3C1NA

Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
468
structure length
458
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAISEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Probable aspartokinase
total genus 146
structure length 458
sequence length 468
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c1nA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c1nA01
4F6TA 3K4OA 3LL9A 1Z9DA 3S6HA 3ZZIA 2AKOA 3QVHA 1B7BA 4NDPB 4NDRB 4USJA 2J5VA 4JZ7A 3D2MA 4A7XA 3L86A 3WWNA 3T7BA 2J4KA 2V4YA 4OLCA 4A7WA 2BRXA 3C1NA 3L76A 3QUOA 1YBDA 2RD5A 4NDPA 4NDRA 3AAWA 4KZTA 3QVFA 3K52A 2W21A 2BMUA 4JZ8A 3ZZHA 2V5HA 3NWYA 4AXSA 3LL5A 2A1FA 2IJ9A 4NDQB 2WE5A 3EK5A 3WWMA 3QUNA 3S6KA 3S6GA 4AB7A 2BTYA 2J4JA 2J0XA 2OGXB 2BNEA 2E9YA 2F06A 1OH9A 2WE4A 4I49A 4Q1TA 3D40A 1GSJA 2X2WA 2OGXA 4NDQA 2BRIA 1OHAA 2WXBA 2BNFA 3ZZFA 4NDOA 3EK6A 3C20A 3ZZGA 1ZVPA 2BUFA 2JI5A 4NDOB 1E19A 3D41A 1OHBA 3AB2A 1GS5A 3KZFA 3QURA 2AP9A 3K56A 2J0WA 2JJXA 3C1MA 3K4YA 3B8GA 2J4LA 2R98A 2J5TA 3D2PA 4F6TB 2JJ4A 1ZHVA 2R8VA 4JZ9A 3AB4A 2VA1A 3TVIA 2HMFA 2BNDA 3U6UA 3LKKA 2CDQA
chains in the Genus database with same CATH superfamily
4F6TA 3K0BA 3LDUA 3K4OA 3LL9A 1Z9DA 3S6HA 3ZZIA 2AKOA 3QVHA 1B7BA 4NDPB 4NDRB 4USJA 2J5VA 4JZ7A 3D2MA 4A7XA 3L86A 3WWNA 3T7BA 2J4KA 2V4YA 4OLCA 3TLJA 4A7WA 2BRXA 3C1NA 3L76A 3QUOA 1YBDA 2RD5A 4NDPA 4NDRA 3AAWA 4KZTA 3QVFA 3K52A 2W21A 2BMUA 4JZ8A 3ZZHA 2V5HA 3NWYA 4AXSA 3LL5A 2A1FA 2IJ9A 4NDQB 2WE5A 3EK5A 3WWMA 3LDGA 3QUNA 3S6KA 3S6GA 4AB7A 3V8VA 2BTYA 2J4JA 2J0XA 2OGXB 2BNEA 2E9YA 2F06A 1OH9A 3TM5A 2WE4A 4I49A 4Q1TA 3D40A 1GSJA 2X2WA 2OGXA 4NDQA 2BRIA 1OHAA 2WXBA 2BNFA 3ZZFA 4NDOA 4KR6A 3EK6A 3C20A 3ZZGA 1ZVPA 2BUFA 2JI5A 4KR9A 4NDOB 1E19A 3D41A 1OHBA 3AB2A 1GS5A 3KZFA 3TMAA 2AP9A 3QURA 3K56A 2J0WA 2C5SA 2JJXA 3C1MA 3K4YA 3V97A 3B8GA 2J4LA 2R98A 2J5TA 3D2PA 4F6TB 2JJ4A 1ZHVA 2R8VA 4JZ9A 3AB4A 2VA1A 4KR7A 3TVIA 2HMFA 3TM4A 2BNDA 3U6UA 3LKKA 2CDQA
chains in the Genus database with same CATH topology
4F6TA 3K0BA 3LDUA 3K4OA 3LL9A 1Z9DA 3S6HA 3ZZIA 2AKOA 3QVHA 1B7BA 4NDPB 4NDRB 4USJA 2J5VA 4JZ7A 3D2MA 4A7XA 3L86A 3WWNA 3T7BA 2J4KA 2V4YA 4OLCA 3TLJA 4A7WA 2BRXA 3C1NA 3L76A 3QUOA 1YBDA 2RD5A 4NDPA 4NDRA 3AAWA 4KZTA 3QVFA 3K52A 2W21A 2BMUA 4JZ8A 3ZZHA 2V5HA 3NWYA 4AXSA 3LL5A 2A1FA 2IJ9A 4NDQB 2WE5A 3EK5A 3WWMA 3LDGA 3QUNA 3S6KA 3S6GA 4AB7A 3V8VA 2BTYA 2J4JA 2J0XA 2OGXB 2BNEA 2E9YA 2F06A 1OH9A 3TM5A 2WE4A 4I49A 4Q1TA 3D40A 1GSJA 2X2WA 2OGXA 4NDQA 2BRIA 1OHAA 2WXBA 2BNFA 3ZZFA 4NDOA 4KR6A 3EK6A 3C20A 3ZZGA 1ZVPA 2BUFA 2JI5A 4KR9A 4NDOB 1E19A 3D41A 1OHBA 3AB2A 1GS5A 3KZFA 3TMAA 2AP9A 3QURA 3K56A 2J0WA 2C5SA 2JJXA 3C1MA 3K4YA 3V97A 3B8GA 2J4LA 2R98A 2J5TA 3D2PA 4F6TB 2JJ4A 1ZHVA 2R8VA 4JZ9A 3AB4A 2VA1A 4KR7A 3TVIA 2HMFA 3TM4A 2BNDA 3U6UA 3LKKA 2CDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F6T A;  3K4O A;  3LL9 A;  1Z9D A;  3S6H A;  3ZZI A;  2AKO A;  3QVH A;  1B7B A;  4NDP B;  4NDR B;  4USJ A;  2J5V A;  4JZ7 A;  3D2M A;  4A7X A;  3L86 A;  3WWN A;  3T7B A;  2J4K A;  2V4Y A;  4OLC A;  4A7W A;  2BRX A;  3C1N A;  3L76 A;  3QUO A;  1YBD A;  2RD5 A;  4NDP A;  4NDR A;  3AAW A;  4KZT A;  3QVF A;  3K52 A;  2W21 A;  2BMU A;  4JZ8 A;  3ZZH A;  2V5H A;  3NWY A;  4AXS A;  3LL5 A;  2A1F A;  2IJ9 A;  4NDQ B;  2WE5 A;  3EK5 A;  3WWM A;  3QUN A;  3S6K A;  3S6G A;  4AB7 A;  2BTY A;  2J4J A;  2J0X A;  2OGX B;  2BNE A;  2E9Y A;  2F06 A;  1OH9 A;  2WE4 A;  4I49 A;  4Q1T A;  3D40 A;  1GSJ A;  2X2W A;  2OGX A;  4NDQ A;  2BRI A;  1OHA A;  2WXB A;  2BNF A;  3ZZF A;  4NDO A;  3EK6 A;  3C20 A;  3ZZG A;  1ZVP A;  2BUF A;  2JI5 A;  4NDO B;  1E19 A;  3D41 A;  1OHB A;  3AB2 A;  1GS5 A;  3KZF A;  3QUR A;  2AP9 A;  3K56 A;  2J0W A;  2JJX A;  3C1M A;  3K4Y A;  3B8G A;  2J4L A;  2R98 A;  2J5T A;  3D2P A;  4F6T B;  2JJ4 A;  1ZHV A;  2R8V A;  4JZ9 A;  3AB4 A;  2VA1 A;  3TVI A;  2HMF A;  2BND A;  3U6U A;  3LKK A;  2CDQ A; 
#chains in the Genus database with same CATH topology
 4F6T A;  3K0B A;  3LDU A;  3K4O A;  3LL9 A;  1Z9D A;  3S6H A;  3ZZI A;  2AKO A;  3QVH A;  1B7B A;  4NDP B;  4NDR B;  4USJ A;  2J5V A;  4JZ7 A;  3D2M A;  4A7X A;  3L86 A;  3WWN A;  3T7B A;  2J4K A;  2V4Y A;  4OLC A;  3TLJ A;  4A7W A;  2BRX A;  3C1N A;  3L76 A;  3QUO A;  1YBD A;  2RD5 A;  4NDP A;  4NDR A;  3AAW A;  4KZT A;  3QVF A;  3K52 A;  2W21 A;  2BMU A;  4JZ8 A;  3ZZH A;  2V5H A;  3NWY A;  4AXS A;  3LL5 A;  2A1F A;  2IJ9 A;  4NDQ B;  2WE5 A;  3EK5 A;  3WWM A;  3LDG A;  3QUN A;  3S6K A;  3S6G A;  4AB7 A;  3V8V A;  2BTY A;  2J4J A;  2J0X A;  2OGX B;  2BNE A;  2E9Y A;  2F06 A;  1OH9 A;  3TM5 A;  2WE4 A;  4I49 A;  4Q1T A;  3D40 A;  1GSJ A;  2X2W A;  2OGX A;  4NDQ A;  2BRI A;  1OHA A;  2WXB A;  2BNF A;  3ZZF A;  4NDO A;  4KR6 A;  3EK6 A;  3C20 A;  3ZZG A;  1ZVP A;  2BUF A;  2JI5 A;  4KR9 A;  4NDO B;  1E19 A;  3D41 A;  1OHB A;  3AB2 A;  1GS5 A;  3KZF A;  3TMA A;  2AP9 A;  3QUR A;  3K56 A;  2J0W A;  2C5S A;  2JJX A;  3C1M A;  3K4Y A;  3V97 A;  3B8G A;  2J4L A;  2R98 A;  2J5T A;  3D2P A;  4F6T B;  2JJ4 A;  1ZHV A;  2R8V A;  4JZ9 A;  3AB4 A;  2VA1 A;  4KR7 A;  3TVI A;  2HMF A;  3TM4 A;  2BND A;  3U6U A;  3LKK A;  2CDQ A; 
#chains in the Genus database with same CATH homology
 4F6T A;  3K0B A;  3LDU A;  3K4O A;  3LL9 A;  1Z9D A;  3S6H A;  3ZZI A;  2AKO A;  3QVH A;  1B7B A;  4NDP B;  4NDR B;  4USJ A;  2J5V A;  4JZ7 A;  3D2M A;  4A7X A;  3L86 A;  3WWN A;  3T7B A;  2J4K A;  2V4Y A;  4OLC A;  3TLJ A;  4A7W A;  2BRX A;  3C1N A;  3L76 A;  3QUO A;  1YBD A;  2RD5 A;  4NDP A;  4NDR A;  3AAW A;  4KZT A;  3QVF A;  3K52 A;  2W21 A;  2BMU A;  4JZ8 A;  3ZZH A;  2V5H A;  3NWY A;  4AXS A;  3LL5 A;  2A1F A;  2IJ9 A;  4NDQ B;  2WE5 A;  3EK5 A;  3WWM A;  3LDG A;  3QUN A;  3S6K A;  3S6G A;  4AB7 A;  3V8V A;  2BTY A;  2J4J A;  2J0X A;  2OGX B;  2BNE A;  2E9Y A;  2F06 A;  1OH9 A;  3TM5 A;  2WE4 A;  4I49 A;  4Q1T A;  3D40 A;  1GSJ A;  2X2W A;  2OGX A;  4NDQ A;  2BRI A;  1OHA A;  2WXB A;  2BNF A;  3ZZF A;  4NDO A;  4KR6 A;  3EK6 A;  3C20 A;  3ZZG A;  1ZVP A;  2BUF A;  2JI5 A;  4KR9 A;  4NDO B;  1E19 A;  3D41 A;  1OHB A;  3AB2 A;  1GS5 A;  3KZF A;  3TMA A;  2AP9 A;  3QUR A;  3K56 A;  2J0W A;  2C5S A;  2JJX A;  3C1M A;  3K4Y A;  3V97 A;  3B8G A;  2J4L A;  2R98 A;  2J5T A;  3D2P A;  4F6T B;  2JJ4 A;  1ZHV A;  2R8V A;  4JZ9 A;  3AB4 A;  2VA1 A;  4KR7 A;  3TVI A;  2HMF A;  3TM4 A;  2BND A;  3U6U A;  3LKK A;  2CDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...