1ZHVA

X-ray crystal structure protein atu0741 from agobacterium tumefaciens. northeast structural genomics consortium target atr8.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
APRIKLKILNGSYGIARLSASEAIPAWADGGGFVSITRTDDELSIVCLIDRIPQDVRVDPGWSCFKFQGPFAFDETGIVLSVISPLSTNGIGIFVVSTFDGDHLLVRSNDLEKTADLLANAGHSLLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein Atu071 from Agobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR8.
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein Atu0741
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 1zhvA00
3AB4A 2HMFA 3C20A 3C1MA 3AAWA 1ZVPA 2F06A 3AB2A 1ZHVA 3C1NA 3TVIA
chains in the Genus database with same CATH superfamily
2HMFA 3V8VA 3C20A 2F06A 1ZHVA 3TMAA 3LDUA 2C5SA 3TM5A 3TLJA 3C1MA 3K0BA 3AAWA 1ZVPA 3TVIA 3AB2A 4KR6A 3V97A 3AB4A 3TM4A 3LDGA 4KR9A 3C1NA 4KR7A
chains in the Genus database with same CATH topology
2HMFA 3V8VA 3C20A 2F06A 1ZHVA 3TMAA 3LDUA 2C5SA 3TM5A 3TLJA 3C1MA 3K0BA 3AAWA 1ZVPA 3TVIA 3AB2A 4KR6A 3V97A 3AB4A 3TM4A 3LDGA 4KR9A 3C1NA 4KR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB4 A;  2HMF A;  3C20 A;  3C1M A;  3AAW A;  1ZVP A;  2F06 A;  3AB2 A;  1ZHV A;  3C1N A;  3TVI A; 
#chains in the Genus database with same CATH topology
 2HMF A;  3V8V A;  3C20 A;  2F06 A;  1ZHV A;  3TMA A;  3LDU A;  2C5S A;  3TM5 A;  3TLJ A;  3C1M A;  3K0B A;  3AAW A;  1ZVP A;  3TVI A;  3AB2 A;  4KR6 A;  3V97 A;  3AB4 A;  3TM4 A;  3LDG A;  4KR9 A;  3C1N A;  4KR7 A; 
#chains in the Genus database with same CATH homology
 2HMF A;  3V8V A;  3C20 A;  2F06 A;  1ZHV A;  3TMA A;  3LDU A;  2C5S A;  3TM5 A;  3TLJ A;  3C1M A;  3K0B A;  3AAW A;  1ZVP A;  3TVI A;  3AB2 A;  4KR6 A;  3V97 A;  3AB4 A;  3TM4 A;  3LDG A;  4KR9 A;  3C1N A;  4KR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...