3C1NA

Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
468
structure length
458
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAISEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable aspartokinase
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 146
structure length 458
sequence length 468
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c1nA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c1nA01
4A7WA 3B8GA 1B7BA 2A1FA 3K4OA 1OHBA 4NDQA 2E9YA 3QUNA 3ZZFA 2BNDA 2OGXB 2R98A 2BUFA 3U6UA 2WXBA 3ZZIA 2WE5A 4NDPA 3D40A 4NDRA 3QVHA 3S6HA 4JZ8A 2HMFA 1Z9DA 1GSJA 4F6TA 3EK5A 4JZ9A 2BNEA 2R8VA 4NDOB 1E19A 3T7BA 1ZHVA 1ZVPA 3D2PA 3AAWA 2BMUA 2BNFA 2BTYA 3AB2A 2V5HA 1OHAA 2BRIA 3K52A 4NDRB 3C20A 2J4JA 2IJ9A 2JJXA 3QUOA 4A7XA 3D41A 2J5VA 2F06A 3S6GA 4NDQB 3QVFA 2OGXA 3D2MA 4JZ7A 2CDQA 3AB4A 3K56A 2W21A 3ZZHA 2J4KA 2WE4A 4OLCA 2J0WA 2J5TA 2RD5A 4USJA 3KZFA 4NDPB 3K4YA 2AP9A 3L76A 2J0XA 3NWYA 3TVIA 2BRXA 4F6TB 3QURA 1GS5A 2V4YA 3LL9A 3C1MA 4NDOA 3LL5A 2VA1A 3EK6A 3LKKA 3WWMA 3S6KA 3WWNA 4AXSA 3L86A 2J4LA 2JI5A 3C1NA 1OH9A 3ZZGA 2AKOA 2JJ4A 1YBDA 4I49A 4AB7A 4KZTA 2X2WA 4Q1TA
chains in the Genus database with same CATH superfamily
4A7WA 3B8GA 1B7BA 2A1FA 3K4OA 1OHBA 4NDQA 2E9YA 3QUNA 3ZZFA 2BNDA 2OGXB 2R98A 2BUFA 3U6UA 2WXBA 3ZZIA 2WE5A 4NDPA 3D40A 4NDRA 3QVHA 3S6HA 3LDGA 4JZ8A 3V97A 2HMFA 1Z9DA 1GSJA 4F6TA 3EK5A 4JZ9A 2BNEA 3TM5A 2R8VA 4NDOB 1E19A 3T7BA 1ZHVA 1ZVPA 3D2PA 3AAWA 2BMUA 2BNFA 2BTYA 3AB2A 2V5HA 1OHAA 2BRIA 3K52A 4NDRB 3C20A 2J4JA 2IJ9A 2JJXA 4KR7A 3QUOA 4A7XA 4KR6A 3D41A 2J5VA 2F06A 3LDUA 3S6GA 4NDQB 3QVFA 2OGXA 3D2MA 4JZ7A 2CDQA 3AB4A 3K56A 2W21A 3TM4A 3ZZHA 2J4KA 2WE4A 3K0BA 4OLCA 2J0WA 2J5TA 2RD5A 4USJA 3KZFA 4NDPB 3K4YA 2AP9A 3L76A 2J0XA 3NWYA 3TVIA 2BRXA 4F6TB 3QURA 1GS5A 2V4YA 3LL9A 3TLJA 3C1MA 4NDOA 2C5SA 3LL5A 4KR9A 3TMAA 2VA1A 3EK6A 3LKKA 3WWMA 3S6KA 3WWNA 4AXSA 3L86A 2J4LA 2JI5A 3C1NA 1OH9A 3ZZGA 2AKOA 2JJ4A 1YBDA 4I49A 3V8VA 4AB7A 4KZTA 2X2WA 4Q1TA
chains in the Genus database with same CATH topology
4A7WA 3B8GA 1B7BA 2A1FA 3K4OA 1OHBA 4NDQA 2E9YA 3QUNA 3ZZFA 2BNDA 2OGXB 2R98A 2BUFA 3U6UA 2WXBA 3ZZIA 2WE5A 4NDPA 3D40A 4NDRA 3QVHA 3S6HA 3LDGA 4JZ8A 3V97A 2HMFA 1Z9DA 1GSJA 4F6TA 3EK5A 4JZ9A 2BNEA 3TM5A 2R8VA 4NDOB 1E19A 3T7BA 1ZHVA 1ZVPA 3D2PA 3AAWA 2BMUA 2BNFA 2BTYA 3AB2A 2V5HA 1OHAA 2BRIA 3K52A 4NDRB 3C20A 2J4JA 2IJ9A 2JJXA 4KR7A 3QUOA 4A7XA 4KR6A 3D41A 2J5VA 2F06A 3LDUA 3S6GA 4NDQB 3QVFA 2OGXA 3D2MA 4JZ7A 2CDQA 3AB4A 3K56A 2W21A 3TM4A 3ZZHA 2J4KA 2WE4A 3K0BA 4OLCA 2J0WA 2J5TA 2RD5A 4USJA 3KZFA 4NDPB 3K4YA 2AP9A 3L76A 2J0XA 3NWYA 3TVIA 2BRXA 4F6TB 3QURA 1GS5A 2V4YA 3LL9A 3TLJA 3C1MA 4NDOA 2C5SA 3LL5A 4KR9A 3TMAA 2VA1A 3EK6A 3LKKA 3WWMA 3S6KA 3WWNA 4AXSA 3L86A 2J4LA 2JI5A 3C1NA 1OH9A 3ZZGA 2AKOA 2JJ4A 1YBDA 4I49A 3V8VA 4AB7A 4KZTA 2X2WA 4Q1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A7W A;  3B8G A;  1B7B A;  2A1F A;  3K4O A;  1OHB A;  4NDQ A;  2E9Y A;  3QUN A;  3ZZF A;  2BND A;  2OGX B;  2R98 A;  2BUF A;  3U6U A;  2WXB A;  3ZZI A;  2WE5 A;  4NDP A;  3D40 A;  4NDR A;  3QVH A;  3S6H A;  4JZ8 A;  2HMF A;  1Z9D A;  1GSJ A;  4F6T A;  3EK5 A;  4JZ9 A;  2BNE A;  2R8V A;  4NDO B;  1E19 A;  3T7B A;  1ZHV A;  1ZVP A;  3D2P A;  3AAW A;  2BMU A;  2BNF A;  2BTY A;  3AB2 A;  2V5H A;  1OHA A;  2BRI A;  3K52 A;  4NDR B;  3C20 A;  2J4J A;  2IJ9 A;  2JJX A;  3QUO A;  4A7X A;  3D41 A;  2J5V A;  2F06 A;  3S6G A;  4NDQ B;  3QVF A;  2OGX A;  3D2M A;  4JZ7 A;  2CDQ A;  3AB4 A;  3K56 A;  2W21 A;  3ZZH A;  2J4K A;  2WE4 A;  4OLC A;  2J0W A;  2J5T A;  2RD5 A;  4USJ A;  3KZF A;  4NDP B;  3K4Y A;  2AP9 A;  3L76 A;  2J0X A;  3NWY A;  3TVI A;  2BRX A;  4F6T B;  3QUR A;  1GS5 A;  2V4Y A;  3LL9 A;  3C1M A;  4NDO A;  3LL5 A;  2VA1 A;  3EK6 A;  3LKK A;  3WWM A;  3S6K A;  3WWN A;  4AXS A;  3L86 A;  2J4L A;  2JI5 A;  3C1N A;  1OH9 A;  3ZZG A;  2AKO A;  2JJ4 A;  1YBD A;  4I49 A;  4AB7 A;  4KZT A;  2X2W A;  4Q1T A; 
#chains in the Genus database with same CATH topology
 4A7W A;  3B8G A;  1B7B A;  2A1F A;  3K4O A;  1OHB A;  4NDQ A;  2E9Y A;  3QUN A;  3ZZF A;  2BND A;  2OGX B;  2R98 A;  2BUF A;  3U6U A;  2WXB A;  3ZZI A;  2WE5 A;  4NDP A;  3D40 A;  4NDR A;  3QVH A;  3S6H A;  3LDG A;  4JZ8 A;  3V97 A;  2HMF A;  1Z9D A;  1GSJ A;  4F6T A;  3EK5 A;  4JZ9 A;  2BNE A;  3TM5 A;  2R8V A;  4NDO B;  1E19 A;  3T7B A;  1ZHV A;  1ZVP A;  3D2P A;  3AAW A;  2BMU A;  2BNF A;  2BTY A;  3AB2 A;  2V5H A;  1OHA A;  2BRI A;  3K52 A;  4NDR B;  3C20 A;  2J4J A;  2IJ9 A;  2JJX A;  4KR7 A;  3QUO A;  4A7X A;  4KR6 A;  3D41 A;  2J5V A;  2F06 A;  3LDU A;  3S6G A;  4NDQ B;  3QVF A;  2OGX A;  3D2M A;  4JZ7 A;  2CDQ A;  3AB4 A;  3K56 A;  2W21 A;  3TM4 A;  3ZZH A;  2J4K A;  2WE4 A;  3K0B A;  4OLC A;  2J0W A;  2J5T A;  2RD5 A;  4USJ A;  3KZF A;  4NDP B;  3K4Y A;  2AP9 A;  3L76 A;  2J0X A;  3NWY A;  3TVI A;  2BRX A;  4F6T B;  3QUR A;  1GS5 A;  2V4Y A;  3LL9 A;  3TLJ A;  3C1M A;  4NDO A;  2C5S A;  3LL5 A;  4KR9 A;  3TMA A;  2VA1 A;  3EK6 A;  3LKK A;  3WWM A;  3S6K A;  3WWN A;  4AXS A;  3L86 A;  2J4L A;  2JI5 A;  3C1N A;  1OH9 A;  3ZZG A;  2AKO A;  2JJ4 A;  1YBD A;  4I49 A;  3V8V A;  4AB7 A;  4KZT A;  2X2W A;  4Q1T A; 
#chains in the Genus database with same CATH homology
 4A7W A;  3B8G A;  1B7B A;  2A1F A;  3K4O A;  1OHB A;  4NDQ A;  2E9Y A;  3QUN A;  3ZZF A;  2BND A;  2OGX B;  2R98 A;  2BUF A;  3U6U A;  2WXB A;  3ZZI A;  2WE5 A;  4NDP A;  3D40 A;  4NDR A;  3QVH A;  3S6H A;  3LDG A;  4JZ8 A;  3V97 A;  2HMF A;  1Z9D A;  1GSJ A;  4F6T A;  3EK5 A;  4JZ9 A;  2BNE A;  3TM5 A;  2R8V A;  4NDO B;  1E19 A;  3T7B A;  1ZHV A;  1ZVP A;  3D2P A;  3AAW A;  2BMU A;  2BNF A;  2BTY A;  3AB2 A;  2V5H A;  1OHA A;  2BRI A;  3K52 A;  4NDR B;  3C20 A;  2J4J A;  2IJ9 A;  2JJX A;  4KR7 A;  3QUO A;  4A7X A;  4KR6 A;  3D41 A;  2J5V A;  2F06 A;  3LDU A;  3S6G A;  4NDQ B;  3QVF A;  2OGX A;  3D2M A;  4JZ7 A;  2CDQ A;  3AB4 A;  3K56 A;  2W21 A;  3TM4 A;  3ZZH A;  2J4K A;  2WE4 A;  3K0B A;  4OLC A;  2J0W A;  2J5T A;  2RD5 A;  4USJ A;  3KZF A;  4NDP B;  3K4Y A;  2AP9 A;  3L76 A;  2J0X A;  3NWY A;  3TVI A;  2BRX A;  4F6T B;  3QUR A;  1GS5 A;  2V4Y A;  3LL9 A;  3TLJ A;  3C1M A;  4NDO A;  2C5S A;  3LL5 A;  4KR9 A;  3TMA A;  2VA1 A;  3EK6 A;  3LKK A;  3WWM A;  3S6K A;  3WWN A;  4AXS A;  3L86 A;  2J4L A;  2JI5 A;  3C1N A;  1OH9 A;  3ZZG A;  2AKO A;  2JJ4 A;  1YBD A;  4I49 A;  3V8V A;  4AB7 A;  4KZT A;  2X2W A;  4Q1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...