1ZHVA

X-ray crystal structure protein atu0741 from agobacterium tumefaciens. northeast structural genomics consortium target atr8.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
134
structure length
134
Chain Sequence
APRIKLKILNGSYGIARLSASEAIPAWADGGGFVSITRTDDELSIVCLIDRIPQDVRVDPGWSCFKFQGPFAFDETGIVLSVISPLSTNGIGIFVVSTFDGDHLLVRSNDLEKTADLLANAGHSLLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Atu0741
publication title Crystal structure of hypothetical protein Atu071 from Agobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR8.
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Structural genomics, unknown function
total genus 28
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2005-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 1zhvA00
1ZHVA 3AAWA 3C1MA 2HMFA 3TVIA 2F06A 3C1NA 3C20A 3AB4A 3AB2A 1ZVPA
chains in the Genus database with same CATH superfamily
3TMAA 3AAWA 3TLJA 3C20A 3TM4A 3AB2A 4KR9A 3TVIA 3LDUA 3V97A 1ZVPA 3LDGA 3V8VA 2HMFA 2F06A 3C1NA 1ZHVA 3C1MA 4KR6A 2C5SA 3K0BA 3TM5A 3AB4A 4KR7A
chains in the Genus database with same CATH topology
3TMAA 3AAWA 3TLJA 3C20A 3TM4A 3AB2A 4KR9A 3TVIA 3LDUA 3V97A 1ZVPA 3LDGA 3V8VA 2HMFA 2F06A 3C1NA 1ZHVA 3C1MA 4KR6A 2C5SA 3K0BA 3TM5A 3AB4A 4KR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHV A;  3AAW A;  3C1M A;  2HMF A;  3TVI A;  2F06 A;  3C1N A;  3C20 A;  3AB4 A;  3AB2 A;  1ZVP A; 
#chains in the Genus database with same CATH topology
 3TMA A;  3AAW A;  3TLJ A;  3C20 A;  3TM4 A;  3AB2 A;  4KR9 A;  3TVI A;  3LDU A;  3V97 A;  1ZVP A;  3LDG A;  3V8V A;  2HMF A;  2F06 A;  3C1N A;  1ZHV A;  3C1M A;  4KR6 A;  2C5S A;  3K0B A;  3TM5 A;  3AB4 A;  4KR7 A; 
#chains in the Genus database with same CATH homology
 3TMA A;  3AAW A;  3TLJ A;  3C20 A;  3TM4 A;  3AB2 A;  4KR9 A;  3TVI A;  3LDU A;  3V97 A;  1ZVP A;  3LDG A;  3V8V A;  2HMF A;  2F06 A;  3C1N A;  1ZHV A;  3C1M A;  4KR6 A;  2C5S A;  3K0B A;  3TM5 A;  3AB4 A;  4KR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...