3C1NA

Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
468
structure length
458
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAISEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable aspartokinase
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 146
structure length 458
sequence length 468
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c1nA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c1nA01
3QVFA 2BMUA 1OHBA 4NDQB 4NDPA 2E9YA 3ZZFA 2BRIA 3QUNA 2F06A 2AKOA 3QVHA 2RD5A 4NDRB 1ZHVA 3WWNA 3KZFA 3AAWA 2OGXB 4AB7A 2J0XA 3QURA 3D2MA 2J5VA 2BUFA 3D2PA 3ZZIA 1B7BA 3C1MA 2HMFA 3C20A 2J0WA 2JJ4A 2WE5A 2R8VA 3LL9A 1Z9DA 4NDPB 2IJ9A 3LKKA 4I49A 2BNDA 2BNFA 4A7WA 4USJA 3L86A 1OHAA 4JZ9A 3B8GA 3K4OA 3AB2A 2WE4A 2WXBA 4A7XA 4NDOA 2CDQA 2V4YA 3K52A 3S6KA 3U6UA 3D41A 1YBDA 4OLCA 3LL5A 2R98A 2JI5A 2J4KA 4NDQA 3WWMA 2J4JA 2A1FA 1E19A 3K4YA 4JZ8A 4F6TA 3K56A 4KZTA 4NDRA 4JZ7A 3L76A 3NWYA 4NDOB 2OGXA 3EK6A 3ZZGA 2BRXA 2X2WA 3S6HA 2JJXA 1OH9A 3TVIA 1ZVPA 2W21A 1GSJA 4F6TB 3AB4A 3ZZHA 2V5HA 4AXSA 2J4LA 3EK5A 2J5TA 2BTYA 3D40A 2BNEA 2AP9A 3QUOA 3S6GA 1GS5A 4Q1TA 2VA1A 3C1NA 3T7BA
chains in the Genus database with same CATH superfamily
3QVFA 2BMUA 1OHBA 3LDUA 4NDQB 4NDPA 2E9YA 3ZZFA 2BRIA 3QUNA 2F06A 2AKOA 3QVHA 2RD5A 4NDRB 1ZHVA 3WWNA 3KZFA 3AAWA 2OGXB 4AB7A 2J0XA 3QURA 3D2MA 2J5VA 2BUFA 3D2PA 3ZZIA 1B7BA 3C1MA 2HMFA 3C20A 2J0WA 2JJ4A 2WE5A 4KR9A 2R8VA 3LL9A 4KR7A 1Z9DA 4NDPB 2IJ9A 3LKKA 4I49A 2BNDA 2BNFA 4A7WA 4USJA 3L86A 1OHAA 4JZ9A 3B8GA 3K4OA 3AB2A 2WE4A 2WXBA 4A7XA 4NDOA 2CDQA 2V4YA 3K52A 3S6KA 3U6UA 3D41A 1YBDA 4OLCA 3LL5A 2R98A 2JI5A 2J4KA 4NDQA 3WWMA 2J4JA 3LDGA 2A1FA 1E19A 3K4YA 4JZ8A 4F6TA 3K56A 4KZTA 4NDRA 4JZ7A 3TM5A 3L76A 3NWYA 4NDOB 2OGXA 3EK6A 3V8VA 3K0BA 3ZZGA 3TMAA 4KR6A 2BRXA 2X2WA 3S6HA 3V97A 1OH9A 2JJXA 2C5SA 3TVIA 1ZVPA 2W21A 1GSJA 4F6TB 3AB4A 3ZZHA 2V5HA 4AXSA 2J4LA 3EK5A 3TLJA 2J5TA 2BTYA 3D40A 2BNEA 2AP9A 3QUOA 3S6GA 1GS5A 4Q1TA 2VA1A 3TM4A 3C1NA 3T7BA
chains in the Genus database with same CATH topology
3QVFA 2BMUA 1OHBA 3LDUA 4NDQB 4NDPA 2E9YA 3ZZFA 2BRIA 3QUNA 2F06A 2AKOA 3QVHA 2RD5A 4NDRB 1ZHVA 3WWNA 3KZFA 3AAWA 2OGXB 4AB7A 2J0XA 3QURA 3D2MA 2J5VA 2BUFA 3D2PA 3ZZIA 1B7BA 3C1MA 2HMFA 3C20A 2J0WA 2JJ4A 2WE5A 4KR9A 2R8VA 3LL9A 4KR7A 1Z9DA 4NDPB 2IJ9A 3LKKA 4I49A 2BNDA 2BNFA 4A7WA 4USJA 3L86A 1OHAA 4JZ9A 3B8GA 3K4OA 3AB2A 2WE4A 2WXBA 4A7XA 4NDOA 2CDQA 2V4YA 3K52A 3S6KA 3U6UA 3D41A 1YBDA 4OLCA 3LL5A 2R98A 2JI5A 2J4KA 4NDQA 3WWMA 2J4JA 3LDGA 2A1FA 1E19A 3K4YA 4JZ8A 4F6TA 3K56A 4KZTA 4NDRA 4JZ7A 3TM5A 3L76A 3NWYA 4NDOB 2OGXA 3EK6A 3V8VA 3K0BA 3ZZGA 3TMAA 4KR6A 2BRXA 2X2WA 3S6HA 3V97A 1OH9A 2JJXA 2C5SA 3TVIA 1ZVPA 2W21A 1GSJA 4F6TB 3AB4A 3ZZHA 2V5HA 4AXSA 2J4LA 3EK5A 3TLJA 2J5TA 2BTYA 3D40A 2BNEA 2AP9A 3QUOA 3S6GA 1GS5A 4Q1TA 2VA1A 3TM4A 3C1NA 3T7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVF A;  2BMU A;  1OHB A;  4NDQ B;  4NDP A;  2E9Y A;  3ZZF A;  2BRI A;  3QUN A;  2F06 A;  2AKO A;  3QVH A;  2RD5 A;  4NDR B;  1ZHV A;  3WWN A;  3KZF A;  3AAW A;  2OGX B;  4AB7 A;  2J0X A;  3QUR A;  3D2M A;  2J5V A;  2BUF A;  3D2P A;  3ZZI A;  1B7B A;  3C1M A;  2HMF A;  3C20 A;  2J0W A;  2JJ4 A;  2WE5 A;  2R8V A;  3LL9 A;  1Z9D A;  4NDP B;  2IJ9 A;  3LKK A;  4I49 A;  2BND A;  2BNF A;  4A7W A;  4USJ A;  3L86 A;  1OHA A;  4JZ9 A;  3B8G A;  3K4O A;  3AB2 A;  2WE4 A;  2WXB A;  4A7X A;  4NDO A;  2CDQ A;  2V4Y A;  3K52 A;  3S6K A;  3U6U A;  3D41 A;  1YBD A;  4OLC A;  3LL5 A;  2R98 A;  2JI5 A;  2J4K A;  4NDQ A;  3WWM A;  2J4J A;  2A1F A;  1E19 A;  3K4Y A;  4JZ8 A;  4F6T A;  3K56 A;  4KZT A;  4NDR A;  4JZ7 A;  3L76 A;  3NWY A;  4NDO B;  2OGX A;  3EK6 A;  3ZZG A;  2BRX A;  2X2W A;  3S6H A;  2JJX A;  1OH9 A;  3TVI A;  1ZVP A;  2W21 A;  1GSJ A;  4F6T B;  3AB4 A;  3ZZH A;  2V5H A;  4AXS A;  2J4L A;  3EK5 A;  2J5T A;  2BTY A;  3D40 A;  2BNE A;  2AP9 A;  3QUO A;  3S6G A;  1GS5 A;  4Q1T A;  2VA1 A;  3C1N A;  3T7B A; 
#chains in the Genus database with same CATH topology
 3QVF A;  2BMU A;  1OHB A;  3LDU A;  4NDQ B;  4NDP A;  2E9Y A;  3ZZF A;  2BRI A;  3QUN A;  2F06 A;  2AKO A;  3QVH A;  2RD5 A;  4NDR B;  1ZHV A;  3WWN A;  3KZF A;  3AAW A;  2OGX B;  4AB7 A;  2J0X A;  3QUR A;  3D2M A;  2J5V A;  2BUF A;  3D2P A;  3ZZI A;  1B7B A;  3C1M A;  2HMF A;  3C20 A;  2J0W A;  2JJ4 A;  2WE5 A;  4KR9 A;  2R8V A;  3LL9 A;  4KR7 A;  1Z9D A;  4NDP B;  2IJ9 A;  3LKK A;  4I49 A;  2BND A;  2BNF A;  4A7W A;  4USJ A;  3L86 A;  1OHA A;  4JZ9 A;  3B8G A;  3K4O A;  3AB2 A;  2WE4 A;  2WXB A;  4A7X A;  4NDO A;  2CDQ A;  2V4Y A;  3K52 A;  3S6K A;  3U6U A;  3D41 A;  1YBD A;  4OLC A;  3LL5 A;  2R98 A;  2JI5 A;  2J4K A;  4NDQ A;  3WWM A;  2J4J A;  3LDG A;  2A1F A;  1E19 A;  3K4Y A;  4JZ8 A;  4F6T A;  3K56 A;  4KZT A;  4NDR A;  4JZ7 A;  3TM5 A;  3L76 A;  3NWY A;  4NDO B;  2OGX A;  3EK6 A;  3V8V A;  3K0B A;  3ZZG A;  3TMA A;  4KR6 A;  2BRX A;  2X2W A;  3S6H A;  3V97 A;  1OH9 A;  2JJX A;  2C5S A;  3TVI A;  1ZVP A;  2W21 A;  1GSJ A;  4F6T B;  3AB4 A;  3ZZH A;  2V5H A;  4AXS A;  2J4L A;  3EK5 A;  3TLJ A;  2J5T A;  2BTY A;  3D40 A;  2BNE A;  2AP9 A;  3QUO A;  3S6G A;  1GS5 A;  4Q1T A;  2VA1 A;  3TM4 A;  3C1N A;  3T7B A; 
#chains in the Genus database with same CATH homology
 3QVF A;  2BMU A;  1OHB A;  3LDU A;  4NDQ B;  4NDP A;  2E9Y A;  3ZZF A;  2BRI A;  3QUN A;  2F06 A;  2AKO A;  3QVH A;  2RD5 A;  4NDR B;  1ZHV A;  3WWN A;  3KZF A;  3AAW A;  2OGX B;  4AB7 A;  2J0X A;  3QUR A;  3D2M A;  2J5V A;  2BUF A;  3D2P A;  3ZZI A;  1B7B A;  3C1M A;  2HMF A;  3C20 A;  2J0W A;  2JJ4 A;  2WE5 A;  4KR9 A;  2R8V A;  3LL9 A;  4KR7 A;  1Z9D A;  4NDP B;  2IJ9 A;  3LKK A;  4I49 A;  2BND A;  2BNF A;  4A7W A;  4USJ A;  3L86 A;  1OHA A;  4JZ9 A;  3B8G A;  3K4O A;  3AB2 A;  2WE4 A;  2WXB A;  4A7X A;  4NDO A;  2CDQ A;  2V4Y A;  3K52 A;  3S6K A;  3U6U A;  3D41 A;  1YBD A;  4OLC A;  3LL5 A;  2R98 A;  2JI5 A;  2J4K A;  4NDQ A;  3WWM A;  2J4J A;  3LDG A;  2A1F A;  1E19 A;  3K4Y A;  4JZ8 A;  4F6T A;  3K56 A;  4KZT A;  4NDR A;  4JZ7 A;  3TM5 A;  3L76 A;  3NWY A;  4NDO B;  2OGX A;  3EK6 A;  3V8V A;  3K0B A;  3ZZG A;  3TMA A;  4KR6 A;  2BRX A;  2X2W A;  3S6H A;  3V97 A;  1OH9 A;  2JJX A;  2C5S A;  3TVI A;  1ZVP A;  2W21 A;  1GSJ A;  4F6T B;  3AB4 A;  3ZZH A;  2V5H A;  4AXS A;  2J4L A;  3EK5 A;  3TLJ A;  2J5T A;  2BTY A;  3D40 A;  2BNE A;  2AP9 A;  3QUO A;  3S6G A;  1GS5 A;  4Q1T A;  2VA1 A;  3TM4 A;  3C1N A;  3T7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...