3C1NA

Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
468
structure length
458
Chain Sequence
b'TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAISEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable aspartokinase
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 146
structure length 458
sequence length 468
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c1nA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c1nA01
3U6UA 2OGXB 3AB4A 2VA1A 4NDPB 4NDOA 2W21A 2BNDA 2HMFA 1E19A 3K4YA 3KZFA 4A7XA 3C1MA 3QUOA 3D2PA 2J5VA 3D41A 2CDQA 4NDRA 1GSJA 1ZVPA 2BUFA 4A7WA 2F06A 2JJXA 4JZ8A 3NWYA 3LL9A 4USJA 4AB7A 3K52A 3WWMA 2BTYA 2J0XA 2JI5A 3ZZGA 3QVFA 4NDQB 1OH9A 2V5HA 3AAWA 3ZZIA 3S6GA 3K56A 2WE4A 1Z9DA 3WWNA 4AXSA 4I49A 2J0WA 4NDOB 1ZHVA 3D2MA 3EK6A 4Q1TA 1GS5A 3QURA 1OHBA 3ZZHA 2R98A 2WE5A 4JZ7A 4NDRB 3LL5A 1YBDA 4F6TA 2BNFA 3L76A 2AKOA 3AB2A 3ZZFA 2OGXA 2J4JA 4JZ9A 3T7BA 2AP9A 4F6TB 2J4KA 3B8GA 3L86A 3QUNA 4NDPA 2IJ9A 3LKKA 2WXBA 2R8VA 2BRIA 2V4YA 2JJ4A 2RD5A 2J4LA 2E9YA 3C20A 2BMUA 3QVHA 2A1FA 3K4OA 4OLCA 2J5TA 2X2WA 3C1NA 3TVIA 2BRXA 3EK5A 4KZTA 1OHAA 3S6HA 2BNEA 3S6KA 3D40A 4NDQA 1B7BA
chains in the Genus database with same CATH superfamily
3TM5A 3U6UA 2OGXB 2C5SA 3LDUA 3AB4A 2VA1A 4NDPB 4NDOA 2W21A 2BNDA 2HMFA 1E19A 3K4YA 3KZFA 4A7XA 3C1MA 4KR9A 3QUOA 3D2PA 2J5VA 3D41A 2CDQA 4NDRA 1GSJA 1ZVPA 2BUFA 4A7WA 2F06A 2JJXA 3V97A 3NWYA 4JZ8A 3LL9A 4USJA 3TLJA 4AB7A 3K52A 3WWMA 2BTYA 2J0XA 2JI5A 3ZZGA 3QVFA 4NDQB 1OH9A 2V5HA 3AAWA 3LDGA 3TM4A 3ZZIA 3S6GA 3K56A 2WE4A 1Z9DA 3WWNA 4AXSA 4I49A 2J0WA 4NDOB 3K0BA 1ZHVA 3D2MA 3EK6A 4Q1TA 1GS5A 4KR6A 3QURA 1OHBA 3ZZHA 2R98A 2WE5A 4JZ7A 4NDRB 3LL5A 1YBDA 4F6TA 2BNFA 3L76A 2AKOA 3AB2A 3ZZFA 2OGXA 2J4JA 4JZ9A 3T7BA 2AP9A 4F6TB 2J4KA 3B8GA 3L86A 3QUNA 4NDPA 2IJ9A 3LKKA 4KR7A 2WXBA 2R8VA 2BRIA 2V4YA 2JJ4A 2RD5A 2J4LA 3V8VA 2E9YA 3C20A 2BMUA 3QVHA 2A1FA 3K4OA 3TMAA 4OLCA 2J5TA 2X2WA 3C1NA 3TVIA 2BRXA 3EK5A 4KZTA 1OHAA 3S6HA 2BNEA 3S6KA 3D40A 4NDQA 1B7BA
chains in the Genus database with same CATH topology
3TM5A 3U6UA 2OGXB 2C5SA 3LDUA 3AB4A 2VA1A 4NDPB 4NDOA 2W21A 2BNDA 2HMFA 1E19A 3K4YA 3KZFA 4A7XA 3C1MA 4KR9A 3QUOA 3D2PA 2J5VA 3D41A 2CDQA 4NDRA 1GSJA 1ZVPA 2BUFA 4A7WA 2F06A 2JJXA 3V97A 3NWYA 4JZ8A 3LL9A 4USJA 3TLJA 4AB7A 3K52A 3WWMA 2BTYA 2J0XA 2JI5A 3ZZGA 3QVFA 4NDQB 1OH9A 2V5HA 3AAWA 3LDGA 3TM4A 3ZZIA 3S6GA 3K56A 2WE4A 1Z9DA 3WWNA 4AXSA 4I49A 2J0WA 4NDOB 3K0BA 1ZHVA 3D2MA 3EK6A 4Q1TA 1GS5A 4KR6A 3QURA 1OHBA 3ZZHA 2R98A 2WE5A 4JZ7A 4NDRB 3LL5A 1YBDA 4F6TA 2BNFA 3L76A 2AKOA 3AB2A 3ZZFA 2OGXA 2J4JA 4JZ9A 3T7BA 2AP9A 4F6TB 2J4KA 3B8GA 3L86A 3QUNA 4NDPA 2IJ9A 3LKKA 4KR7A 2WXBA 2R8VA 2BRIA 2V4YA 2JJ4A 2RD5A 2J4LA 3V8VA 2E9YA 3C20A 2BMUA 3QVHA 2A1FA 3K4OA 3TMAA 4OLCA 2J5TA 2X2WA 3C1NA 3TVIA 2BRXA 3EK5A 4KZTA 1OHAA 3S6HA 2BNEA 3S6KA 3D40A 4NDQA 1B7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6U A;  2OGX B;  3AB4 A;  2VA1 A;  4NDP B;  4NDO A;  2W21 A;  2BND A;  2HMF A;  1E19 A;  3K4Y A;  3KZF A;  4A7X A;  3C1M A;  3QUO A;  3D2P A;  2J5V A;  3D41 A;  2CDQ A;  4NDR A;  1GSJ A;  1ZVP A;  2BUF A;  4A7W A;  2F06 A;  2JJX A;  4JZ8 A;  3NWY A;  3LL9 A;  4USJ A;  4AB7 A;  3K52 A;  3WWM A;  2BTY A;  2J0X A;  2JI5 A;  3ZZG A;  3QVF A;  4NDQ B;  1OH9 A;  2V5H A;  3AAW A;  3ZZI A;  3S6G A;  3K56 A;  2WE4 A;  1Z9D A;  3WWN A;  4AXS A;  4I49 A;  2J0W A;  4NDO B;  1ZHV A;  3D2M A;  3EK6 A;  4Q1T A;  1GS5 A;  3QUR A;  1OHB A;  3ZZH A;  2R98 A;  2WE5 A;  4JZ7 A;  4NDR B;  3LL5 A;  1YBD A;  4F6T A;  2BNF A;  3L76 A;  2AKO A;  3AB2 A;  3ZZF A;  2OGX A;  2J4J A;  4JZ9 A;  3T7B A;  2AP9 A;  4F6T B;  2J4K A;  3B8G A;  3L86 A;  3QUN A;  4NDP A;  2IJ9 A;  3LKK A;  2WXB A;  2R8V A;  2BRI A;  2V4Y A;  2JJ4 A;  2RD5 A;  2J4L A;  2E9Y A;  3C20 A;  2BMU A;  3QVH A;  2A1F A;  3K4O A;  4OLC A;  2J5T A;  2X2W A;  3C1N A;  3TVI A;  2BRX A;  3EK5 A;  4KZT A;  1OHA A;  3S6H A;  2BNE A;  3S6K A;  3D40 A;  4NDQ A;  1B7B A; 
#chains in the Genus database with same CATH topology
 3TM5 A;  3U6U A;  2OGX B;  2C5S A;  3LDU A;  3AB4 A;  2VA1 A;  4NDP B;  4NDO A;  2W21 A;  2BND A;  2HMF A;  1E19 A;  3K4Y A;  3KZF A;  4A7X A;  3C1M A;  4KR9 A;  3QUO A;  3D2P A;  2J5V A;  3D41 A;  2CDQ A;  4NDR A;  1GSJ A;  1ZVP A;  2BUF A;  4A7W A;  2F06 A;  2JJX A;  3V97 A;  3NWY A;  4JZ8 A;  3LL9 A;  4USJ A;  3TLJ A;  4AB7 A;  3K52 A;  3WWM A;  2BTY A;  2J0X A;  2JI5 A;  3ZZG A;  3QVF A;  4NDQ B;  1OH9 A;  2V5H A;  3AAW A;  3LDG A;  3TM4 A;  3ZZI A;  3S6G A;  3K56 A;  2WE4 A;  1Z9D A;  3WWN A;  4AXS A;  4I49 A;  2J0W A;  4NDO B;  3K0B A;  1ZHV A;  3D2M A;  3EK6 A;  4Q1T A;  1GS5 A;  4KR6 A;  3QUR A;  1OHB A;  3ZZH A;  2R98 A;  2WE5 A;  4JZ7 A;  4NDR B;  3LL5 A;  1YBD A;  4F6T A;  2BNF A;  3L76 A;  2AKO A;  3AB2 A;  3ZZF A;  2OGX A;  2J4J A;  4JZ9 A;  3T7B A;  2AP9 A;  4F6T B;  2J4K A;  3B8G A;  3L86 A;  3QUN A;  4NDP A;  2IJ9 A;  3LKK A;  4KR7 A;  2WXB A;  2R8V A;  2BRI A;  2V4Y A;  2JJ4 A;  2RD5 A;  2J4L A;  3V8V A;  2E9Y A;  3C20 A;  2BMU A;  3QVH A;  2A1F A;  3K4O A;  3TMA A;  4OLC A;  2J5T A;  2X2W A;  3C1N A;  3TVI A;  2BRX A;  3EK5 A;  4KZT A;  1OHA A;  3S6H A;  2BNE A;  3S6K A;  3D40 A;  4NDQ A;  1B7B A; 
#chains in the Genus database with same CATH homology
 3TM5 A;  3U6U A;  2OGX B;  2C5S A;  3LDU A;  3AB4 A;  2VA1 A;  4NDP B;  4NDO A;  2W21 A;  2BND A;  2HMF A;  1E19 A;  3K4Y A;  3KZF A;  4A7X A;  3C1M A;  4KR9 A;  3QUO A;  3D2P A;  2J5V A;  3D41 A;  2CDQ A;  4NDR A;  1GSJ A;  1ZVP A;  2BUF A;  4A7W A;  2F06 A;  2JJX A;  3V97 A;  3NWY A;  4JZ8 A;  3LL9 A;  4USJ A;  3TLJ A;  4AB7 A;  3K52 A;  3WWM A;  2BTY A;  2J0X A;  2JI5 A;  3ZZG A;  3QVF A;  4NDQ B;  1OH9 A;  2V5H A;  3AAW A;  3LDG A;  3TM4 A;  3ZZI A;  3S6G A;  3K56 A;  2WE4 A;  1Z9D A;  3WWN A;  4AXS A;  4I49 A;  2J0W A;  4NDO B;  3K0B A;  1ZHV A;  3D2M A;  3EK6 A;  4Q1T A;  1GS5 A;  4KR6 A;  3QUR A;  1OHB A;  3ZZH A;  2R98 A;  2WE5 A;  4JZ7 A;  4NDR B;  3LL5 A;  1YBD A;  4F6T A;  2BNF A;  3L76 A;  2AKO A;  3AB2 A;  3ZZF A;  2OGX A;  2J4J A;  4JZ9 A;  3T7B A;  2AP9 A;  4F6T B;  2J4K A;  3B8G A;  3L86 A;  3QUN A;  4NDP A;  2IJ9 A;  3LKK A;  4KR7 A;  2WXB A;  2R8V A;  2BRI A;  2V4Y A;  2JJ4 A;  2RD5 A;  2J4L A;  3V8V A;  2E9Y A;  3C20 A;  2BMU A;  3QVH A;  2A1F A;  3K4O A;  3TMA A;  4OLC A;  2J5T A;  2X2W A;  3C1N A;  3TVI A;  2BRX A;  3EK5 A;  4KZT A;  1OHA A;  3S6H A;  2BNE A;  3S6K A;  3D40 A;  4NDQ A;  1B7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...