ANQA 3KGAA 4W4VA 4FOBA 3QRJA 1WBPA 2X9EA 4GYIA 4RC4A 2J2IB 2XRWA 3HNGA 5FDPA 5LVLA 1PF8A 5DHJA 1YDTE 4FVPA 3IDPA 3BV3A 2UZDA 4QMPA 2Y7JA 3LQ3A 4TPTA 4XRJA 1IAJA 3D1MA 2ITQA 3OMVA 3T3UA 2XK7A 3AD6A 3MPTA 2OH4A 2QKRA 3PZHA 4RFYA 4M0ZA 4R3PA 4ANMA 5AP4A 2HAKA 3K7HB 2A4LA 2FSOX 3WE4A 3DBFA 3LLAA 3CE3A 4JJRA 3F9NA 3AC1A 5JFSA 3U4UA 3TWJA 3FI4A 4ZJJA 2RKUA 1OPJA 3RAIA 3DXPA 3TL8A 4O91A 4EOLA 3OXIA 5C03A 4KBKA 3UO6A 5BYYA 4FX3A 2WMUA 3POZA 2J51A 5AP0A 4ANLA 3UQFA 4FUXA 4IANA 2WG3A 1DAYA 2WQMA 5HX8A 4QP6A 2V55A 3TI1A 1H24A 2RFEA 3CEKA 4FK3A 4B0GA 5BPYA 4KWPA 2Q0BA 3K54A 4U5JA 3UIMA 1QPEA 3BHUA 3MN3A 5A4EA 4FTOA 3TIZA 5M44A 3ORNA 4OX3A 4O0RA 4L3PA 3RK9A 2DUVA 4FIGA 3HUCA 2EB3A 3ITZA 4X3FA 5FXSA 5EQPA 2J9MA 3V8TA 3GNIB 1MRVA 3UP2A 5IDNA 4WHZA 4CSVA 1P2AA 3BGPA 4J52A 4ZZMA 3MV5A 4FR4A 4QQTA 1PXKA 4DG2E 3U87A 3AC2A 2UW9A 3R01A 4H1MA 2QU5A 2YAKA 3DZQA 3Q52A 4I6BA 4WSYA 4H3BA 5FM3A 4PP7A 2G9XA 2W99B 2XZSA 4PL3A 3WIKA 4RA4A 4UALA 4YZNA 4XP2A 4EQMA 4BN1A 2ETMA 1HOWA 2GNJA 3FMDA 3A4OX 3ALNA 5AV0A 2C5OA 2HWOA 3WZDA 3QRKA 4CFFA 2IN6A 2XEYA 5LVMA 3MFRA 5CVHA 1SNXA 2OJ9A 1NVQA 1ZXEA 4IAFA 4QYGA 2V7OA 5BX0A 4C4HA 5KBRA 4BC6A 4C3RA 4HW7A 4FKRA 4FTJA 2CPKE 2WTIA 5TOZA 1UNHA 4V05A 4EH8A 2W4OA 2XM8A 4KBCA 1JKSA 1I44A 4YLJA 1Q99A 2PPQA 3FMHA 3OEZA 4QNAA 5EI2A 3HEGA 3FV8A 4IZ7A 4FIHA 4JDJA 4LUEA 5IQBA 2X8EA 3CJGA 3DDPA 4C0TA 3D5XA 3CS9A 3AQVA 1GNGA 1ZYCA 3QTXA 4FZFB 3O7LB 1XR1A 4YP8A 3KVWA 3DXNA 3KRWA 3MY5A 4IAYA 4X3FC 2WZJA 5AAEA 4XG7A 3MYGA 3NZ0A 2BZHB 3HX4A 5L6PA 4C37A 3TJCA 3FZ1A 3ANRA 4AZFA 2Y8OA 3CCNA 3RNIA 4F6SA 2BALA 4O86A 5LMBA 2XH5A 1J7LA 5EQEA 1GOLA 4ASXA 5HG5A 1J1BA 3Q9ZA 4WA9A 5CAPA 5J9YA 4RMZA 4MNEB 3R1YA 3W8LA 4DHJA 2W1DA 5EK7A 4BKJA 4G9CA 4FVQA 4LDTA 4IQ6A 3N1QA 4A4OA 5FQDC 4M12A 4X0MA 3PY0A 1UKHA 1XH5A 3KU2A 2C0TA 4ASZA 4C2WA 2CNQA 4AW0A 3FHRA 1XJDA 4IH8A 4PNIA 3KXCA 1PMNA 4USDA 2KTYA 4O7TA 5J95A 3RVGA 3PXKA 4F9BA 5CAOA 1F3MC 5CS6A 4DCAA 2QCSA 2XALA 3HAVA 1ZY4A 2C0OA 3QQJA 2XKEA 2Y4PA 4P5ZA 1XBCA 3HMOA 3GBZA 2UV2A 3Q6WA 5F9EA 2QD9A 3MBLA 2GFCA 4GT3A 3QTQA 4N57A 5AAGA 4YJQA 2PY3A 1O6KA 5ANKA 5K4IA 4I3ZA 3R21A 4ZTSA 2P55A 1KV1A 4HNFA 3R8ZA 5FEDA 3R7YA 3FL5A 2J5EA 3H10A 1GY3A 4NKAA 2WTKC 2VNYA 4UBAA 4FNZA 3LFNA 5IQHA 2DYLA 3EN9A 3VO3A 4EC9A 3G33A 4ERKA 5HG8A 2X39A 3F3ZA 3PA5A 2VTAA 2UZNA 2X2LA 5IQGA 4FIEA 4J97A 5IMEA 4FG8A 3IKAA 3QD3A 4QYHA 1G8KA 4AG8A 2J4ZA 5L8KA 4YZDA 5I5ZA 4U8ZA 4UV0A 5HNMA 4ANSA 1T46A 3DDQA 5H2UA 5A4LA 3KF7A 2GPHA 3AMBA 3R63A 3A4PA 4PRJA 4HZRA 4EK3A 5A6OA 4NZWB 3EYHA 3W0MA 4DH7A 3R7IA 3CKXA 4D9TA 3REPA 3KK9A 2X0GA 5J1VA 3PJ3A 3PVWA 2WU6A 3OWKA 1OBGA 2ZVAA 2HYYA 3QKKA 3PZEA 3L8VA 3D7TB 4E93A 2VO7A 3PVUA 3FKOA 1U10A 4I94A 4YPSA 3BWFA 4HOKA 3TNPC 3D0EA 4QP7A 4RVTA 4NM3A 2EB2A 5EDRA 4DN5A 4NFMA 4KKEA 3MA6A 4MWIA 3VBTA 2JIUA 3NPCA 4RWKA 4LQMA 1ST4A 1ZARA 1YKRA 4V0GB 2I6LA 3SAYA 5FEEA 4PNKA 3I60A 4DG0E 4PDOA 3F66A 5E92A 4FT9A 1VYWA 3ALOA 2VGOA 4QP2A 3UDSA 2VX3A 4TT7A 4FKIA 4M67A 1MQ4A 4TN6A 5TO8A 4D0YA 2VD5A 4CFUA 1LP4A 2IZSA 3QHWA 4TNBA 3QCQA 5CASA 5DNRA 3P86A 3WZJA 4JX7A 1NA7A 2BTSA 3FPMA 2XB7A 2UW8A 3AOXA 3C4WA 3EJ1A 3I0QA 3H0YA 5AJQA 4BTFA 4MH7A 4QMLA 5DN3A 2PVNA 3M42A 3KRXA 3TNQB 2F49A 3PRIA 4QPAA 3KIOC 2FGIA 1WBVA 3BX5A 1G8SA 4D1SA 3HMIA 4D4VA 2VWBA 2RGPA 2PMIA 5AFVA 4BDGA 1FPUA 5AP2A 4RX8A 2VTOA 5HLNA 3NLBA 3CUEB 1Q8ZA 1J3HA 3GENA 2P33A 5J87A 3VRZA 3TACA 4IB5A 4G31A 3V04A 2WKMA 3PA4A 2RFDA 1V1KA 4FSYA 4L00A 3BKBA 4MTAA 2XIKA 5C01A 2G2HA 4K33A 4O7VA 3VRYA 4A9YA 3N4TA 4ZZNA 3ZONA 3H9RA 3G9LX 4ERWA 3DK6A 4YLLA 5EYKA 4YTCA 5ANGA 3Q4ZA 2VO9A 2X6DA 2B7AA 1E9HA 1ZMWA 3E64A 2HZ0A 2C69A 3ZUUA 5DT3A 4Z7GA 4IWQA 5CU6A 3OUKA 1R3CA 4FJVA 5DIAA 4E73A 3DNDA 3ZHPC 3E3PA 4GU9A 2GTMA 2UZTA 4EH4A 3R8PA 4WD5A 2Q83A 4CZTA 4G9RA 4G34A 4ZY6A 2BRBA 2GTNA 4GUBA 5E4HA 4J95A 1WC8A 4I24A 5FP6A 4A9UA 3NAYA 4FV8A 3MA3A 3I7CA 2UW6A 3G90X 2IJMA 2ESMA 3PWYA 1OM1A 4OTHA 4BDIA 3EN5A 3R1NA 1Z5MA 5DT0A 1URWA 2JFLA 3EQPA 2C5NA 4L43A 3TUCA 2XNBA 4HPUE 3I81A 2Z60A 2R5TA 4ZTMA 5JFWA 4DINA 5JZJA 1DM2A 2PZRA 3ATTA 4BDAA 3U55A 3VF9A 4R1VA 4X21A 3ORPA 4IX3A 3QTIA 4EH5A 4FYNA 1MRYA 5M57A 2J0JA 4XBUA 3C9WA 2NNWB 3ENHA 1ZWSA 1TQPA 5EOLA 3A7JA 3NEWA 2PSQA 4IVAA 5DBXA 4O0XA 4BCQA 3DTCA 2WMQA 2IVTA 4YZ9A 3PE1A 3QL8A 4HNIA 4U79A 3E8DA 4ZMEA 2Y6MA 3GC7A 2ZB1A 4FK6A 4MQ2A 1OUKA 4CKIA 3VBVA 3ZEWA 3SG9A 3GFWA 1OGUA 3HVCA 4X7QA 3EMGA 1BI8A 2JAVA 1Y6AA 3F69A 1Q24A 2EU9A 4WOVA 3RKBA 2F2UA 2VWUA 3FUPA 1XH4A 4FVRA 2VAGA 3G0FA 3MI9A 4AZWA 4TWPA 3AXWA 2C5XA 4A9TA 3L8PA 3QC9A 2OI4X 2QO7A 4JI9A 1E1VA 5EOBA 4GW8A 2IZRA 4B99A 2PVKA 3V5QA 1OKWA 5AUZA 3TZMA 2AC5A 3NRMA 4DEIA 3MB6A 1UNLA 2G15A 1PMUA 2QC6A 3QD2B 3FL4A 4JVGA 3PLAE 2XP2A 4XP3A 2WU7A 3ZLXA 3NNWA 2XNPA 3UZRA 5M4CA 2R9SA 1H00A 4ACGA 4XOYA 3KRRA 5GJDA 3GP0A 1PMEA 4MNEA 4NK9A 3HRCA 1GZOA 3NFGB 4HVHA 5AX9A 4L01A 5HESA 2HZIA 3A8XA 3IOPA 3MJ1A 3Q4CA 4FBXA 4RBLA 3QALE 3BCEA 1JSUA 4C61A 3OG7A 4JG8A 2BDFA 3G2FA 3VS0A 4AA0A 4DEBA 1P5EA 4J98A 3VONA 4RX7A 3LXLA 5HD4A 2PVRA 2QLUA 2X2MA 4ACHA 4RVLA 5HCXA 4JBVA 3C0IA 4ZXTA 3VJOA 4E1ZA 1J91A 5ETFA 2HELA 3MJ2A 3BHHA 4BHZA 4R7BA 2YM7A 2B9FA 4LV8A 2PUIA 4IC8A 1H26A 3PSDA 3W8QA 3L9NA 1OIRA 1OUYA 3KY2A 4U0IA 4I6QA 5EM8A 3R83A 4E4NA 1KE8A 3OCGA 2RG5A 2A0CX 4PQNA 5HEZA 4DEEA 5LQFA 2C6TA 4MD7E 4F4PA 3ZUVA 5BVNA 2C5YA 2YFXA 2C0JB 5BQ0A 3OWPA 2C1BA 2YABA 5CEIA 3P5JC 2R0UA 4D0XA 5LCJA 4AW1A 2H6DA 4RIWA 3MH1A 1GIIA 5EM6A 4GVJA 3MSSA 4HYSA 4RX9A 5HO7A 2P2HA 2JDVA 4YJTA 4AOTA 2CCIA 4BIEA 3WZUA 3QUEA 2GS6A 4CVAA 3W1FA 1KUTA 4LRKA 3ZBFA 2J6MA 3MS9A 1H1PA 2NPQA 3OOGA 3PRFA 4GFMA 4K77A 4OTIA 4C4GA 3EFKA 3F82A 3HZTA 2HOGA 4CNHA 1TZPA 4NSTA 2OIDA 4G3CA 4M68A 4BGHA 4IAAA 1YXXA 4FV6A 5FXQA 1ZOEA 2V22A 3O2MA 4GEOA 4IMYA 5BYLA 5A54A 3EN7A 5KMMA 3PDTA 4HVIA 2P4IA 4X2FA 3PA3A 3QA0A 2WTDA 3UIBA 4WIHA 2JIIA 2XBJA 2W1CA 3FSKA 4ALVA 2AC3A 5L8LA 4LOQA 3QA8A 2E9UA 3UOJA 1VYZA 3CPBA 4OXDA 3QXPA 3HA8A 4FT5A 3R9RA 3D4QA 2YDJA 2B0QA 2SRCA 3DK3A 3FZSA 3NW6A 5LXMA 3I7BA 4RQKA 3HUBA 4CFNA 1P4OA 2C6KA 3BYSA 4BCFA 5EH0A 3RPOA 4YHFA 4JRNA 4L46A 3L8SA 3LFBA 1G8JA 1PXJA 2ZMDA 4QP9A 4AOJA 4V01A 4V0GA 2P0CA 1LBUA 1GZNA 4P5QA 2QOFA 3HA6A 3ZRLA 1FBNA 3SOAA 3ZXTA 1REJA 2YM8A 4O82A 2OZAA 2HXLA 3AC4A 4NU1A 5M53A 2XUUA 2R7BA 3BV2A 3LAUA 3ENMA 3MH2A 3QX4A 4RX5A 1BLXA 3MPAA 4FSZA 4YZCA 4GIIA 4OBPA 3KKVA 5HIBA 3LXNA 4YHTA 4FKPA 3IK3A 3BBTB 4RSSA 4AU8A 2PK9A 5HVYA 1FVVA 2ZB0A 2WQBA 3SGCA 3NW7A 4RIWB 3TNWA 2UW0A 3NWWA 4RWLA 4IAIA 2VO6A 1W84A 2XNGA 3QWKA 3PTGA 5KBQA 2YM4A 3L9PA 2XIRA 3CC6A 4MAOA 5KMIA 3PJCA 2X81A 2VTMA 2FVDA 1H0WA 2QU6A 4CMTA 3RZBA 3BLQA 4I93A 4DGOA 3CSVA 4MURA 4WG4A 4CQEA 5I4NA 5K5XA 4F1MA 4YMJA 2R3LA 4NW6A 2ZFYA 2ITXA 5M56A 5FM2A 2UZEA 2OIQA 4FTNA 4AZTA 2CDZA 3E7OA 3OVVA 3OWJA 4FMQA 4U41A 5EW8A 2OFUA 4FSTA 4MXOA 5LMAA 3TXOA 4EORA 3O8UA 1W83A 2CLXA 4M84A 4DYMA 3N4VA 4AZEA 3PIXA 2Y0AA 2FA2A 1CSNA 4EKKA 3HP5A 5KKRB 3EQHA 5E7RA 4UY9A 3V5PA 3WF6A 2YZAA 3FSFA 2P2IA 2C3LA 4BCJA 3IPHA 4BVUA 2VTLA 5H3QA 3ZDUA 2QO9A 3I4BA 3OY3A 3SXSA 3ZC6A 1EH4A 3LOKA 4O27B 4TWNA 2QKWB 3UPXA 3RMFA 3UVQA 1CKIA 1XWSA 3WF5A 4ASDA 3D94A 3LJ1A 3QUPA 4C36A 3OW3A 3DKOA 4NWMA 1OBDA 1Q4LA 1V0BA 3W55A 5EYDA 4AP7A 3KULB 2WEVA 3NFFB 4FKOA 4ASEA 2PUUA 3PJ8A 3UJGA 4JOAA 1W98A 3HV5A 5DI1A 5K3YA 5EHYA 4ONAA 2DWBA 2QG7A 4WNPA 2Y6OA 1NXKA 2XK9A 3C5UA 4JRVA 4XG8A 4L68A 1JSTA 4Y72A 4FZ7A 4G6LA 3Q9XA 1PKDA 4F1TA 4YC8A 5IA4A 5T3QA 2OGVA 3FYJX 2CGWA 3NUPA 5B0XA 4UYNA 4BCHA 4CXAA 4D1XA 3R22A 4DFZE 4E5BA 5AP1A 2WNTA 4QMYA 4YU2A 2CGXA 3BELA 5LCKA 4C4EA 4B9DA 4H39A 4KS8A 1DAWA 2W06A 3I79A 2XF0A 2WFQA 5DOSA 1GZ8A 3DCVA 4J96A 2WMVA 3UIUA 4DLJA 3G0EA 5BV3A 5J8IA 5TKDA 4AXAA 3SA0A 5JRSA 1ZYLA 3LCSA 3FKNA 1HCKA 3DKFA 2HY0A 4DH3A 3QRIA 1ZZ2A 2WMXA 4TRLA 3R00A 4AOIA 2X4ZA 4FKWA 1JKLA 5JSMA 3EB0A 3MVHA 4G5PA 4Q5HA 2WFXA 3CXWA 4F6UA 4ZAUA 4NIFB 4U6RA 2CGUA 3L9LA 4M14A 3ZOSA 4A4XA 3HV6A 4YR8A 1MUOA 2GMXA 3P5KA 4KINA 3F88A 1FINA 3QQFA 5G1XA 3VF8A 3GC9A 3F5UA 4FEXA 3V51A 5A6NA 2BMCA 1UWJA 1GJOA 3R1SA 4F9AA 1P14A 2GS7A 4AZVA 1BKXA 4E6CA 3ORTA 5E91A 3TYKA 4XUFA 3LQ8A 4F9CA 5JGAA 1WVWA 3LFAA 4EI4A 3PSBA 5FTQA 3LMHA 3QQHA 3SRVB 5HLWA 5C4KA 2C47A 2W1ZA 1NT2A 1Q8UA 3QKLA 2EUFB 3A8WA 2GNFA 3QXOA 4BB4A 4AA4A 4BZOA 2IPXA 2GHGA 3V5TA 3NS9A 2A27A 5DLSA 3NMUF 3ZO4A 4FL2A 5HBJA 4CMUA 4BIBA 4YBKA 2BDWA 3FHIA 4S31A 2W9FB 4YJRA 1U46A 2B9IA 3A7IA 3DAJA 4M69B 4QMOA 2EVAA 2HWPA 3DA6A 4U81A 5AX3A 4DAWA 4DGMA 5L2WA 4EWHA 3FE3A 4M3QA 3GEQA 4YJOA 2WQNA 3U9NA 4M7IA 2WIHA 4AFJA 4IW0A 3CPCA 4R5SA 5E8XA 5E8ZA 2YIRA 5HLPA 2VTTA 2ONLA 2OO8X 5D12A 5HCZA 4I20A 4IWDA 1GAGA 2WIPA 1OL2A 3HECA 4LL0A 4XV3A 2I0EA 2F7EE 3VUDA 2YCQA 2DQ7X 4G17A 5EHLA 3ZS5A 4C62A 4GG7A 3KXHA 3C4ZA 4IIRA 5JGDA 2PWNA 2ERKA 4IZ5A 3TUBA 2O0UA 3HDNA 4Y8DA 5LJJA 3HDMA 1YOJA 4QTEA 4WRSA 3IDBA 4MPHA 2ZM4A 5FG8A 3LPBA 4RGJA 3UG1A 4YURA 4KIOA 5GNKA 4AE6A 5CY3A 2PE1A 4Q5EA 3DKGA 4M8TA 4YNOA 4P7EA 3NNVA 4YZMA 4C3FA 4C34A 3R7UA 3FI8A 4DFYA 2W4KA 1UU9A 2OW3A 3O7LD 4IM3A 1Y57A 2W17A 4NCTC 5AUWA 5HNGA 2XNMA 4XBRA 5E8SA 2HIWA 4YJNA 4C4MA 3KVXA 2ZDUA 3FY2A 3LIJA 5HICA 3VUHA 4C2VA 4DA5A 3TZ9A 4O84A 2R3MA 2AUHA 2YJSA 2R3QA 2GQRA 4I92A 4E5AX 4EHVA 4EK8A 5JN2A 2WHBA 5KCVA 3UVPA 1CMKE 3BLAA 4APPA 1J7IA 2CNUA 3NUSA 3O71A 4JQEA 3K2LA 3V8SA 1S9IA 4XOZA 3QTWA 2WPAA 3BI6A 3OHTA 4B7TA 2YAAA 3SRVA 2V7AA 3R1QA 4HGEA 4ZJVA 3EZRA 3Q96A 1XH7A 4FL1A 4NL0A 4XH6A 4AX8A 4DC2A 4EH3A 1DI8A 3QWJA 3SKCA 4YC6A 3K5VA 3KMMA 2W9ZB 1WVXA 3MVMA 4U45A 5AP6A 4EH2A 3SVVA 2ONLC 5D7AA 4QDVA 2OU7A 2QR7A 3RPSA 1JLUE 1M2RA 4DLIA 4F70A 4ZY5A 1JWHA 4H3QA 2YN8A 5FTGA 4OAKA 5AV1A 5BUIA 2HW6A 4U3ZA 4RIYB 2R3PA 4Z3VA 1U4DA 2OLCA 4I4FA 2JDSA 5AP7A 1M2PA 3ZSHA 1H08A 1R1WA 1QMZA 5M55A 3C4CA 3AT3A 3BQRA 3NCZA 1K3AA 3EQBA 5L6WL 4RLLA 3GC0A 3VQHA 4WKQA 4D58A 4W8EA 1XH6A 3W2SA 2QHNA 4ITHA 4TL0A 1FVTA 3BHYA 5IG1A 4A9SA 3DTWA 1TQIA 1Q8TA 3SOCA 2W7XA 4K8AA 4RJ3A 5EQYA 2OSOA 4RZWA 4F63A 4TKSA 5EDPA 5ACBC 3QF9A 4OLIA 4PMTA 2IVVA 2Q0NA 2W96B 3S3IA 1UV5A 4FV9A 4YJUA 3V6SA 5DH3A 3JUHA 3C4EA 3UNZA 4DEAA 5IH6A 3L1SA 4EK5A 5JGBA 2BJNA 1M7QA 2JKOA 4FV3A 2QURA 3MVJA 5ANDA 4Z9LA 2XIXA 2GNHA 2R2PA 3EH9A 4FL3A 4FV1A 3BLRA 3BWJA 1B6CB 4D55A 2BHHA 2CCHA 4UZHA 3M1SA 3JS2A 5AWMA 4ACDA 2WG4A 3BQCA 3RJCA 1NW1A 5AM6A 5CEQA 3LE6A 3VJNA 2J90A 4XG4A 5E8YA 4TWCA 2XEZA 4U9AA 2C6MA 3U9CA 4BCOA 4ID7A 3RAWA 4PMSA 4R78A 3RI1A 4IADA 2YIQA 4FTKA 4MD8E 3ZLSA 5J7HA 4E6QA 4DITA 3K7IB 3VHEA 4K9YA 1VHHA 4L7FA 2IZTA 5CF4A 3SQQA 3QZGA 5TR6A 1M17A 3UOLA 2PMLX 3JYAA 5A46A 2J3RB 1QPCA 4QNYA 4X6QC 1W7HA 3OCBA 3V5WA 3DU8A 3ACJA 2XMYA 1W0XC 5DA3A 2YWPA 3Q2MA 5CALA 3KULA 3FLQA 4PTCA 3ZBXA 4X3JA 2XVDA 2XNEA 4EJNA 3QAME 3RWQA 1YI3A 3HV3A 3ZM9A 5KHWA 1RW8A 5B7VA 4LOPA 1A48A 2H9VA 3NNXA 2HK5A 4PDYA 4R3CA 2F9GA 2PL0A 4UXLA 5M08A 3ETAA 3A2CA 3QTSA 4QYFA 4CD0A 4YGAA 5LVNA 4EHEA 3CP9A 2G2FA 5HG9A 4RJ7A 3PUFC 3HV7A 3TG1A 3KXZA 3MTFA 4PTEA 3OTUA 1WCCA 4XJ0A 2B55A 5G6VA 4O7SA 3ZH8A 4XNEA 4CRSA 4EOPA 4HYUA 4EK6A 1XHAA 3K3IA 5CT7A 5BVWA 4FEVA 3UODA 4AQCA 3FC1X 4CG8A 5FBOA 1XKKA 2BROA 2UVXA 4FTQA 1BI7A 2BIKB 2XKDA 1HCLA 3H9FA 4AFEA 3PFYA 4AACA 4DEHA 3N1MB 3ROCA 3DB8A 4RFZA 4AGWA 5H8EA 5DRBA 4MF1A 3UO4A 3SV0A 3PIZA 2BAJA 4KABA 5IQIA 1OKZA 2WMRA 3D7ZA 3I1AA 3PG3A 3WF9A 2BILB 1UA2A 4I22A 1PXPA 3B2TA 4OT6A 2PVYA 4YC3A 2R7IA 1XQZA 4BCPA 2YIWA 2YJRA 3UMWA 4DBNA 4V04A 1FMKA 4DFUA 5KMJA 3D9VA 3QQGA 3L9MA 4YUQA 4MYGA 4DE4A 4ZMFA 1OMWA 4YLKA 2YCFA 4LV5A 2NRUA 3OBGA 3P1AA 4FTRA 4D28A 2IBGE 3NR9A 5GJGA 3W2RA 3KB7A 4PF4A 3EQCA 1U5RA 5KE0A 4FTLA 4X3FB 4CTCA 1PXLA 1Y8GA 1YW2A 3ELJA 4DDIA 5AIRA 4RIXB 5CI7A 1KE6A 4XV2A 4CCUA 4F9YA 5HU9A 3KMWA 1H27A 3OEFX 5CEMA 4ZK5A 2BFYA 3UYSA 3BPRA 1OL1A 4H1JA 1WBWA 1YOMA 1ZYSA 4HVGA 4JDKA 4X2KA 2H96A 5A4CA 4F7SA 4GKHA 4AW2A 2UVYA 3ORKA 4FKGA 4ZS0A 5CT0A 3EYGA 2BFXA 4FV2A 5HHWA 4PMMA 4OGRA 3ZSIA 2VO3A 1VZOA 4QP8A 2OXYA 4DHIB 3PXYA 5BVKA 4LRJA 4EHGA 2OJIA 3GCSA 4MEDA 5JZNA 3NUNA 5LWMA 3BL7A 2G1TA 5JQ8A 4ZTRA 3NYOA 3QQKA 3VS3A 3DBQA 4TTHB 4AN9A 5KMLA 2YHVA 4BCKA 2CKEA 4O7WA 3GCPA 3IW4A 4P4CA 3ZO1A 3QTRA 3C51A 4CT1A 3TTJA 3IW7A 2JKQA 4Q2AA 3VS4A 5CENA 4FG9A 3OT8A 4PX6A 4BBEA 5DT4A 2IVSA 1PXNA 3ORXA 4GT4A 5L8JA 3KXXA 4QMTA 3TIYA 2PVLA 4DHFA 2OFVA 2OWBA 4D5KA 1ZY5A 4U97A 3MIYA 2LGCA 3QCSA 4ITJA 4JAJA 4OR5A 3RINA 3LXPA 3UIXA 3UG2A 4AXFA 1OL7A 5ICPA 4C4JA 1PHKA 1YVJA 2KULA 4J8NA 1OITA 3QTZA 3AT2A 2E9PA 3D2IA 3RAHA 5GIOE 2NYAA 1OIQA 2V0DA 4Y95A 1JQHA 2BCJA 2RF9A 3HV4A 4EUUA 3EN6A 3UNKA 5JFVA 3ZTXA 3NVKI 3NUUA 4IZYA 4MXXA 3RP9A 2BZIB 5ANEA 2GSFA 3VC4A 4ZOGA 3GOKA 3E63A 3D5UA 3KREA 4QPSA 3POOA 3U4WA 1XMLA 3NDMA 5LWNA 2B9HA 2XJ0A 3QLFA 5AM7A 2REIA 2UZUE 2Z7SA 2R3NA 2WEIA 3KK8A 2YISA 3O0GA 4GU6A 3I6UA 4AN3A 4F7NA 4LMUA 4KSQA 4AUAA 4F7LA 5TT7A 1K9AA 1O6LA 1YI4A 2Z02A 3H30A 3HYHA 2CKPA 3LM5A 4TXCA 1IRKA 1H0VA 4QTDA 5GHVA 3VVHA 5I9WA 3VIDA 4DT8A 3KFAA 3CIKA 3DGKA 4FTUA 2XIYA 5IISA 4GJ2A 3LHJA 5FLFA 2VO0A 3KF4A 3GU4A 3ZFMA 1H8FA 3TKHA 1QL6A 5FUTA 4LUDA 4ITIA 4UN0C 2W1FA 5CTPA 4A9RA 1WMKA 2BKZA 4UWCA 3TNHA 4NJ3A 1TVOA 5EKOA 1SVHA 3AGMA 3BU6A 3C13A 5KZ0A 2OKRA 4UWYA 4A4LA 2J0KA 3SG8A 4LGGA 2VWYA 3MXWA 2C6LA 4FEUA 1YXSA 3AC3A 5HBEA 4KIPA 3O8TA 4W4YA 4BZNA 3BEAA 4P90A 5GINE 2ZDTA 3W0OA 4J7BA 3VULA 5L2SA 5GIPE 4E4MA 4BY9E 3C5IA 4O0YA 3VUMA 4BDBA 2O65A 3P08A 4DG3E 4E5WA 5BNJA 2G01A 3VW8A 4LL5A 5A4TA 3U6JA 1Y8YA 3H3CA 4O0VA 4IFGA 3OZ6A 4KRCA 1YXUA 2ZM3A 3BHTA 3TMOA 4L8MA 5JMSA 3G6HA 3UE4A 3BZ3A 3UGCA 2I7QA 4XLIA 1LUFA 3TKUA 3CD3A 2FH9A 5HE3A 3QHRA 5AUTA 3JY0A 3PUPA 3D5WA 1Q62A 3F2NA 2H8HA 4PMPA 2JDOA 1E1XA 5CEOA 2BR1A 3D7TA 3F3VA 2YDIA 2BTRA 4A07A 4CZUA 3QBNA 3W32A 5DE2A 4ZTLA 2W05A 3BRBA 2PTKA 4QQCA 4RFMA 1B38A 3KQ7A 2C0IA 4MBLA 4MCVA 2PZIA 3CR0A 3MY1A 2HENA 3PPZA 4BBMA 1L8TA 4EWQA 4MBJA 3R6XA 3RALA 3KRLA 2VWIA 2QOOA 3OD6X 4ZP5A 3UBDA 2LAVA 3G6GA 3W33A 3N4UA 3C0HA 2XYNA 3R9HA 2GQGA 3OP5A 3GXLA 5BUEA 4Y85A 4IE9A 1YQJA 2WOUA 3F3WA 5CI6A 3IQ7A 4G3EA 2ITNA 2VN9A 2CHLA 3KC3A 4FT7A 5M07A 5IA1A 5EM5A 5ITAA 2Z7RA 4YSMA 1FMOE 2YM5A 3NUYA 3DKCA 3AKKA 2ITPA 4OTWA 4FEWA 4OUCA 5JQ5A 1ZRZA 2V62A 3Q9WA 2JDTA 1H25A 3RHKA 3NSZA 3OY1A 3LM0A 2R3HA 3R2YA 3TV6A 4F6WA 3E7VA 3FEGA 2OICA 3RM7A 4EBWA 4NYEA 4ZEGA 3NUXA 5HE0A 3UDZA 1IR3A 3FAAA 3QZIA 3ACKA 4EOMA 1U54A 2PVJA 3HAMA 4KKHA 4D0WA 1VLRA 2BRHA 3MH0A 5D7VA 3O96A 4K2RA 4L7SA 4FA2A 3WARA 1UU8A 5E1EA 3E92A 2W5HA 4WNKA 1GIHA 1KSWA 2YA9A 2JIVA 2O2UA 2V5QA 3EQRA 4I0TA 5CVGA 1BL6A 1BYGA 3O51A 5IA3A 2B1PA 4ACMA 5IDPA 3HP2A 2XKFA 4XG6A 5CX9A 4D4YA 1SZ7A 4LRMA 3MTLA 3DQWA 5BMMA 1ZYJA 4FKLA 1Q97A 3GC8A 3RHXA 4FIJA 5CEKA 2GS2A 4KIQA 2X7OA 5KHXA 3FMKA 3FZTA 4FT3A 2VRXA 4G2FA 1J1CA 4BYJA 5E8TA 4UB7A 5J1WA 4A06A 1NVSA 3DY7A 3OCSA 2O63A 5T68A 4ENXA 4FV5A 3MW1A 4FTCA 4FI1A 4CTBA 4I1ZA 4QMWA 3RCJA 3W0QA 2VX1A 3CKWA 3DBDA 4TYHA 3EIDA 5EFQA 4YJPA 3TZ8A 1AQ1A 5EM7A 4AGUA 4DBXA 5FD2A 4DH5A 4GFGA 1OKYA 4Y5HA 3KXMA 4KBAA 4FSRA 3C50A 3TDWA 2WTJA 4R77A 2UW3A 3GI3A 5HE2A 1REKA 3FMNA 3ORZA 5DWRA 4IDVA 3DJ7A 4F0GA 4FIFA 3VW6A 3COHA 4XCUA 4MXCA 3MFTA 4EH6A 4PL5A 4CKRA 2PVHA 3KN5A 3OF0A 2WMSA 5C8NA 4ORKA 2RIOA 4IFCA 2OF4A 4QQ5A 1YXVA 3QYZA 2YEXA 2QVSE 2ZV2A 4AAYA 3VBXA 3S2PA 5F1ZA 2YERA 3H0ZA 2WTCA 3FLSA 1KV2A 3RPVA 2PWLA 5LMKC 3G9NA 3GQLA 4IB3A 4MX9A 3GCVA 2B4SB 3VBYA 4BF2A 4CFWA 4E8AA 3W0SA 3UP7A 4ALWA 1XBAA 3E8EA 3LCDA 4MXZA 3A7GA 1V0PA 4AXEA 2HCKA 3A61A 4TYIA 1VEBA 1WC9A 4G1WA 1BX6A 5FBNC 2WD1A 4Q9SA 5BVFA 4EONA 2A2AA 4FGBA 4WG5A 5GJFA 5HBHA 4BDFA 2YM6A 4JXFA 1LEWA 1JVPP 2FSLX 3DS6A 3EN4A 3EFJA 3TEIA 4ZJIA 3MIAA 3TCPA 4C4IA 1XMMA 4ZSLA 4EEVA 3EQGA 2VTQA 4II5A 3F2RA 4IM0A 1H07A 2QOKA 4N70A 4FKJA 2OXDA 3DNEA 2W1GA 2X1NA 3JPVA 3NVMB 3P9JA 3VBQA 3QQLA 1Y91A 3LFDA 3FZPA 3T8OA 1YDSE 3GCUA 4P2KA 4L3LA 4YPDA 2VWZA 4OX5A 3RK5A 4PP9A 2C3JA 4CKJA 4HCTA 4O83A 3FKLA 4N6YA 4EC8A 3R30A 5JT2A 3QRTA 3SXFA 3ZCLA 4TYHB 3WF7A 2RFNA 3A7HA 3V5LA 3CY2A 4BI1A 2IG7A 3IGGA 5M09A 5M51A 4DEGA 4E6DA 4LG4A 3EL7A 1R0PA 3Q2JA 4FKUA 5EG3A 4J1RA 5IH5A 1LR4A 1ATPE 2FSTX 2GNIA 1Q8YA 3DPKA 2XAMA 5A3XA 2BAQA 4EKLA 5CSPA 3PYYA 4JIAA 3MWUA 1JPAA 3QTUA 4J71A 2UUEA 4E4XA 4QEBA 5AUVA 2O3PA 3BU3A 3CY3A 4R1YA 4AW5A 2C0JA 1VR2A 4FTMA 4M13A 4NKSA 4IWOA 5E8VA 2I0HA 3VS6A 4BYIA 5EW3A 4UXQA 5E9EA 4EUTA 3VAPA 4JT3A 3CJFA 1JAMA 5CEPA 3FLYA 3U6IA 3IGOA 5CU3A 3QD0A 1XH8A 4FSQA 3QFVA 5I9ZA 5FRIA 1O6YA 3PXFA 4IM2A 1URCA 4L53A 3FI2A 5EHOA 1OKVA 3WOWA 1T45A 3CD8A 3MY0A 4GUEA 3ZFYA 4LV7A 4CMOA 5BMSA 3UZTA 4MK0A 5KKRC 1YXTA 3R8MA 2FUMA 3S95A 5I9UA 2A1AB 4UEUA 4EQCA 2CN5A 1I09A 2P3GX 4QO9A 1L3RE 4XG9A 4XP0A 5HX6A 4O6EA 2I40A 3QU0A 4M97A 4RA5A 4XV1A 4CRLA 3COKA 3EQIA 3O5AA 3Q32A 5ACKA 2VV9A 3W0NA 2VX0A 5KMNA 2O64A 2UZBA 2EXMA 4JBPA 3W2PA 4ENYA 5AV4A 2OXXA 3E88A 4QOXA 4NT4A 4JG7A 2J0LA 3GU5A 3PPKA 4GFOA 3TNIA 5IA5A 2E2BA 3HMMA 4FUYA 3BL9A 3AMYA 2QOQA 1TFFA 5HKMA 4YNEA 4BGQA 4HYHA 1M7NA 4FEQA 4O7YA 1UNGA 4A7CA 1G8AA 4HVSA 4FTIA 2WELA 2IW6A 3H9OA 3AKJA 5AUXA 4QQJA 3UDBA 2HW7A 1YHWA 2YDKA 1ZYDA 2W0JA 4RPVA 5H8BA 4E20A 4H05A 4QP3A 4EOIA 1UU7A 1K2PA 4WG3A 4IVBA 3MPMA 5EI6A 4ZTQA 4EL9A 3OFMA 4IBMA 3M11A 3F3UA 3CTHA 4NUSA 1NVRA 3P79A 3P4KA 4PV0A 4QMUA 3NYNA 4FZ6A 3OXTA 1H01A 4FSWA 4W4XA 5HNIX 2C6DA 4HZSA 3NNUA 2FO0A 5EDQA 3QD4A 5KMOA 2CSNA 4YBJA 4JIDA 4OTDA 3UTOA 2YM3A 2BPMA 3EWHA 5CF6A 2JLDA 2YIYA 4JR3A 4KRDA 3TTIA 5ANIA 4FNYA 4JNWA 4FTAA 3LKMA 1UKIA 3QZHA 4Z16A 2BDJA 4FKVA 1QPDA 3VN9A 4L52A 1U54B 1FOTA 4XG3A 3TM0A 3DQXA 1F0QA 3N51A 3R28A 4BDKA 4HGLA 5F4NA 1ZMUA 2PE0A 3G51A 2X8IA 3PXRA 4YZBA 2I0VA 3GUBA 5AIKA 5DG5A 5IA2A 4X2GA 4DT9A 3TZ7A 5HNBA 3ULIA 1KOAA 2W4JA 3JY9A 5AP3A 4AF3A 4G6OA 3MVLA 4NTTA 1UU3A 4LM5A 3ZO2A 4AWIA 1OI9A 3D14A 4YTIA 2OBJA 4EOSA 4PDSA 2UZWE 4L42A 3UVRA 1Z57A 4OTQA 4F7JA 1U5QA 1WVYA 1YHSA 2QQ7A 4DFBA 2ACXA 3GU6A 5D10A 3PY3A 4YSJA 5CANA 2J5FA 2UZOA 5B2MA 3GQIA 4NCTA 4WO5A 3UZPA 4TWOA 4EOQA 3FBVA 3IW5A 4IC7A 3D2KA 3ET7A 4G3DA 3P0MA 1CM8A 3ODYX 2R3JA 4ZTHA 2BVAA 3VS2A 3OROA 4RC2A 4BDJA 2R3IA 2ITUA 3A62A 3GVUA 4HCUA 3BYOA 3W16A 4MKCA 5C8KA 4O21A 4FZDB 2OJGA 4DH8A 2RG6A 3LXKA 3NYXA 5ANJA 3RM6A 2YITA 3BHVA 4DTKA 2IWIA 5IUGA 3LFCA 3PP1A 4AGDA 2XBAA 4HJOA 5EKNA 2WGJA 3VS7A 3R7VA 1H4LA 5DEWA 3OTVA 4BTJA 3TKIA 1Z9XA 2IO6A 5IQCA 3VUKA 2JEDA 3RK7A 4PTGA 5F94A 4D5HA 4L44A 4R7IA 5JRQA 2W1IA 2PU8A 3DB6A 3QGWA 3QZFA 5BVOA 4ZSGA 3U8WA 3OT3A 5I9VA 5L3AA 5H8GA 3O8PA 4HCVA 4ANBA 3SLSA 3COMA 2WAJA 2YCSA 4IWPA 4JBQA 4B4LA 1XBBA 4NM0A 5CQWA 1U59A 2ZM1A 2XK4A 1G3NA 3E3BX 4I21A 4JIKA 4NM5A 1R78A 4FV7A 2R64A 3FI3A 3DJ6A 3EKNA 3O50A 4GH2A 2QONA 3F5XA 5HI2A 4FKQA 1YWRA 2X6EA 3RNYA 5AP5A 5HQ0A 1Q61A 2QI8A 2XA4A 4YTHA 4BBFA 4FE2A 4GS6A 1WAKA 4RJ8A 1H1RA 2R3OA 3HO5H 2R3FA 3EHAA 2CLQA 3M1NA 4DCEA 5E8UA 2UZVA 1ZOGA 2FSMX 2BRMA 2X2KA 4BDDA 3ZM4A 1BUHA 1MP8A 4YTFA 2RL5A 5FXRA 4GL9A 3PXZA 3D15A 2WTWA 4S33A 1FGIA 2VTRA 3DAKA 3PY1A 5CXZA 5LMKA 5DGZA 4ZY4A 3ZZEA 4IEBA 2Y9QA 3KRJA 1F5QA 2VWXA 4XMOA 4RC3A 2PVMA 1ZLTA 4QTBA 4AS0A 1IA8A 2HZ4A 3QKMA 4WNOA 3Q5IA 5BVEA 4L9IA 2WTVA 5D9HA 4UX9A
chains in the Genus database with same CATH topology
2G2IA 3FQHA 4AT5A 5B2KA 2F57A 5B2LA 3F2AA 5DVRA 3ZU7A 3VWAA 5C8MA 4YJSA 1AGWA 3EQDA 3W18A 4HVDA 4ZLYA 3JVSA 4ZS4A 4L6QA 3FJQE 2WOTA 2XK6A 4IJ9A 1OPKA 4IJPA 3EFWA 4USEA 4O0WA 3V6RA 2PE2A 3PIYA 4C4FA 3A99A 3R8VA 1RDQE 3T9IA 4C38A 3SX9A 1MQBA 4RQVA 2Y4IC 4N0SA 2E9VA 2O5KA 4L67A 2Z7QA 3BGZA 4H3PA 3LJ0A 4XEYA 5IEXA 5KNJA 3FDNA 3PVBA 2XCKA 4F0IA 2XKCA 3EOCA 2PZYA 3OBJA 4FSUA 2DS1A 1SVEA 4CFMA 3GT8A 1Q3DA 4EYJA 4U7ZA 2R0IA 5CU4A 4DGGA 3PLSA 5JFXA 4O7RA 4G6NA 2CN8A 2QG5A 3GB2A 3JVRA 4QRCA 2C3KA 3BYUA 3WIGA 3KA0A 2RFSA 3FMLA 3NW5A 3QCYA 3EZVA 1KOBA 2XARA 2HZNA 3HKOA 3R0TA 1XH9A 5C9CA 5M06A 3PWDA 1B39A 4RJ5A 3ZRMA 4TZRA 5E1SA 3K7GB 1M2QA 2PZ5A 2ITTA 3QX2A 1IAHA 3VS1A 3W2QA 3LCOA 2W5AA 2C5VA 4JMQA 4XYFA 4DEDA 4ZSAA 2YIXA 3PP0A 2F4JA 2R4BA 5BUJA 4NT9A 4I0SA 5AV3A 3WZEA 2W1HA 4I6HA 3UMXA 4GYGA 4QTCA 3PE2A 3SHEA 4AT4A 4BDHA 3SDJA 3FXZA 3ORMA 5EYCA 3TT0A 1PKGA 3LCTA 5E90A 3TV7A 5CAUA 4KS7A 4RVMA 3ERKA 4WUAA 4RG0A 4LI5A 3CQUA 3UQCA 4HYIA 3RPYA 1CDKA 3IW6A 3N1RA 2GNGA 3IG7A 2BRGA 3LCKA 4CLJA 3MB7A 5I9XA 2IW9A 2WFYA 4RLKA 4GCJA 1KWPA 3QQUA 2QNJA 2JKKA 3VBWA 1BMKA 3COIA 3ZXZA 2VTIA 3P78A 5HE1A 3GU7A 4JG6A 3ZDIA 5KUPA 5LVOA 4WNMA 3FQSA 5EI8A 3WBLA 4AE9A 1RQQA 1APME 2XNOA 1Y6BA 4AT3A 3HRFA 3CTJA 2OSCA 3W2OA 3JXWA 5A9UA 3QYWA 4EZ5A 3P7BA 2R3RA 3ATSA 3S4QA 3GCQA 1OZ1A 4O0SA 2XRUA 4CFXA 1YHVA 4FNXA 3NAXA 4BHNA 5CU0A 5C4LA 1GZKA 1ZMVA 3T9TA 3MFUA 2EWAA 4JAIA 2PUPA 3LQ5A 4JR7A 4FZAB 2CJMA 2AYPA 4GSBA 4IAKA 4AGCA 4MQ1A 4YO6A 2F7ZE 3F3TA 3MH3A 4M0YA 4O38A 3V8WA 4BDCA 4K0YA 2OJFE 2WMAA 2WQEA 5CU2A 5AUYA 4EQUA 4O2ZA 4QMQA 4EBVA 3S0OA 2QOLA 3CQEA 4O22A 3PVGA 5I0BA 2ETKA 4O0TA 1SZMA 2ITOA 2XCHA 3C7QA 3W10A 2W1EA 4QP1A 3NYVA 2CGVA 4Y83A 2QR8A 3DAEA 3NX8A 4FKSA 3E5AA 4NM7A 3BU5A 1P4FA 4NJDA 4QMVA 2PVFA 3B8RA 4DF3A 1FGKA 5CYIA 3UNJA 4BICA 3KMUA 1M52A 3FLWA 4R7HA 4D9UA 2VNWA 5FEQA 4J8MA 3B8QA 4XG2A 1YOLA 2PMNX 4J99A 1JOWB 2VTPA 3R71A 3PJ1A 4FG7A 5DR6A 1IG1A 4I41A 1H1WA 4D4SA 2YCRA 3T3VA 4NTSA 3G15A 1CKPA 5DYJA 4B6LA 4O6LA 4B8MA 3I5ZA 4BR3A 5J5SA 3SD0A 3R04A 2JITA 4KD1A 2UW7A 1Q8WA 3AKLA 5CAQA 4RWJA 1OVEA 5KO1A 4QT1A 2XNNA 1A06A 4DH1A 5EW9A 2BIYA 2BKKA 5FDXA 4JX3A 2JBOA 4JL9A 3BE9A 3FLZA 2QODA 1MRUA 3F61A 4F0FA 2X7FA 3I0OA 4JQ8A 5JEBA 1FVRA 2IZUA 4GK4A 3FLNC 2XYUA 3E8CA 1KE9A 1PYXA 2ZV8A 5H9BA 5HIDA 3WF8A 2C68A 4F65A 4MUQA 3BGQA 4X2NA 4MWHA 3ODZX 4C33A 5C26A 4EH9A 2XJ1A 5K9IA 4JBOA 4PY1A 2JKMA 4K18A 4I0RA 3UC4A 3C1XA 4FOCA 4KKGA 2I0YA 1W8CA 2GFSA 4I5HA 2QOCA 4JDHA 4MD9E 4BCIA 4BIDA 3AD5A 2VTHA 5CNNA 3WE8A 3CLYA 1IASA 3LVPA 3ANQA 3LLTA 3CGFA 4IX5A 5F20A 4O7ZA 5HORA 5KZIA 5HU3A 3VUGA 4YJVA 5ETIA 1WBTA 3I5NA 4CLIA 3DOGA 3LMIA 4DFNA 3ZO3A 1STCE 3GFEA 5CZIA 2JFMA 4FT0A 1JKTA 2ITWA 4LMNA 3I6WA 2R3GA 4BCMA 4IVCA 2J50A 2GHMA 2JAMA 2OH0E 4FODA 4FV0A 4QMMA 4XLVA 4Q9ZA 5CVFA 1RJBA 2BUJA 3B2WA 5DR9A 4OW8A 2JGZA 3C4FA 3OOMA 4PDPA 3QLGA 2QOBA 4EZ7A 4UZDA 2BAKA 1FQ1B 3QRUA 2XS0A 5IEYA 2ZYBA 3DV3A 3LFFA 5CXHA 4BCGA 5IQFA 3DK7A 2XIZA 3R8UA 3DBCA 4IZAA 4APCA 3A60A 3OWLA 4GJ3A 1PW2A 1SM2A 4R3RA 1SYKA 3FMMA 2UW4A 4GV1A 4AXCA 2UW5A 3ULZA 2X9FA 3MDYA 4B8LA 2ITVA 3IONA 1Q41A 4RRVA 2OJJA 1PXMA 4FYOA 5K5NA 5L2IA 4FNWA 3NIZA 4ZTNA 4ZLZA 4QYYA 3RGFA 2OK1A 5CAVA 2OF2A 4QMZA 2E9NA 2EXCX 3P7CA 2UVZA 4GG5A 4U43A 4PWNA 4RVKA 2B54A 3H4JA 4E26A 4LFIA 1Q3WA 3AG9A 5AA9A 1YI6A 1ST0A 3MESA 5L2TA 1R39A 5C1QB 5AV2A 3Q4TA 3SW4A 5K4JA 4ZZOA 3UPZA 3W0PA 1WFCA 4TYJA 3P23A 5LARA 3HL7A 3WILA 1JSVA 3F7ZA 1XO2B 5I9YA 4BJJA 5IUHA 3F5PA 5D11A 3A7FA 5HZNA 4EZ3A 1NY3A 3II5A 4TYGA 2B52A 2A19B 3C0GA 3VNTA 2ITYA 3BYVA 3UDTA 2PZPA 2ZV9A 3AD4A 4IDTA 2CKOA 4FKTA 4O7LA 3OC1A 5ETAA 2ERZE 4TYEA 5M4IA 3Q3BA 4WBBB 4AN2A 4TW9A 5DEYA 3BIZA 3AGLA 4WRGA 3DFCB 3KL8A 2WO6A 4D4RA 5JKGA 3CQWA 2Y4IB 3OS3A 2OZOA 2E9OA 2CKQA 3FQEA 4DDGA 3HRBA 5FTOA 2OZAB 3CGOA 4U3YA 3WI6A 3U54A 4CV9A 2WTKB 4F9WA 5JK3A 5BYZA 1UVRA 4I6FA 4OBOA 1KE7A 4IVDA 4RJ6A 4EOOA 4ARKA 4Z55A 1R0EA 3THBA 4F1OA 1PXOA 5CSWA 3ZZWA 3WYXA 3PG1A 4UWBA 3VUIA 2Z7LA 3F7WA 4I6LA 4HPTE 2PHKA 4EYMA 2VTNA 3DLSA 4O0UA 2PULA 1IEPA 4K1BA 1TQMA 4IX6A 3U6HA 1G5SA 3FMEA 4O7NA 3TUDA 1JNKA 1VJYA 2ZMCA 3MFSA 2NRYA 1YWNA 2Z8CA 3EKKA 3HGKA 4IB1A 2ITZA 4GRBA 3EQFA 4JDIA 4QMSA 2AEGA 4D1ZA 3N1FA 3Q6UA 2ZAZA 4X2JA 3RPRA 1BL7A 2H34A 4FGRA 3RWPA 4DFLA 1WBNA 4S34A 3LFEA 5HTCA 4USFA 3R02A 4M15A 3IDCA 4K11A 4C35A 1GIJA 5F95A 3FXXA 5IA0A 2C4GA 2F7XE 5M4UA 3N1PB 4O81A 5J9ZA 2JD5A 4O2PA 5D1JA 3FZRA 1OECA 3P7AA 3BEGA 4GK3A 2VGPA 3W2CA 4C3PA 4U80A 3RCDA 5J9LA 3Q04A 3CBLA 5TF9A 4C7TA 2VUWA 3R9DA 4BJJB 3LJ2A 4I4EA 1LEZA 3DXQA 3R7OA 4MHAA 2BZKB 4WBOA 3ZYAA 3BLHA 4OTRA 4F64A 4FTTA 2BHEA 3KN6A 4EOJA 3SW7A 3PSCA 4BGGA 2JBPA 3R8LA 3EFLA 4U40A 2W5BA 3L8XA 4LYNA 5CLPA 4RIXA 4EJ7A 4F09A 3ZUTA 1KE5A 2ZV7A 3FMJA 4RWIA 3ZMMA 3FXWA 3ZRKA 1OIUA 1OIYA 3AC8A 3UOHA 3UO5A 4C02A 4C58A 4F08A 3NCGA 4F99A 4CG9A 4RIYA 3LW0A 2GNLA 1IA9A 3HMNA 2PUNA 3IECA 4TNDA 4L3JA 4DTBA 4GIHA 4KUJA 2C3IB 5CSVA 5IU2A 4RIOA 4EOKA 1ZZLA 2J0IA 3ZLYA 4G3FA 3FPQA 3QC4A 4CCBA 1ND4A 1M14A 2J0MB 3DBEA 3ZFXA 4FC0A 3GOPA 4FV4A 1CTPE 5D41A 3K3JA 3Q53A 5IQEA 2B9JA 3CTQA 3G5DA 3TDVA 4E6AA 3DFAA 3R73A 2NP8A 4XS2A 1PXIA 3RAKA 3AMAA 1S9JA 5HVKA 3K7JB 2GDOA 5HO8A 4KA3A 1OB3A 3LFSA 4OTFA 2IVUA 3R9NA 4S2ZA 2WXVA 3PPJA 3ORLA 2OG8A 4KSPA 4D2SA 3LZBA 4CV8A 3ORIA 3AC5A 4NW5A 4YO4A 4BCNA 2CNVA 2JC6A 5M4FA 3AT4A 4E4LA 1WZYA 5HTBA 2FB8A 1YDRE 4U44A 5HGIA 3C4XA 1CKJA 1DI9A 3KCKA 4MXAA 4QTAA 5CSHA 3FY0A 3TJDA 3V01A 1JKKA 5AADA 3N1GA 4I5CA 4CFVA 2VZ6A 4AA5A 4F78A 5FGKA 3V5JA 1H28A 3KCFA 3OW4A 4H58A 5DFPA 3RTPA 2HY81 4OTGA 5CZHA 3VQUA 4DGNA 4GVAA 2O8YA 1X8BA 1W82A 3D83A 3DLZA 4QYEA 4BTKA 2WMBA 5HVJA 5IQDA 4ZSEA 3Q9YA 2FYSA 2XAOA 3F5GA 3ID6C 3E93A 4O96A 4JS8A 3Q5ZA 2C6OA 1H1SA 3IOKA 5CWZA 4ZIMA 5T6KA 4J53A 1OL5A 4GKIA 3KXGA 4C59A 2ZJWA 4DFXE 2QOHA 4K6ZA 2ETRA 5AUUA 1ZAOA 5IPJA 1PMVA 4N4SA 5ANOA 3UC3A 3ROYA 2Z2WA 4DTAA 4BZDA 4RJ4A 4GK2A 2XM9A 2VWWA 4MNFA 3VS5A 5IZFA 4CT2A 5C27A 4E7WA 4I23A 2YWVA 2C30A 1DS5A 3ZC5A 5CF5A 3IW8A 3PFQA 1QPJA 4MUTA 2I1MA 3LMGA 3V3VA 1OGYA 4W4WA 1OL6A 1JBPE 4BTMA 3QCXA 3PJ2A 4Y46A 3VHKA 5JH6A 5HD7A 3NIEA 1UWHA 4U42A 5AAFA 4W8DA 2NO3A 4WUNA 1OPLA 4Z7HA 1WBSA 4C4NA 3ZSGA 4Y5QA 5DPVA 5DRDA 1QCFA 4FSMA 4AAAA 3MGYA 4S32A 4XHKB 3UOKA 3FC2A 4KB8A 3PXQA 2IW8A 4BDEA 2GU8A 4ALUA 5HG7A 5CNOA 3FYKX 4DHZA 4N6ZA 4FSNA 3ZLWA 2WB8A 4G5JA 5CQUA 1TKIA 2GQSA 1V0OA 5KX8A 3UYTA 1SMHA 5FP5A 2C6IA 4D2RA 3D5VA 2HXQA 1WBOA 5CF8A 4EH7A 3S00A 3KXNA 4KNBA 2OIBA 3JR1A 3R9OA 4BI2A 2YZLA 2BZJA 3HMPA 4PL4A 2UZLA 4HGTA 5AA8A 5IMXA 1PYEA 4MBIA 3W0RA 3QUDA 2GHLA 4QDEA 3Q60A 4DGLC 3U51A 4AQKA 5LOHA 1R44A 3DZOA 4QP4A 3M2WA 3TN8A 4EK4A 3DJ5A 4ZLOA 2QLQA 1PJKA 2VTSA 4G3GA 4CGAA 3NUAA 5IUIA 2WMWA 4FIIA 2WMTA 4GT5A 3F6XA 3S1HA 5IF1A 4R6VA 2C1AA 2J7TA 4I5PA 4ZSJA 4EHZA 5ETCA 4NFNA 2XK3A 4Y73A 4RT7A 3UQGA 4MXYA 1A9UA 2YACA 4HGSA 4BRXA 4CEGA 5BVDA 4G16A 4IB0A 4XX9A 5DR2A 5LVPA 5E8WA 1ZOHA 4MUSA 5CSXA 5IQAA 5HCYA 4IAZA 1H1QA 3BYMA 2QOIA 3R7EA 3BBWA 2ZOQA 3IS5A 1ERKA 5AEPA 2VU3A 3OUNB 4S30A 1LPUA 2BRNA 2QHMA 1PY5A 3BE2A 5KMKA 3E87A 4QMNA 3GU8A 3E8NA 3TV4A 4R5YA 2B53A 3O23A 1SVGA 3KEXA 4AXDA 3N9XA 2PYWA 3K5UA 4NH1A 5EYMA 4OBQA 4OT5A 5L6OA 1RE8A 3E62A 3GGFA 4GMYA 4LOOA 4YHJA 3SC1A 3QGYA 4ACCA 3DT1A 4JLCA 2WQOA 4UYAA 5IEVA 2X8DA 4TY1A 2QO2A 3HLLA 3IO7A 3OXZA 5IH4A 2R3KA 2X7GA 1PRYA 3FZOA 2PMOX 2XANA 3LFQA 3O17A 3Q4UA 4BI0A 2WFRA 3WZKA 4I5MA 4XRLA 2XK8A 3WYYA 2GCDA 1Q5KA 1J7UA 3FWQA 4LGHA 4WT6A 5A4QA 5AMNA 5HIEA 4L45A 4PUZA 3SXRA 3ZEPA 2F2CB 4IACA 3NGAA 3R2BA 4FICA 2VWVA 1YWVA 2CMWA 4H36A 2C6EA 4MVFA 4JQ7A 1YRPA 2X4FA 4RZVA 4QMXA 4XV9A 1SNUA 3N1OA 4AZSA 4KAOA 1O9UA 3OCTA 3ML1A 3EL8A 2JDRA 2VTJA 5A14A 1AD5A 4X6RA 4IHPA 4IX4A 2XJ2A 4ANQA 3KGAA 4W4VA 4FOBA 3QRJA 1WBPA 2X9EA 4GYIA 4RC4A 2J2IB 2XRWA 3HNGA 5FDPA 5LVLA 1PF8A 5DHJA 1YDTE 4FVPA 3IDPA 3BV3A 2UZDA 4QMPA 2Y7JA 3LQ3A 4TPTA 4XRJA 1IAJA 3D1MA 2ITQA 3OMVA 3T3UA 2XK7A 3AD6A 3MPTA 2OH4A 2QKRA 3PZHA 4RFYA 4M0ZA 4R3PA 4ANMA 5AP4A 2HAKA 3K7HB 2A4LA 2FSOX 3WE4A 3DBFA 3LLAA 3CE3A 4JJRA 3F9NA 3AC1A 5JFSA 3U4UA 3TWJA 3FI4A 4ZJJA 2RKUA 1OPJA 3RAIA 3DXPA 3TL8A 4O91A 4EOLA 3OXIA 5C03A 4KBKA 3UO6A 5BYYA 4FX3A 2WMUA 3POZA 2J51A 5AP0A 4ANLA 3UQFA 4FUXA 4IANA 2WG3A 1DAYA 2WQMA 5HX8A 4QP6A 2V55A 3TI1A 1H24A 2RFEA 3CEKA 4FK3A 4B0GA 5BPYA 4KWPA 2Q0BA 3K54A 4U5JA 3UIMA 1QPEA 3BHUA 3MN3A 5A4EA 4FTOA 3TIZA 5M44A 3ORNA 4OX3A 4O0RA 4L3PA 3RK9A 2DUVA 4FIGA 3HUCA 2EB3A 3ITZA 4X3FA 5FXSA 5EQPA 2J9MA 3V8TA 3GNIB 1MRVA 3UP2A 5IDNA 4WHZA 4CSVA 1P2AA 3BGPA 4J52A 4ZZMA 3MV5A 4FR4A 4QQTA 1PXKA 4DG2E 3U87A 3AC2A 2UW9A 3R01A 4H1MA 2QU5A 2YAKA 3DZQA 3Q52A 4I6BA 4WSYA 4H3BA 5FM3A 4PP7A 2G9XA 2W99B 2XZSA 4PL3A 3WIKA 4RA4A 4UALA 4YZNA 4XP2A 4EQMA 4BN1A 2ETMA 1HOWA 2GNJA 3FMDA 3A4OX 3ALNA 5AV0A 2C5OA 2HWOA 3WZDA 3QRKA 4CFFA 2IN6A 2XEYA 5LVMA 3MFRA 5CVHA 1SNXA 2OJ9A 1NVQA 1ZXEA 4IAFA 4QYGA 2V7OA 5BX0A 4C4HA 5KBRA 4BC6A 4C3RA 4HW7A 4FKRA 4FTJA 2CPKE 2WTIA 5TOZA 1UNHA 4V05A 4EH8A 2W4OA 2XM8A 4KBCA 1JKSA 1I44A 4YLJA 1Q99A 2PPQA 3FMHA 3OEZA 4QNAA 5EI2A 3HEGA 3FV8A 4IZ7A 4FIHA 4JDJA 4LUEA 5IQBA 2X8EA 3CJGA 3DDPA 4C0TA 3D5XA 3CS9A 3AQVA 1GNGA 1ZYCA 3QTXA 4FZFB 3O7LB 1XR1A 4YP8A 3KVWA 3DXNA 3KRWA 3MY5A 4IAYA 4X3FC 2WZJA 5AAEA 4XG7A 3MYGA 3NZ0A 2BZHB 3HX4A 5L6PA 4C37A 3TJCA 3FZ1A 3ANRA 4AZFA 2Y8OA 3CCNA 3RNIA 4F6SA 2BALA 4O86A 5LMBA 2XH5A 1J7LA 5EQEA 1GOLA 4ASXA 5HG5A 1J1BA 3Q9ZA 4WA9A 5CAPA 5J9YA 4RMZA 4MNEB 3R1YA 3W8LA 4DHJA 2W1DA 5EK7A 4BKJA 4G9CA 4FVQA 4LDTA 4IQ6A 3N1QA 4A4OA 5FQDC 4M12A 4X0MA 3PY0A 1UKHA 1XH5A 3KU2A 2C0TA 4ASZA 4C2WA 2CNQA 4AW0A 3FHRA 1XJDA 4IH8A 4PNIA 1PMNA 4USDA 2KTYA 4O7TA 5J95A 3RVGA 3PXKA 4F9BA 5CAOA 1F3MC 5CS6A 4DCAA 2QCSA 2XALA 3HAVA 1ZY4A 2C0OA 3QQJA 2XKEA 2Y4PA 4P5ZA 1XBCA 3HMOA 3GBZA 2UV2A 3Q6WA 5F9EA 2QD9A 3MBLA 2GFCA 4GT3A 3QTQA 4N57A 5AAGA 4YJQA 2PY3A 1O6KA 5ANKA 5K4IA 4I3ZA 3R21A 4ZTSA 2P55A 1KV1A 4HNFA 3R8ZA 5FEDA 3R7YA 3FL5A 2J5EA 3H10A 1GY3A 4NKAA 2WTKC 2VNYA 4UBAA 4FNZA 3LFNA 5IQHA 2DYLA 3EN9A 3VO3A 4EC9A 3G33A 4ERKA 5HG8A 2X39A 3F3ZA 3PA5A 2VTAA 2UZNA 2X2LA 5IQGA 4FIEA 4J97A 5IMEA 4FG8A 3IKAA 3QD3A 4QYHA 1G8KA 4AG8A 2J4ZA 5L8KA 4YZDA 5I5ZA 4U8ZA 4UV0A 5HNMA 4ANSA 1T46A 3DDQA 5H2UA 5A4LA 3KF7A 2GPHA 3AMBA 3R63A 3A4PA 4PRJA 4HZRA 4EK3A 5A6OA 4NZWB 3EYHA 3W0MA 4DH7A 3R7IA 3CKXA 4D9TA 3REPA 3KK9A 2X0GA 5J1VA 3PJ3A 3PVWA 2WU6A 3OWKA 1OBGA 2ZVAA 2HYYA 3QKKA 3PZEA 3L8VA 3D7TB 4E93A 2VO7A 3PVUA 3FKOA 1U10A 4I94A 4YPSA 3BWFA 4HOKA 3TNPC 3D0EA 4QP7A 4RVTA 4NM3A 2EB2A 5EDRA 4DN5A 4NFMA 4KKEA 3MA6A 4MWIA 3VBTA 2JIUA 3NPCA 4RWKA 4LQMA 1ST4A 1ZARA 1YKRA 4V0GB 2I6LA 3SAYA 5FEEA 4PNKA 3I60A 4DG0E 4PDOA 3F66A 5E92A 4FT9A 1VYWA 3ALOA 2VGOA 4QP2A 3UDSA 2VX3A 4TT7A 4FKIA 4M67A 1MQ4A 4TN6A 5TO8A 4D0YA 2VD5A 4CFUA 1LP4A 2IZSA 3QHWA 4TNBA 3QCQA 5CASA 5DNRA 3P86A 3WZJA 4JX7A 1NA7A 2BTSA 3FPMA 2XB7A 2UW8A 3AOXA 3C4WA 3EJ1A 3I0QA 3H0YA 5AJQA 4BTFA 4MH7A 4QMLA 5DN3A 2PVNA 3M42A 3KRXA 3TNQB 2F49A 3PRIA 4QPAA 3KIOC 2FGIA 1WBVA 3BX5A 1G8SA 4D1SA 3HMIA 4D4VA 2VWBA 2RGPA 2PMIA 5AFVA 4BDGA 1FPUA 5AP2A 4RX8A 2VTOA 5HLNA 3NLBA 1Q8ZA 1J3HA 3GENA 2P33A 5J87A 3VRZA 3TACA 4IB5A 4G31A 3V04A 2WKMA 3PA4A 2RFDA 1V1KA 4FSYA 4L00A 3BKBA 4MTAA 2XIKA 5C01A 2G2HA 4K33A 4O7VA 3VRYA 4A9YA 3N4TA 4ZZNA 3ZONA 3H9RA 3G9LX 4ERWA 3DK6A 4YLLA 5EYKA 4YTCA 5ANGA 3Q4ZA 2VO9A 2X6DA 2B7AA 1E9HA 1ZMWA 3E64A 2HZ0A 2C69A 3ZUUA 5DT3A 4Z7GA 4IWQA 5CU6A 3OUKA 1R3CA 4FJVA 5DIAA 4E73A 3DNDA 3ZHPC 3E3PA 4GU9A 2GTMA 2UZTA 4EH4A 3R8PA 4WD5A 2Q83A 4CZTA 4G9RA 4G34A 4ZY6A 2BRBA 2GTNA 4GUBA 5E4HA 4J95A 4I24A 5FP6A 4A9UA 3NAYA 4FV8A 3MA3A 3I7CA 2UW6A 3G90X 2IJMA 2ESMA 3PWYA 1OM1A 4OTHA 4BDIA 3EN5A 3R1NA 1Z5MA 5DT0A 1URWA 2JFLA 3EQPA 2C5NA 4L43A 3TUCA 2XNBA 4HPUE 3I81A 2Z60A 2R5TA 4ZTMA 5JFWA 4DINA 5JZJA 1DM2A 2PZRA 3ATTA 4BDAA 3U55A 3VF9A 4R1VA 4X21A 3ORPA 4IX3A 3QTIA 4EH5A 4FYNA 1MRYA 5M57A 2J0JA 4XBUA 3C9WA 2NNWB 3ENHA 1ZWSA 1TQPA 5EOLA 3A7JA 3NEWA 2PSQA 4IVAA 5DBXA 4O0XA 4BCQA 3DTCA 2WMQA 2IVTA 4YZ9A 3PE1A 3QL8A 4HNIA 4U79A 3E8DA 4ZMEA 2Y6MA 3GC7A 2ZB1A 4FK6A 4MQ2A 1OUKA 4CKIA 3VBVA 3ZEWA 3SG9A 3GFWA 1OGUA 3HVCA 4X7QA 3EMGA 1BI8A 2JAVA 1Y6AA 3F69A 1Q24A 2EU9A 4WOVA 3RKBA 2F2UA 2VWUA 3FUPA 1XH4A 4FVRA 2VAGA 3G0FA 3MI9A 4AZWA 4TWPA 3AXWA 2C5XA 4A9TA 3L8PA 3QC9A 2OI4X 2QO7A 4JI9A 1E1VA 5EOBA 4GW8A 2IZRA 4B99A 2PVKA 3V5QA 1OKWA 5AUZA 3TZMA 2AC5A 3NRMA 4DEIA 3MB6A 1UNLA 2G15A 1PMUA 2QC6A 3QD2B 3FL4A 4JVGA 3PLAE 2XP2A 4XP3A 2WU7A 3ZLXA 3NNWA 2XNPA 3UZRA 5M4CA 2R9SA 1H00A 4ACGA 4XOYA 3KRRA 5GJDA 3GP0A 1PMEA 4MNEA 4NK9A 3HRCA 1GZOA 3NFGB 4HVHA 5AX9A 4L01A 5HESA 2HZIA 3A8XA 3IOPA 3MJ1A 3Q4CA 4FBXA 4RBLA 3QALE 3BCEA 1JSUA 4C61A 3OG7A 4JG8A 2BDFA 3G2FA 3VS0A 4AA0A 4DEBA 1P5EA 4J98A 3VONA 4RX7A 3LXLA 5HD4A 2PVRA 2QLUA 2X2MA 4ACHA 4RVLA 5HCXA 4JBVA 3C0IA 4ZXTA 3VJOA 4E1ZA 1J91A 5ETFA 2HELA 3MJ2A 3BHHA 4BHZA 4R7BA 2YM7A 2B9FA 4LV8A 2PUIA 4IC8A 1H26A 3PSDA 3W8QA 3L9NA 1OIRA 1OUYA 3KY2A 4U0IA 4I6QA 5EM8A 3R83A 4E4NA 1KE8A 3OCGA 2RG5A 2A0CX 4PQNA 5HEZA 4DEEA 5LQFA 2C6TA 4MD7E 4F4PA 3ZUVA 5BVNA 2C5YA 2YFXA 5BQ0A 3OWPA 2C1BA 2YABA 5CEIA 3P5JC 2R0UA 4D0XA 5LCJA 4AW1A 2H6DA 4RIWA 3MH1A 1GIIA 5EM6A