3C1NA

Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
468
structure length
458
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAISEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Probable aspartokinase
total genus 146
structure length 458
sequence length 468
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c1nA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c1nA01
2F06A 2WE5A 3C1MA 3L86A 4AXSA 2A1FA 3AB4A 1ZVPA 3NWYA 3C1NA 2BNEA 2V4YA 2BTYA 2JI5A 3LL5A 2J5VA 1YBDA 2V5HA 4F6TB 2HMFA 4USJA 2WXBA 4AB7A 1OHAA 3WWMA 1GS5A 3AAWA 3LKKA 4NDRA 3K4OA 3D2PA 2BRXA 4Q1TA 4NDPB 2IJ9A 3D2MA 4F6TA 2BRIA 4OLCA 4KZTA 4NDOB 2J4KA 3D41A 3S6GA 2J4JA 4A7WA 3S6HA 4NDRB 2E9YA 2BNDA 2W21A 2AP9A 4I49A 2J5TA 3S6KA 2AKOA 3AB2A 3T7BA 3L76A 3WWNA 2WE4A 4A7XA 4JZ9A 2X2WA 2CDQA 3U6UA 2J0XA 1Z9DA 1OH9A 3K4YA 4NDPA 4JZ7A 3EK6A 2BNFA 3QUNA 3ZZHA 1OHBA 4NDQA 2J0WA 2JJ4A 2JJXA 3QUOA 3C20A 3B8GA 4NDQB 3TVIA 2J4LA 4NDOA 2RD5A 2R98A 1GSJA 3EK5A 1E19A 3QVFA 2VA1A 3QURA 2OGXB 3D40A 1B7BA 3ZZIA 1ZHVA 2R8VA 3K52A 3ZZFA 2BMUA 2OGXA 3ZZGA 3K56A 3LL9A 4JZ8A 3QVHA 3KZFA 2BUFA
chains in the Genus database with same CATH superfamily
2F06A 2WE5A 3C1MA 3L86A 4AXSA 2A1FA 3AB4A 1ZVPA 3NWYA 3C1NA 2BNEA 2V4YA 2BTYA 2JI5A 3LL5A 2J5VA 1YBDA 2V5HA 4F6TB 2HMFA 4USJA 2WXBA 4AB7A 1OHAA 3WWMA 1GS5A 3AAWA 3LKKA 4NDRA 3K4OA 3D2PA 2BRXA 4Q1TA 4NDPB 3V97A 2IJ9A 3D2MA 4F6TA 2BRIA 4OLCA 4KZTA 4NDOB 2C5SA 3TM4A 2J4KA 3D41A 3S6GA 2J4JA 4A7WA 3S6HA 4NDRB 3TMAA 2E9YA 2BNDA 2W21A 2AP9A 4I49A 2J5TA 3S6KA 3LDGA 2AKOA 3AB2A 3V8VA 3T7BA 3LDUA 3L76A 3WWNA 3TM5A 2WE4A 4A7XA 4JZ9A 2X2WA 2CDQA 3U6UA 2J0XA 1Z9DA 1OH9A 3K4YA 4NDPA 4JZ7A 3EK6A 2BNFA 3QUNA 3ZZHA 1OHBA 4NDQA 2J0WA 2JJ4A 4KR6A 2JJXA 3QUOA 3C20A 3B8GA 4NDQB 3TVIA 2J4LA 4NDOA 2RD5A 2R98A 1GSJA 3EK5A 1E19A 3QVFA 4KR9A 2VA1A 3QURA 2OGXB 3D40A 1B7BA 3ZZIA 1ZHVA 2R8VA 3K52A 3ZZFA 3TLJA 3K0BA 2BMUA 2OGXA 3ZZGA 3K56A 3LL9A 4KR7A 4JZ8A 3QVHA 3KZFA 2BUFA
chains in the Genus database with same CATH topology
2F06A 2WE5A 3C1MA 3L86A 4AXSA 2A1FA 3AB4A 1ZVPA 3NWYA 3C1NA 2BNEA 2V4YA 2BTYA 2JI5A 3LL5A 2J5VA 1YBDA 2V5HA 4F6TB 2HMFA 4USJA 2WXBA 4AB7A 1OHAA 3WWMA 1GS5A 3AAWA 3LKKA 4NDRA 3K4OA 3D2PA 2BRXA 4Q1TA 4NDPB 3V97A 2IJ9A 3D2MA 4F6TA 2BRIA 4OLCA 4KZTA 4NDOB 2C5SA 3TM4A 2J4KA 3D41A 3S6GA 2J4JA 4A7WA 3S6HA 4NDRB 3TMAA 2E9YA 2BNDA 2W21A 2AP9A 4I49A 2J5TA 3S6KA 3LDGA 2AKOA 3AB2A 3V8VA 3T7BA 3LDUA 3L76A 3WWNA 3TM5A 2WE4A 4A7XA 4JZ9A 2X2WA 2CDQA 3U6UA 2J0XA 1Z9DA 1OH9A 3K4YA 4NDPA 4JZ7A 3EK6A 2BNFA 3QUNA 3ZZHA 1OHBA 4NDQA 2J0WA 2JJ4A 4KR6A 2JJXA 3QUOA 3C20A 3B8GA 4NDQB 3TVIA 2J4LA 4NDOA 2RD5A 2R98A 1GSJA 3EK5A 1E19A 3QVFA 4KR9A 2VA1A 3QURA 2OGXB 3D40A 1B7BA 3ZZIA 1ZHVA 2R8VA 3K52A 3ZZFA 3TLJA 3K0BA 2BMUA 2OGXA 3ZZGA 3K56A 3LL9A 4KR7A 4JZ8A 3QVHA 3KZFA 2BUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F06 A;  2WE5 A;  3C1M A;  3L86 A;  4AXS A;  2A1F A;  3AB4 A;  1ZVP A;  3NWY A;  3C1N A;  2BNE A;  2V4Y A;  2BTY A;  2JI5 A;  3LL5 A;  2J5V A;  1YBD A;  2V5H A;  4F6T B;  2HMF A;  4USJ A;  2WXB A;  4AB7 A;  1OHA A;  3WWM A;  1GS5 A;  3AAW A;  3LKK A;  4NDR A;  3K4O A;  3D2P A;  2BRX A;  4Q1T A;  4NDP B;  2IJ9 A;  3D2M A;  4F6T A;  2BRI A;  4OLC A;  4KZT A;  4NDO B;  2J4K A;  3D41 A;  3S6G A;  2J4J A;  4A7W A;  3S6H A;  4NDR B;  2E9Y A;  2BND A;  2W21 A;  2AP9 A;  4I49 A;  2J5T A;  3S6K A;  2AKO A;  3AB2 A;  3T7B A;  3L76 A;  3WWN A;  2WE4 A;  4A7X A;  4JZ9 A;  2X2W A;  2CDQ A;  3U6U A;  2J0X A;  1Z9D A;  1OH9 A;  3K4Y A;  4NDP A;  4JZ7 A;  3EK6 A;  2BNF A;  3QUN A;  3ZZH A;  1OHB A;  4NDQ A;  2J0W A;  2JJ4 A;  2JJX A;  3QUO A;  3C20 A;  3B8G A;  4NDQ B;  3TVI A;  2J4L A;  4NDO A;  2RD5 A;  2R98 A;  1GSJ A;  3EK5 A;  1E19 A;  3QVF A;  2VA1 A;  3QUR A;  2OGX B;  3D40 A;  1B7B A;  3ZZI A;  1ZHV A;  2R8V A;  3K52 A;  3ZZF A;  2BMU A;  2OGX A;  3ZZG A;  3K56 A;  3LL9 A;  4JZ8 A;  3QVH A;  3KZF A;  2BUF A; 
#chains in the Genus database with same CATH topology
 2F06 A;  2WE5 A;  3C1M A;  3L86 A;  4AXS A;  2A1F A;  3AB4 A;  1ZVP A;  3NWY A;  3C1N A;  2BNE A;  2V4Y A;  2BTY A;  2JI5 A;  3LL5 A;  2J5V A;  1YBD A;  2V5H A;  4F6T B;  2HMF A;  4USJ A;  2WXB A;  4AB7 A;  1OHA A;  3WWM A;  1GS5 A;  3AAW A;  3LKK A;  4NDR A;  3K4O A;  3D2P A;  2BRX A;  4Q1T A;  4NDP B;  3V97 A;  2IJ9 A;  3D2M A;  4F6T A;  2BRI A;  4OLC A;  4KZT A;  4NDO B;  2C5S A;  3TM4 A;  2J4K A;  3D41 A;  3S6G A;  2J4J A;  4A7W A;  3S6H A;  4NDR B;  3TMA A;  2E9Y A;  2BND A;  2W21 A;  2AP9 A;  4I49 A;  2J5T A;  3S6K A;  3LDG A;  2AKO A;  3AB2 A;  3V8V A;  3T7B A;  3LDU A;  3L76 A;  3WWN A;  3TM5 A;  2WE4 A;  4A7X A;  4JZ9 A;  2X2W A;  2CDQ A;  3U6U A;  2J0X A;  1Z9D A;  1OH9 A;  3K4Y A;  4NDP A;  4JZ7 A;  3EK6 A;  2BNF A;  3QUN A;  3ZZH A;  1OHB A;  4NDQ A;  2J0W A;  2JJ4 A;  4KR6 A;  2JJX A;  3QUO A;  3C20 A;  3B8G A;  4NDQ B;  3TVI A;  2J4L A;  4NDO A;  2RD5 A;  2R98 A;  1GSJ A;  3EK5 A;  1E19 A;  3QVF A;  4KR9 A;  2VA1 A;  3QUR A;  2OGX B;  3D40 A;  1B7B A;  3ZZI A;  1ZHV A;  2R8V A;  3K52 A;  3ZZF A;  3TLJ A;  3K0B A;  2BMU A;  2OGX A;  3ZZG A;  3K56 A;  3LL9 A;  4KR7 A;  4JZ8 A;  3QVH A;  3KZF A;  2BUF A; 
#chains in the Genus database with same CATH homology
 2F06 A;  2WE5 A;  3C1M A;  3L86 A;  4AXS A;  2A1F A;  3AB4 A;  1ZVP A;  3NWY A;  3C1N A;  2BNE A;  2V4Y A;  2BTY A;  2JI5 A;  3LL5 A;  2J5V A;  1YBD A;  2V5H A;  4F6T B;  2HMF A;  4USJ A;  2WXB A;  4AB7 A;  1OHA A;  3WWM A;  1GS5 A;  3AAW A;  3LKK A;  4NDR A;  3K4O A;  3D2P A;  2BRX A;  4Q1T A;  4NDP B;  3V97 A;  2IJ9 A;  3D2M A;  4F6T A;  2BRI A;  4OLC A;  4KZT A;  4NDO B;  2C5S A;  3TM4 A;  2J4K A;  3D41 A;  3S6G A;  2J4J A;  4A7W A;  3S6H A;  4NDR B;  3TMA A;  2E9Y A;  2BND A;  2W21 A;  2AP9 A;  4I49 A;  2J5T A;  3S6K A;  3LDG A;  2AKO A;  3AB2 A;  3V8V A;  3T7B A;  3LDU A;  3L76 A;  3WWN A;  3TM5 A;  2WE4 A;  4A7X A;  4JZ9 A;  2X2W A;  2CDQ A;  3U6U A;  2J0X A;  1Z9D A;  1OH9 A;  3K4Y A;  4NDP A;  4JZ7 A;  3EK6 A;  2BNF A;  3QUN A;  3ZZH A;  1OHB A;  4NDQ A;  2J0W A;  2JJ4 A;  4KR6 A;  2JJX A;  3QUO A;  3C20 A;  3B8G A;  4NDQ B;  3TVI A;  2J4L A;  4NDO A;  2RD5 A;  2R98 A;  1GSJ A;  3EK5 A;  1E19 A;  3QVF A;  4KR9 A;  2VA1 A;  3QUR A;  2OGX B;  3D40 A;  1B7B A;  3ZZI A;  1ZHV A;  2R8V A;  3K52 A;  3ZZF A;  3TLJ A;  3K0B A;  2BMU A;  2OGX A;  3ZZG A;  3K56 A;  3LL9 A;  4KR7 A;  4JZ8 A;  3QVH A;  3KZF A;  2BUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...