4KR9A

Crystal structure of a 4-thiouridine synthetase - rna complex at 3.5 angstrom resolution
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
386
structure length
386
Chain Sequence
ELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA sulfurtransferase
publication title Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/rna
total genus 117
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.8.1.4: tRNA uracil 4-sulfurtransferase.
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02568 ThiI Thiamine biosynthesis protein (ThiI)
A PF02926 THUMP THUMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 4kr9A01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kr9A02
2AZXA 1U3CA 1KH1A 3KFLA 4MW7A 1Q77A 1N77A 4ND7A 5DEOA 1O97D 4MVYA 5EKDA 3N8HA 3QE4A 1WXIA 1O94C 1O96A 4RUKA 2JANA 2WB2A 3PNYA 3HV0A 3K32A 1LW7A 3IUEA 1PFWA 3CVWA 4I6EA 5HUHA 3SYTA 4ZCRA 1JIKA 1OBHA 1EUQA 3P0HA 2DERA 3CLRD 3CVVA 3CLUC 1KP2A 3IMGA 4ZT5A 1NYLA 1QRTA 2E21A 3P52A 4NAHA 4I6JA 2DR2A 2PZ8A 1NSYA 1O94D 1O95D 2HMAA 2J07A 1KQPA 3COWA 3TM4A 4RPIA 3VGJA 1O0BA 3ND5A 1OWNA 1N2EA 4P2BA 1SURA 1H3EA 3ZJTA 4DDKA 3ZUGA 4EG8A 1MAWA 1TYDE 4BWVA 1M8FA 3X1MA 4YP5A 1GLNA 5TEVA 4MLPA 1IVSA 3MXTA 2A88A 3COVA 2RE8A 1K92A 4MAFA 4MVCA 1KORA 3IVCA 3KT8A 1IQ0A 1M8JA 4WSOA 4HJRA 3LCJA 4YBRA 1X6VA 2QTMA 1GTSA 2ZP1A 3N9IA 1NUTA 1CT9A 4J76A 3GLVA 1GPMA 4EG7A 1YIAA 3IMEA 3KT3A 5K0SA 2Z3VA 2YWBA 4MUJA 4MW0A 1MRZA 1OWOA 2C5SA 2A1TS 3NBAA 4MUHA 3UK2A 2PZBA 1DNPA 2QJTA 4WNYA 4NZPA 1M8GA 3QTTA 1QJCA 1Q19A 2CYBA 4MUGA 4EG1A 2PG3A 4EG6A 2CT8A 1T6YA 3ZJVA 4OJMX 4YP7A 3ZXIA 3CLTC 5DK4A 2PXHA 3D6UA 3M5WA 3DV2A 4E1AA 1K4KA 2NZ2A 1N2JA 4UZFA 2X1MA 4ARCA 2QJFA 1M1ZA 1O5TA 3MLBA 1QQTA 1F7VA 4KR6A 3X1KA 1R6XA 3U1VA 1KKUA 3DPIA 3ZJUA 3OTWA 2J09A 5KHAA 1UFVA 4MW1A 1N2GA 4J75A 4L2IB 1U7XA 3COYA 5J59A 2QJOA 3LDUA 3CLSC 3G6KA 4G6ZA 2WQ7A 1FFYA 2H29A 2WSIA 4HPWA 3PXUA 4H3SA 4Q16A 4MWEA 1TFUA 2A1UB 3H99A 4ND6A 3FOCA 4ZT3A 3ISJA 2VXOA 4OUDA 3N05A 1ILEA 3IH5A 4L2IA 1JMVA 1PFYA 3RK0A 1O97C 2J08A 3NV7A 1TYCA 3G5AA 1NUSA 1JHDA 1VLHA 3H05A 2JA2A 3KT6A 2CYCA 3TQOA 1VL2A 3AL0C 1O96B 4PBSA 1ZH0A 3C8ZA 4MW6A 4ZCQA 2A86A 3CLRC 3RJZA 2VTBA 1J1UA 5DB4A 4DDHA 1KP3A 3MMXA 2E18A 4MVXA 1JGTA 3VRHA 1XJQA 1O95C 3IOBA 4F3RA 3IUBA 2BTEA 3G59A 3GUZA 1WOYA 1WXFA 3S3TA 3K0BA 4ZT7A 3MUEA 1MBZA 4QBTA 3KT0A 3Q10A 1EUYA 3PNVA 3DO8A 4R2MA 1EFVB 1JIIA 4QRDA 1N1DA 2WQ6A 4R2LA 2X1LA 4U8HA 4DJAA 4EGAA 1ZUNA 1X8XA 3A4IA 3P0IA 1IQUA 2DETA 3ZIUA 1U3DA 2DEUA 1WQ4A 1F7UA 3IOEA 3E27A 5IHXA 1EFVA 2J5BA 1RQGA 3FG9A 4S1OA 5J58A 4KKVA 3ILVA 2G36A 4EG5A 4HJXA 4PY2A 3P0JA 4F4HA 1KR2A 2CSXA 3IVXA 4DDMA 1EJ2A 2YY5A 4U7JA 1R6UA 4XSVA 3RFFA 1Q11A 4MUEA 3HFJA 4KR9A 4EFKA 1Y42X 4YP6A 1COZA 3FI0A 1WXEA 4DNXA 1J21A 2A1TR 2QUHA 1JZQA 3SDBA 4FZJA 3AIIA 5TGTA 1WZ2A 1NZJA 2QUKA 4PBRA 2CV2A 5KCMA 2A84A 3HMQA 4GRIA 2TS1A 3RK1A 5K0TA 4UZEA 1MB9A 1QU3A 3IVGA 1K4MA 1YUNA 1N3LA 3H9CA 1TYAE 1OD6A 2YWCA 1WXGA 3FWKA 4EF6A 4MUIA 1NUPA 2J4DA 3FIUA 4NX2A 3TZLA 1G59A 4MW9A 2XRZA 1OWMA 1XNJA 2CV0A 2V0GA 2ZUEA 2H2AA 2NSYA 4MULA 1ZH6A 1EFPA 4TS1A 1QNFA 5IJXA 1J1ZA 1WY5A 3LOQA 3CR8A 3AG5A 1H3FA 3UC5A 4DE5A 1G8GA 1OWPA 3MLAA 1I6KA 3LE8A 1GZUA 3HL4A 2V0CA 3SEQA 1PG0A 3FNRA 4OUDB 1YUMA 3ZXSA 4NATA 4MW4A 1WXHA 4MUKA 4PBTA 5HG0A 5F23A 3PRHA 3F3MA 1T6XA 2D54A 3X1JA 1BS2A 3FY4A 1V47A 1S4MA 1GAXA 3QTBA 3AFHA 1OWLA 3ELBA 3A2KA 1PFVA 5J5AA 1G8HA 4MW5A 1KAMA 4MWBA 1M83A 1T9GS 1QTQA 2YXNA 3OP1A 2VTBB 4MUFA 1P7PA 4JXZA 3TZEA 1QU2A 2CV1A 3V97A 3TQIA 3UMVA 4ZT6A 1O6BA 1YULA 2DLCX 2QTNA 1YI8A 1NUUA 5LLTA 3CVUA 1NURA 4A91A 4DLPA 5LM3A 3TM5A 2PFSA 1FYDA 3UY4A 3A04A 1ULHA 1KQOA 1KH3A 3A05A 2D5BA 1JZSA 2DPLA 4ZCPA 1WKBA 1MB2A 1A8HA 1IFXA 1F9AA 1NI5A 1U0BB 1N78A 1IHOA 2PIDA 4XFDA 3SP1A 4KPUA 1GN8A 1WQ3A 2B7LA 4EG4A 4ZT2A 3L93A 5KWVA 3IOCA 2DUMA 2EJCA 2X3FA 1EE1A 1MOPA 4NAUA 1TEZA 1JEEA 1H3NA 1N2OA 2I1LA 3L92A 5FO0A 3H97A 2OV4A 2QTRA 1I2DA 3GMIA 4AS1A 1WJGA 3CA8A 4G5YA 3CVYA 3DLAA 4YMIA 4G5FA 4MQ6A 1IRXA 4MW2A 4ARIA 1N2BA 2GKSA 2GM3A 1QRSA 5H7XA 1KQNA 2IJGX 4CDNA 3JXEA 3VU8A 1K97A 4JFAA 5TEWA 4GU5A 4AQ7A 3IODA 3FETA 3TMAA 3IMCA 4KR7A 1I6MA 1PG2A 1J09A 5FNZA 2Z08A 4XFJA 1TQ8A 4CDMA 3FH0A 1YIDA 1HYBA 2GOYA 2QUIA 4NDAA 1O0CA 2Z09A 3IDFA 4ZCSA 1MJHA 5FO1A 1J20A 3CLUD 2RD2A 1D2RA 1J70A 3RHSA 3COZA 1ZJWA 2AKEA 1XNGA 2E89A 1EFPB 5TS2A 2CYAA 1QRUA 2HGZA 3AG6A 1IH8A 3TLJA 1MAUA 1N2HA 1G8FA 1Q15A 4EG3A 1KH2A 3PNBA 2XRYA 1VBKA 1JEDA 1M8PA 3V8VA 2AG6A 3TNJA 1F4LA 2OQ2A 1EXDA 3INNA 4JZYA 2D13A 4QREA 1JILA 1VBMA 1H1TA 5LFAA 1NP7A 1LI7A 1MC1A 5AHWA 4U63A 5BNZA 3ND6A 3ND7A 2R5WA 2X0KA 2JAXA 2O5RA 3LDGA 3TS1A 1N75A 3K9WA 1OBCA 3FDXA 3FHJA 2A7XA 4JYZA 1JECA 2CUZA 3H9BA 4K03A 3CVXA 2CFOA 4I6GA 4CT0A 1LI5A 1R6TA 3HGMA 3Q12A 3HZRA 2EL7A 1T9GR 4Q93A 2PZAA 1JIJA 4CQNA 4JXXA 2A4MA 1XNHA 3UOWA 1M8KA 2DXIA 1B6TA 3RBAA 2IP1A 1N2IA 1V8FA 4MUNA 3SZ3A 4ZT4A 4MWCA 3CLTD 3D6VA 4R0NA 4ZCTA 2E0IA 3SEZA 2HZ7A 2ZUFA 4MVWA 5HUJA 1TYBE 2QUJA 2BYTA 3I05A 3AKZA 1NUQA 4KPUB 4X0EA 3NBKA 5DASA 1VBNA 1GTRA 5H16A 1KAQA 3Q4GA 4HK4A 5JBNA 1U7DA 3SZGA 2IELA 4K0RA 1IQRA 3CLSD 2O8VA 1T6ZA 2A1UA 1PFUA 1I6LA 3BL5A 3N2YA 3ZGZA 4MWDA
chains in the Genus database with same CATH superfamily
3O91A 2N75A 2G77B 5JDCA 3EPPA 4Y2RA 1DBPA 2IU3A 3UJ3X 5KZMB 3V4RA 5DBIA 2E87A 1PHPA 4MQFB 3ZCRA 1HG1A 5CG2A 1QNLA 1N77A 4RA9A 1XKQA 5IEBA 3GRUA 4QUKA 5EKDA 3FDZA 1R9MA 2YX1A 3CN7A 4ZAVA 2J0SA 1WXIA 1O94C 2BMAA 4EPRA 1YD7A 3ETEA 1EM8A 4JMLA 1CY7A 2BRUA 4LGMA 3DOHA 4GMKA 1VLMA 2I3DA 4QD3A 5K8TA 3IPCA 4GP7A 2JW5A 1MRSA 1NQAO 3CRRA 5BV2P 1LW7A 3UG6A 3IAFA 1PFWA 3L4BA 1EFRA 3LY7A 3MELA 1VSBA 2C3MA 3QYJA 3U37A 5HMLA 1S2NA 1S7GA 4BMOB 3CLRD 1GYRA 1SCBA 1JN0A 1RWQA 2NU7B 3NHUA 3UB4A 4MDHA 3I5XA 4JLJA 1NV8A 2NUPA 4I6JA 1WOMA 1IMOA 2P6NA 4KFUA 4PLHA 2ORWA 5K3SA 4ETMA 3QSYA 5DN9A 1FFWA 4I4NA 1NY5A 3ZBTA 1GSAA 1PUIA 2E5LB 1MP0A 2ZWVA 2DUNA 2X23A 1DIOB 3BMNB 1P9NA 4WTOA 4OAQA 5DMHA 1TMGE 1WLSA 4RQTA 2C9ZA 4Q21A 1KEVA 3O4JA 3ICWA 4WADA 5D51S 3L5OA 1SUSA 1PZGA 4QUGA 4GMGA 2VHWA 3R5KA 4P7KA 4A2QA 3BGVA 3CNLA 4PAQA 4WXPA 6ADHA 4WK0B 1U3VA 3A1SA 2HHAA 1IJBA 5BMVB 2I7XA 4DMKA 1CERA 2DBZA 2QN7A 5CIQA 3PKZA 4Z54A 1GPYA 2MHCA 3CKYA 3D9QX 1ODFA 4MV6A 2VBIA 2IF2A 2Y3IA 3H3JA 4DJFC 2ZB7A 1O5OA 3I62A 1HQYE 3SHTA 3HFSA 2GD1O 5BOVA 3P20A 4TYQA 3PQEA 2X0DA 1FMFA 1L5QA 2EAUA 5FIUA 5GGXA 4OX9B 4OMCA 3NALA 4J76A 5KOYA 4M1YA 1UT6A 3F67A 3WQQA 1W4BA 3HJAA 1N4AA 5JFGA 1E3IA 3ROGA 5L45A 5K0SA 3I2HA 4EI8A 5EOVA 3T5MA 1GCGA 1ADFA 1WMDA 3H17A 1CE8B 1ONSA 5FEMA 3SC4A 2AFHE 3GJZA 4OFBA 2DFTA 3ICVA 4ZWNA 4EITA 2OAP1 3U16A 2PVPA 2NV2B 3QVGA 4JYAB 3FWNA 3DWIA 3BF7A 1EAMA 1R0KA 2PGNA 2R6CA 3FHLA 4BNNA 2Y4NA 1JFSA 3G8CA 1IB6A 2R6R1 1CY6A 1AKQA 3CURA 3P5BA 2XYPA 4GG1A 1BFDA 1SBNE 5M3BA 4C4YA 2Z3WA 4OJMX 4YH1A 3LUDA 5IMBA 4LRXA 5EMMA 3ZPXA 4EJFA 1XZAA 4CQJA 1QVVA 1RHJA 1MRNA 1NJGA 2IYQA 4MHTA 3E7PA 1U2PA 2ID8A 1H6AA 2N47A 4JB3A 4NZMA 1NW8A 2PGXA 3VJRA 1G60A 1OAKA 3I1FA 3SQOA 1QQTA 3ZY2A 3IC5A 1PX0A 3E3NA 3O4FA 5CW2A 1SPXA 1AF7A 3GT0A 5K3OA 2OV3A 4E46A 2J09A 3U4AA 1N2GA 1JHPA 5HOQA 2RGUA 3GLGE 2HRBA 3JYNA 3QHAA 4OQDA 5JZSA 2VOJA 1AM4D 1ADYA 1KKMA 2BMVA 1WF3A 3K6KA 3EE6A 4ND1A 3IMFA 3V8RA 2VQEB 1ZCBA 2HHLA 3K92A 1BWPA 1PT7A 1TQ2A 1SCAA 1U8AA 1K5PA 1ISPA 1GUBA 2NO1A 3I2YX 3WLLA 1M2OA 3H5OA 4Q3KA 1TQHA 1KL7A 4OSEA 4EHNA 1B6SA 1DCFA 1FSFA 1PFYA 3CINA 2AC7A 3MVEA 4AJOA 3HYSA 3CRZA 1K6MA 1HC7A 1B42A 4E5YA 2P69A 3FUTA 5GM2A 3AVOA 1Q3KA 4OBBA 1BW9B 1M6HA 3IOMA 5A5GA 5AVSA 1I9CA 2J67A 1JHUA 3MXOA 4RQBA 5D3ZA 4WCFA 3ST7A 1YZUA 1Z7GA 2ATEA 4RD2A 4ZD6A 1HEUA 4N6GA 3SYNA 1CP2A 4A1FA 4PLZA 4TUYB 1AGXA 4UU1A 3H1TA 2JAHA 4KIUA 2J9GA 4BTEA 4Q7QA 2GA9A 3ZD9A 4D9BA 2K2WA 2EG5A 2DJIA 3VR2A 1I1QB 2BFWA 3R4CA 3PD1A 4CG3A 4LECA 3VX4A 1JPUA 3IUQA 1PX2A 1L6RA 1SEPA 2JFGA 2HK6A 3OSUA 1FP4B 3T7SA 2G4LA 2D5AA 3FAKA 3K0EA 4KIWA 3ZWOA 1XP8A 3KCQA 1I3OA 2VF5X 2YNMA 3HBNA 3L1JA 1F2UA 4LV6A 1J00A 1MQSA 1XCLA 1UCFA 4Q03A 3M5PA 4QXRA 3MUEA 3Q8LA 2D2EA 3ADPA 3QX3A 2O0KA 2VNSA 3EGVA 2OWDA 4IUCS 5EIEA 3HRHA 1G19A 3RKSA 3T3MB 3AF5A 3K5IA 1L5HB 1YASA 4I1UA 2ES4A 4WJZA 4WFKA 5EQDA 4ZTUB 1NVVR 2YWDA 3VNVA 3NNSA 4Q1FA 4P33A 1DIGA 3G23A 3KQVA 3TLBA 3PFHA 4BJ3A 4X61A 5J1TB 4LJRA 3A4IA 5ALXA 1K3TA 3ZQKA 1VGQA 5FDFA 1JSCA 3K1JA 1IXRC 2VUIB 3EXHC 3TZCA 1L6IA 5KU7A 3U6BA 3DCNA 7ADHA 1W52X 2RGDA 1JR6A 2BHSA 5IHXA 2AF4C 3V8MA 2DH5A 2W98A 4CF6A 5I7EA 2X0EA 3VAYA 4R0MA 5LIPA 1Q2XA 1DWQA 1FUEA 1L5ZA 1YZFA 2IP2A 2WR8A 1XI2A 4LIPD 2DHQA 4FYJA 2XNHA 4TKVB 1XHFA 2HD4A 2BMEA 4KK4A 4PINA 5T64A 4EG5A 3P0JA 2J46A 3FMPB 3KC2A 4JLDA 4WKPA 5E2BA 2VSOA 5JC8A 5F77A 4OX9Y 2NUTA 4OHYA 1I4OA 2WNIA 4YAGA 2JIRA 2QDKA 4KB5A 1YR9A 3E1KA 5ILGA 2VJQA 4MDEA 1U1IA 3STHA 5IZ4A 4TV8F 1QFSA 2WHEA 3L4KA 4J1QA 1E6WA 2HIGA 3R6LA 5HFJA 4I4IA 4CNQA 4QGGA 5DWQA 1PZFA 1U9JA 3BICA 1EUZA 3HCNA 1MN6A 2BZSA 4H18A 5CUQA 5BNIA 1SC6A 1F20A 1EDEA 1RU3A 2OQIA 3G8YA 4IF6A 2QUHA 4LC0A 2GEBA 3UT0A 4Z7OB 4FOPA 5KQMA 4EW3A 4EB0A 4BXOB 4WA8A 3KXIA 4ZGBA 5DGDA 4D9GA 2Q3HA 2FDXA 1E4EA 2B8JA 3H5NA 4UZEA 5DCWA 3WGNA 3IAAA 1E89A 4AJNA 5EHQA 1SK8A 4N0PA 1TKBA 3G0BA 2BSQA 4LSZA 1U3TA 2IPAB 3ACDA 3K2EA 4ZXFA 2I4OA 2CDAA 4ZU1X 3RNLA 3TW8A 4ZJPA 4R1NA 4UD2A 1US8A 3VOTA 1UBNA 4D4HA 2JCYA 2WD7A 4FBLA 5C5DA 1U90A 3HXOA 4P08A 4YMHA 5AK3A 5CTJA 1AXRA 1Q1BA 2IEYA 3GJYA 2LDXA 4O0LA 4JU8A 3THYB 4JS0A 1RQPA 2V9ZA 2G7MC 3IP1A 4HB0A 4NMXB 1X9GA 1XN1A 1Y63A 3A7DA 1GILA 3WL6A 4YT8A 5K8JB 3W5BA 4J16A 3U4CA 1L4BA 3CR8A 5KNDD 3CF0A 3AG5A 4DB4A 4BRUA 4LDQA 4B71A 4G26A 4MJXA 1R8QA 4M7RA 1QP4A 1OXSC 1W59A 2ONYA 1GKYA 3HZOA 3D3JA 3VOBA 1D09A 1KJNA 4FC6A 4HAXA 4IZ6A 4GE0A 4WEOA 1DJQA 1GNRA 2A14A 1NPDA 2NO9A 3D64A 3JD3A 3AERB 4NATA 4YAEA 4QOJA 4ARVA 3IT3A 3QE0A 1J7JA 3ZWNA 2ZRCA 3IP7A 3ORSA 2Q9AA 5JXIA 2JIBA 1E7MA 2VDWA 2GPTA 1VQ1A 4LE0A 3WKDA 1GP2A 1GAXA 1S4MA 5ER9A 4C4XA 4H7IA 4IOMA 4E2FA 2OZKA 3LGSA 5I5EA 4B76A 4CNBA 3IL2A 5CXUA 4PRKA 3A2KA 3S0JA 5LU9A 2QD5A 3VR5A 4JVLA 4DLSA 4HAYA 2QG9A 4B5LA 5E6UA 2WF6A 9LDTA 1MPTA 4LY0A 3WGYA 5EUBA 1FFBA 5LXTA 5TIIA 1Z7YA 2XUKA 3AU8A 3JASA 3N70A 2WF5A 3BGIA 4AWBA 4B4VA 1E1NA 1G5IA 2TSYB 3GW8A 3HXTA 3Q3HA 5CVDA 3TQIA 1XFDA 3PGXA 5EIBC 1GM5A 2H1CA 1OU4A 3VPHA 5JT1A 1IN8A 3SXUB 2QJRA 2O8DA 4IY1A 2A9JA 3MIZA 3HXPA 2HJRA 1DXHA 4LX8A 4UU8A 2H5EA 5FUVA 4WEQA 4MEJA 2OCGA 2B4AA 1A9ZA 4XASA 4OI4A 3K6JA 4LHYA 1W8DA 1X8LA 1XRPA 2XDYA 1KQOA 3LQRA 3UPUA 2JLRA 4C87A 5I3CA 2PMEA 4IZHA 1VKOA 1Q50A 2JAWA 5ALZA 2QMZA 3O2JA 1HE5A 5BYBA 5AWFC 5KVSA 3V4SA 3QQ5A 1TLTA 2XSZD 1S8NA 4OP1A 4Z0NA 5CGQB 2A5FA 4YO8A 3FB4A 2OWEA 3GNTA 5FTNA 2NZYA 5T4HA 4B0PA 4XCXA 3PRKE 5A2QA 4H7KA 4RABA 1Y8QA 3HK2A 2CC2A 1P5HA 1E69A 4ZT2A 4GF5A 3KZ1E 2CHEA 2X3FA 5HEKA 3WLNA 1G0OA 1FOEB 1C1XA 2BFFA 3KYIB 1JLSA 2O2JA 4WN9B 1I0IA 2HSDA 5C8XA 4XWWA 3PHCA 2FMKA 2QA5A 1QMPA 2W2NA 2XGSA 4P4SA 4HR7A 5J4VA 4GD3Q 2N46A 1CETA 1WMBA 5A6SB 3L0IB 5KSPA 2HBYA 1TOAA 4BATA 5FD8A 1LD3A 1T36B 1O7JA 2WKSA 3B1JA 4GI1A 1WCIA 5E38A 2QQFA 4A0SA 4D46A 2A2ZA 4NXNB 3I01M 1J39A 1VHDA 1IOWA 2J3KA 3MWYW 3NTVA 2YXLA 1P7CA 4DKXA 3UHPA 3DJFA 4IG4A 4NY1A 1C3OB 3KQTA 3OQOA 2B8WA 3OLYA 3AUUA 1Y9DA 4MCHA 1PJCA 3GCGA 1RWPA 3TTSA 4DM3A 4ZEVA 3FM9A 4M9RA 2A0YA 1NW5A 1SH7A 1XMXA 2Z08A 4G3XA 4ODIA 2CHQA 4AY3A 4CHGA 4MI1A 4ENQA 2JJYA 5CYPA 5BWOA 2R00A 1JPVA 2OQVA 1A27A 3E9RA 1YI0A 3P7MA 2BBTA 4HEJA 4GLBA 4NFSA 3LUPA 2BUCA 4MS4B 5CVJA 1SVWA 1V3UA 4S1VA 4BBPA 3B78A 3GPBA 2I67A 4WK6A 3C6MA 1XNGA 1X7ZA 4DL9A 1JKMA 1AOXA 4RQAA 3KRTA 1FUIA 3OVMA 4DR5B 2UUOA 1T29A 1DEHA 5AVXA 2HBQA 3KOMA 3GHHA 3W2FA 3NC4A 4EG3A 1SUAA 1N1GA 1M2KA 1I4EB 1JKFA 1JEDA 1KVTA 4HB3A 4RFVA 4CM9A 3F78A 2QPLA 3CRNA 3UWOA 1PO7A 3LL7A 3INNA 4IWNA 2QQEA 3TQQA 2VNKA 4DNOA 4H15A 3KDSE 1UMKA 4HOYA 1E3DA 2HDOA 4QHYA 1OLSA 1NR7A 2J3LA 2HQOA 3H9GA 1RYHA 3Q41A 4FFBB 3U7EB 2QSZA 1P1FA 2WWYA 1P1JA 3ND6A 1SD5A 2X0KA 1U9ZA 4B43A 4KI7A 2D0IA 3LDGA 1FVXA 1RLMA 1CF2O 1YMUA 2WUGA 4UFNA 4EY8A 3HJNA 3Q0TA 1E61A 1CZUA 1JQ5A 1UIRA 2PUHA 3KK0A 1N8SA 4DABA 4C7JA 1SQGA 1SUWA 5EP1A 2AL7A 1Y3AA 3K6SA 2GKGA 1GGVA 1ZITA 4R16A 4I7EA 3C5WP 3SU8A 1ZGGA 2AZDA 2E5FA 2J7KA 1G41A 4HZIA 1M6EX 1OZ0A 2P62A 4Q93A 4A1OA 4B74A 4BJ1A 2UYHA 3VOSA 1GYQA 3FYDA 4HRYA 4RVDA 4NH0A 3NFYA 5TMPA 2A1IA 2VCHA 1OU0A 3U4GA 3ZDYB 5BWCA 1Y1SA 2IC5A 2G9NA 5I7UA 3B2NA 5GINE 1R8YA 2VWQA 3E9CA 3ML1A 2C4TA 4W9RA 2FPSA 2DQYA 1TAHA 2IYXA 3PXGA 4D9JA 2HW8A 1X1AA 4M7PA 2GVDC 2QZJA 1N2IA 5SYNA 3GB9A 4KTTE 2H31A 4FZRA 4EX7A 4PFQA 4QXPA 1V96A 2OG2A 3H18A 4K6FA 3MJRA 4JSRA 2QD4A 3A6DA 1GA1A 4LE1A 1HF3A 4QECA 1JQBA 5MDHA 2B9VA 4HWOA 2ZPTX 3CNEA 3GEDA 4J7XA 1N4DA 2BISA 4GGOA 4RH0A 5KUTA 3VDQA 5H8WA 2QMQA 3A3KA 3AKZA 5FOTA 3TLCA 2YV4A 2UXBB 4RH1A 1TC1A 2JGRA 3SYRA 5INTA 1BS1A 3M2TA 5FL7A 3W9UA 1OYWA 2JFPA 2GXSA 5KCZA 2AHOA 3DLPX 1MW8X 1JFFA 2WFAA 4IJ6A 1RYDA 1FRFS 1X3LA 2B34A 3BIWA 3CLSD 3H8VA 3KJZA 4FYWA 4PM4A 3RFXA 1I6LA 1VKHA 4TTVA 1CIPA 3QBDA 3QWAA 4H7HA 4QFCA 2OLEA 2PWPA 1ADCA 1MH1A 3P2MA 4ZI5A 4JJAA 4Q4HA 1V8OA 1PDVA 3UHOA 2HY7A 1AV6A 1OX5A 1A97A 1YDMA 3WNDA 1V8BA 1UXOA 3KBOA 2VUHB 3FFAA 1CZRA 2Y67A 3D43A 3CX7A 3UNXA 4ND7A 3O9ZA 5HS4A 3NWPA 4OHZA 3KB6A 3QEKA 2ZI4A 4REQB 3HEAA 4FZ3A 2FZ5A 1XXHB 3RHFA 2RAFA 1U2DA 1VA5A 5FOSA 3UWSA 5A3SA 3IVAA 1JQEA 1N0UA 2X0IA 2JKZA 1TTPB 4LHZA 4LJYA 3DHNA 3M6FA 4QULA 2WPDA 5HUHA 4EWLA 4OXNA 3W5CA 3I34X 1UADA 3V8EA 3T7EA 1WTAA 1T4DA 5FLKA 2A35A 3E8XA 5T8KC 1M7HA 1GZHB 1OFTA 1WZIA 1DZ3A 4TWRA 4UAUA 4WZZA 3VNRA 4N3GA 4B79A 4R1QA 4J7AA 1PVOA 2I1QA 1HDZA 4LYHA 2QGFA 4KIGA 5EP3A 2HMAA 2JD0A 1RACA 1W30A 3AEYA 3N39C 1CY1A 3TDMA 5BVGA 3JATA 3AR3A 3WLIA 5BSUA 4B87A 4TKZA 3BMXA 2PLAA 1NW3A 4KQCA 4OUKX 3OPYI 4YJHB 4Z99A 3SJBA 3VTAA 1IN1A 5EYPB 4XOUA 2XOXA 4WL0A 2WJVA 3TBHA 4YXFA 1Z45A 1GLNA 2OHGA 1IM2A 1SBCA 2MMGA 2XT9A 4QARA 3EVAA 3BCHA 4BZXA 2OBMA 3A9CA 4JASB 3ZZTA 3H6GA 4W63A 5TR9A 4LXGA 1OUMA 2RH8A 2W0SA 5LDGA 4E21A 1AHPA 2Q0SA 1KVUA 1Y9JA 1D2GA 1L5VA 2AWNA 2RI0A 4OLAA 3H1BA 3O21A 4LCEA 1GR1A 2QTMA 2I6TA 3BTUA 2CNLA 3VGPA 1ZD4A 3I4CA 3GARA 3U26A 3BGDA 1I2ZA 3ZGVA 1VL5A 1Z4QA 2IZ1A 1ST3A 1KZ9A 2ISCA 3BMOB 2WB4A 3HKEA 3PDHA 3QLTA 4G41A 4LBZA 4YA6A 5D3QA 3SFZA 1O9HA 3GX1A 3ABOB 5AOVA 5T41A 1V2HE 3LUGA 2OGZA 3DV9A 4G0XA 4GSYA 4MPTA 3VMMA 4QEKA 3JWPA 4U7TB 1G5HA 1OWOA 3NIGB 5SICE 3CGGA 2XKAA 4F06A 3H4TA 1XTJA 4C5CA 1PWXA 1PS8A 3HSSA 3OKAA 2UZ1A 4NMLA 3NHZA 1KAOA 3AHCA 1QO7A 3TLGB 3ZHTA 1HSZA 2EGUA 3OD1A 4HYQA 3MOSA 4QUBA 4YV7A 4HX2A 2XMPA 3PHHA 1X3SA 4G9BA 3WQSB 3A4VA 3ESAA 1CY2A 1PWHA 4YP7A 5B6PA 3ITEA 4QJBA 2VPZA 3TLKA 3M5WA 1DADA 2FPIB 4FGZA 4TV8B 4AMGA 1GAEO 3I53A 1N2JA 3KHKA 4TL7A 4OHCA 2X1MA 3QVVA 2CXPA 2NUBA 1RYMA 4H31A 4GI2A 2UAGA 4JI1B 2FZKA 5TQVA 5MN6A 1V1MB 3R20A 4DMCA 3ZZ1A 1TD1A 1N6LA 4FWBA 4ECEA 2GN2A 3K31A 4L8VA 5G02A 4RTSA 1MOZA 3GEHA 1CUJA 6REQA 2PH5A 5AIBA 3LUCA 5K01A 3COYA 4DMGA 3C3KA 4PZPA 3S2FA 4F4UA 1WCWA 1WW3A 1DTWA 1EVQA 1PV2A 2WSIA 4S0XA 5ARDA 3RVMA 5KMGA 1P4HA 4Q16A 1FRZA 1OCEA 4TRJA 4G5OA 2I6SA 2NPFA 1Q17A 4B84A 1XTBA 2G3YA 3R5FA 4BV3A 3ISJA 1S3SA 3AYXB 5EXPA 2FEXA 2GJKA 3BUSA 4KP7A 3EIFA 1VJTA 1CUGA 3VSEA 2K7ZA 3S1LA 2XB8A 2J08A 3SDZA 1CK4A 1K63A 1TYCA 4U4AA 3WJ2A 3F6EX 4RA9B 3ZDQA 1E62A 4F6CA 2AIRA 4F12A 3FDZB 5KOHA 5ALNA 1EM8B 3EGOA 5IYZF 1GTVA 1H9AA 1SXJA 3QOFA 3BORA 4WZBB 5FWDA 4AS2A 2V7WA 4BFWA 1IPEA 3HADA 4R4JA 5M34A 1SUIA 2ATVA 2QBYA 5THQA 3QNUA 4BGVA 1GGFA 1ZKDA 3R3YA 4R68A 5BT9A 3S7TA 3RJZA 3MJHA 1J90A 1NI3A 3Q6MA 2R9VA 4K81B 2AOTA 5DHPA 3SKVA 4TMFA 2ZB8A 1R6VA 3A11A 3OCVA 4C04A 4MUMA 3B7PA 2XITA 3SSOA 3WSWA 4FIZA 2EU8A 1U02A 3EPHA 4F7WA 2QRGA 3ET5A 4TV9F 1DPFA 2NUPB 2W6OA 4PYMA 4A8JA 3CUUA 2H5IA 2W7TA 3RGGA 4KDEA 1EVJA 4GX1A 4TLAA 1MG5A 3GFFA 3TBKA 1N9KA 2PS3A 3CBQA 1ICIA 1U3FA 3DVSX 4NMMA 3OZIA 3VTZA 5FTMA 2GCOA 2NZUG 2RDMA 1W4AA 3CO0S 2FZVA 3IULA 4XM2A 5G0TA 2GRUA 2QL5A 4D96A 4XIYA 4JOCA 3WOHA 2YV2A 2EZ9A 3GYGA 2CXSA 3C5VA 3RU3A 1Z47A 2JBAA 1E9BA 2VRCD 1SUPA 2BI7A 2F17A 4M8KA 3O4GA 3UB3A 4JI3B 3PQ7A 4NYMQ 2OFFA 5A1JA 4P4NA 3UMYA 4EGAA 4FONA 3FCEA 1UEXC 2IHVA 4N9WA 1KXJA 3X2FA 4EW1A 2DKOA 3GUHA 3WYDA 5E95A 1TCAA 3EBPA 2ZXFA 4TMYA 2Y1DA 5CFNA 1A98A 2EX1A 2FKNA 1RHQA 4Q9JA 3W9SA 3WZLA 4B75A 4KEAA 4UHHA 3B3JA 5BQXA 2GHRA 2C94A 3SWWA 1GZ6A 3UK1A 3LCVB 3O3OB 1TIBA 1C8LA 4U1RA 1USKA 3W5VA 1L3BA 3HB0A 4D9CA 1LI4A 3NANA 1J5PA 2O6HA 3QVKA 4QGFA 4X6XA 1NLYA 4KQXA 4Z1OA 4TVOA 9LDBA 4EUKA 2VOEA 2HQSA 4NR0A 4U7JA 4N1AA 1POWA 3BL6A 4HMQA 5LQDA 3L7YA 4TKUA 3QVGB 1SELA 4YP6A 2HCJB 1SC9A 3HV2A 1TYEB 1YDFA 5D1HA 1J22A 2X4GA 4HYYA 1QHEA 1BXZA 1AUXA 2C00A 3BFXA 2YWXA 4TYYA 3MG9A 4X41A 2JH8A 1N5LA 4MS1A 5TMDA 2TS1A 4AZ3A 3ZK8A 2ZJAA 5CHEA 5IZCC 5CT8A 3ZDBA 3I39X 5EXSA 2WF8A 2R7MA 2VDLB 3F5FA 1Y0BA 3B38A 4YMLA 2R97A 2GN1A 1QFMA 2BJHA 4KX3A 1EZZA 2C83A 2WIBA 3ECSA 5C1IA 5IJ0B 3H11A 2PVCA 4M98A 4MUIA 3VU0A 1FTGA 2RHWA 3ZGXA 5E8RA 4KWTA 2NVUA 1UMDA 2XOKA 2ZIVB 4DF3A 4TVKA 3TD6A 1DXQA 2CV0A 1SO8A 1XD8A 1U0SY 2W70A 4RZ3A 3FMVA 1ZH8A 3LT5A 5GONA 4OQEA 3L0SA 4FFRA 4NBSA 2W6PA 4YK7A 5DF1A 1PDOA 2A9PA 2BCGY 2EP7A 2G4CA 2G9RA 3LQ1A 1KJQA 1DOAA 1UOOA 4IIXA 4B6SA 3OX4A 4B6PA 4JKOA 1NNLA 2GK7A 3DBRA 3HA3A 4HXFB 1OE0A 2C4HA 1YR7A 5CT5A 1Q21A 2R66A 2WA2A 3UWMA 3NHWA 3QE2A 4B81A 1WUIS 1DDIA 3BE6A 2KYRA 3EQZA 5A4JA 1RBYA 1MJFA 2HMWA 3KTAB 3UMJA 5CAEA 3V1MA 4R40A 1M2OB 1VLLA 3PZBA 3R76A 3A1TA 4J4TA 4DOMA 1Q1NA 3ZHYA 5HG0A 3ENWA 3KJHA 1Z37A 2A9FA 1QV6A 1U11A 3RJ5A 3O4HA 1HLGA 3SZMA 5BNWA 3AF1A 5BUQA 5AVZA 2RB5A 1V47A 1EP9A 3FGOA 4F3YA 4RDXA 2Z5GA 1NOKA 1YA4A 4G0YA 4UHJA 4ZC8A 1PFVA 2ECKA 1G8HA 2RGEA 4MA0A 3D3WA 5G53C 1JB9A 1SC1A 2YWRA 4KGVA 4HQOA 4P7JA 2OE2A 3KQUA 5FOXA 1T9GS 1QTQA 2H1VA 3GY0A 2WZDA 4P8RA 1PJZA 1N7GA 2EDCA 4JA2A 2IZ0A 3BAZA 4OYRA 5E4JA 5B3JC 4PGGA 3DBOB 4HFRA 5DLYA 4WGFA 2V7PA 1QU2A 4OA5A 4AIRA 1A2BA 1YJAA 4ZT6A 1O6BA 4FHGA 1TIPA 1Z8HA 4XR4A 1ODCA 1W0JA 2AMLA 2BEUA 3U4IA 2DQSA 4FU0A 3CSUA 5H59A 2EYQA 5AW4A 3D6AA 2XMGA 3WLTA 5JXHA 4X62B 5B1HA 3IXLA 3O1IC 4R7GA 1FYDA 2MMCA 5TS3A 1EWYA 1SU6A 1F2UB 2HNBA 2ZJZA 2ZRKA 2JH3A 3EHEA 1Z08A 1DB3A 4Q1BA 5DTJA 3RASA 4DQ0A 3A4YA 1CQWA 3ZK7A 3OFKA 2BGJA 1Q1ZA 3P27A 2C5HA 5EZQA 4GECA 4MR8B 4UQPA 4A0RA 5FBVB 1U4OA 2O0JA 1SY7A 2FUEA 4GZMA 2WILA 4RZSA 5LQRA 2PUCA 5FPKA 5AW1A 2WJ4A 3IR7A 3INRA 4EYQA 4RLQA 1DFHA 4YRMA 3MGBA 2UYGA 4OL0A 2FFJA 4N5DA 1XZKA 1PK7A 1QHGA 2PRKA 3K8QA 3S28A 1SKUA 1GEEA 1DI0A 4B8WA 5BV7A 4U5QA 3I9FA 4JEIA 4EI9A 2IS2A 1ENOA 5JPDA 3GDFA 1YR8A 4N3CA 2CCKA 5JCOA 1Q1GA 5M29A 4K05A 1QHHA 4YMIA 4UDXX 2J9ZB 1IPFA 4LZLA 5JJCA 4ARIA 2LDBA 5AVKA 1PZEA 4A6DA 4H6PA 2JJ2A 4M99A 1XBTA 3CZPA 1LXCA 1P0PA 1Y7LA 3LLUA 4M2LA 7GPBA 1WZUA 3M6AA 3NHPA 3WK5A 4A4DA 5L4SA 4F91B 4ITVA 4BNTA 4CDNA 3PJEA 2Y66A 1H1DA 3BE8A 1K97A 3QKIA 4BB5A 3GAMA 1UM8A 3DVAA 1MO2A 2XGGA 3G7SA 5FJJA 2DTDA 3ECCA 1E4EB 2I6QA 4BYGA 3UMBA 1YZGA 3O4RA 1TZMA 4HRXA 4O4IF 1NT4A 2ZZMA 1QVRA 4CCAA 2REQA 4KGZA 1PHRA 2WKQA 3TW8B 1DFIA 3BF8A 1Z9BA 1TLLA 1XGKA 1US8B 1Y1LA 2G08A 1AC5A 1U99A 4M0UA 3CYFA 3IBFA 1EG2A 3DHWC 2F00A 3RVNA 4E5MA 2DTEA 3GWGA 3CLUD 4FCVA 4GKAA 5C35A 5LKRA 4TS4A 1PYGA 4AMUA 5ECDA 1SK9A 2AOWA 5EVJA 2W6ZA 4E30A 3F4KA 2ILVA 3IPYA 3MCZA 1NNI1 3QFFA 2CBZA 4LJKA 1E2PA 5FTWA 3RBXA 4BAUA 3TIVA 1Q0QA 6YASA 1UKAA 1G8FA 4XB2A 3GLFA 1PW5A 1AG9A 4ZDIA 3DOOA 2D5IA 5DTRA 1FBTA 2AKYA 1HDYA 2GNPA 4MMXB 1UJNA 3TTVA 4EGSA 1ZZEA 4TT3D 1ZK3A 3Q5EA 3H1PA 1YBMA 3IQEA 1Q7GA 2CLEB 3VISA 4POOA 1WB5A 4HSGA 4L73A 1DFGA 1D4OA 1HRKA 3E0XA 2Q3FA 2G5PA 3OZBA 2B61A 5LFAA 5LWHA 2BFDA 1Q16A 4IYRA 2X9GA 2VDWB 2PX6A 2REOA 3GEMA 4K46A 4NBKA 4GBGA 1IY9A 4LTDA 1DEOA 1VYHA 2DJ5A 3DM5A 4ANFA 3ON5A 3F5SA 1TCUA 5F98A 3G2PA 1E4OA 3DMHA 5B64A 1RR6A 5HK9A 4LRWA 1GPJA 2XWSA 3A10A 3F97A 2WAMA 5E6UB 2PU5A 2OYRA 4N41A 4I6GA 3A2LA 4Z9FA 2PMCA 3C8UA 4B4UA 3AOEC 2G1PA 5SYMA 1EFKA 1GTG1 1G8KA 2E4VA 3ED5A 3JASB 4GUAA 3N8NA 4XI9A 1ZD5A 3RT9A 3F2IA 1NFRA 2B30A 1MVNA 4QNNA 3KSDO 2BFAA 3GFBA 1YOBA 3U4QA 1VRVA 1GZDA 2CCJA 1ECPA 1M8KA 1PGJA 3FNIA 5JZMA 2B37A 4OHMA 1PVVA 5K0GA 2O8DB 4BNZA 2IP1A 4HVAA 5H80A 3GPCA 2XEXA 4OSOA 4URYR 4AUNA 1WBDA 4Q5IA 4Z9AA 3WGIA 3E4CA 5EPOA 4JX8A 3M8KA 5K4AA 4WXRA 2C1EA 4KVGA 4MWCA 2XUFA 1ILWA 4CFYA 2HEGA 1XQYA 2BJVA 2QEQA 2XMQA 3QLVA 1UFOA 3LQ4A 5CVUA 1SOWA 4R0NA 4BUZA 4ZCTA 3DKPA 5C52B 2P90A 5H70A 2J7PA 4NOMA 3LX4A 1Z5VA 1ZCZA 2OXIA 4LYEA 1K7EB 4NS1A 1K5HA 1XTIA 2J3QA 2ZRJA 2BHNA 1VGRA 2HU2A 3C3DA 3KQNA 1SIOA 5DASA 1Y8QB 4RK5A 2QUAA 2B4YA 5LIRA 16PKA 5IC4A 2D74A 5FPHA 1C1XB 4H6VA 2JHPA 2WYVA 1YQWA 4DIFA 4IZIA 1ZONA 3SZLA 1ID1A 4AF8A 3VHQA 1M2NA 2BHLA 1WRBA 1ZMBA 4ZVTA 1NXVA 5I5GA 1MG0A 4EEZA 1YF3A 2P8JA 1NLFA 1WAMA 4QO7A 1X74A 5ILOA 2KWIA 2QW1A 4GLFA 3SJ7A 1HDGO 4YMVA 5K4HA 3RT1A 4Z7JA 2PSFA 1KH1A 4MA4A 4MW7A 4J0IA 3ORHA 4YRCA 4LZOA 5IAGA 4YV0A 2F48A 2QN6A 1WCIB 1KYYA 4EM6A 1NHWA 1Z36A 2R44A 2JKVA 4LY3A 3FVRA 2XYQA 1C7EA 1FYXA 1MZVA 2G5TA 2ZBUA 4E5DA 3RUCA 2CLOB 1SC3A 5T3YA 1VECA 4N6OA 3IBSA 3RFTA 5ESWA 2JANA 4J6EA 4OXIA 2ENWA 1GCIA 1EK2A 1EVYA 3OC0A 3QBTA 3UUEA 4GC5A 1OAAA 3PQ4A 1ZOIA 5DYNA 4PZ9A 2DERA 4UKDA 3AUSA 3C14C 2FETA 1X38A 2ZUBA 3D8BA 4FMBB 4RE5A 1Y3FE 5TPWB 5EZ5A 1QRTA 2A67A 2PR2A 4R9VA 2B7BA 3BZUA 1K68A 4UU7A 4LZZA 5IYZB 2PZ8A 2YICA 1G7RA 2Q3LA 4MVJE 4PC7A 2GERA 4IJKA 2JH9A 4YWHA 3PNSA 2Q6KA 1I80A 4GPIB 4HBGA 4IS3A 5A1TA 3R5HA 2VYCA 1M2VA 3EVCA 4YRDA 3SLKA 1DHRA 3Q3EA 1QRRA 1DKQA 1XF9A 4LDRA 2ONCA 4J9UE 4O5OA 2PZMA 2JLAA 4OH7A 4X8MA 3SICE 4TV9B 1CQIB 5DBHX 4UAJA 2G63A 4HDQB 2GCEA 4EZBA 2H8KA 1B76A 1X9HA 1QH9A 1LTQA 3S55A 2ZJ2A 3NOXA 1KORA 2YY6A 3ZJ4A 4LTNA 4C7BA 4ZANA 3AB7A 3OWOA 3ZIAA 1JMKC 1K8RA 4TZTA 1USVA 5KTMA 3WMWA 2C8LA 4D0RA 1GTSA 5LP1A 5ALSA 1ZO8A 1GPMA 1YIAA 4ZDJA 2GCIA 2V6MA 2QQGA 4O4HA 4CJXA 5JPCA 3ZDDA 2PLRA 3HH8A 4JN6B 4RKEA 3I04M 4K9DA 3JX9A 1JH8A 4BFLA 2QRKA 1L4EA 3I37X 1HZJA 1SKYB 2WJHA 3K6SB 2C5SA 5ALPA 1XXLA 1Z28A 2PT6A 2RHLA 3MMNA 4MI3A 3S2SA 3VHLB 5ALLA 1WF6A 4ZHQA 3ERCA 4GQAA 4LQDA 1Y1QA 3GF4A 1GCOA 3I58A 2LIVA 3NTOA 3NPMA 3OPYA 2ZE8A 5EJAA 5JHGB 4FFVA 3NBYC 3TRHA 3VC7A 5FWNA 1NVGA 1S2GA 1KDVA 4DXDA 1XZGA 4GL4A 4AUEA 1L7RA 2WU3A 3IR5A 4MWSA 1W36B 2H17A 4DY4A 4KAFA 2G80A 3HBAA 4IUBS 5LB2A 3AM3A 4DB2A 1MAVA 2B5VA 1J8DA 2I3BA 2GARA 3G1TA 2P1ZA 3HVHA 3NYIA 2YIDA 2XBUA 4H08A 4OAOA 2H57A 3FLEA 3FSGD 3CUVA 1JQKA 3RFUA 3ZHXA 1P2FA 1Q0PA 2EXXA 4DCPA 421PA 3THXA 4YCLA 5TARA 3U1VA 3JQ9C 5AO9A 2WVAA 3EB9A 1ZLXA 1SM4A 1X14A 2P5YA 1BOFA 2UYOA 3JQPA 4G63A 1OBVA 4R8RA 4WX2B 3G5UA 1E4YA 4BVBA 3O5AA 1Q20A 3OPNA 4IUDS 4PXSA 5AVVA 1Z25A 1MGOA 1DZIA 1RMQA 2XE6A 4IKOA 4TMXA 1EEHA 1IZZA 2GEUA 1JFFB 2F1HA 4LWZA 5TB5A 4MVJD 2QYHA 4C08A 1EFCA 3PHIA 3WZMA 1PV4A 5EE1A 3CH7A 3ZV4A 1LCIA 5CFLA 1NRXA 1XTVA 5IAOA 2RIRA 4EK9A 3R44A 1S2IA 2X9NA 3N05A 4RQUA 4DSUA 3JZMA 4Q4HB 2Z30A 3PXXA 4IH4A 4W7HA 5BXYA 3BX1A 4PYQA 4M4SA 2XCIA 1XIVA 3RK0A 5IDQA 3WADA 3UJ6A 3KOOA 1ZCJA 5HRCA 2W2LD 1NDQA 1VL1A 4ZZ2A 1UJ5A 1C2TA 2CXTA 5H3CA 4KXMA 2YTZA 1ZD1A 5HKAA 2C58A 2ZUUA 1ZN9A 3TB4A 4NE7A 3AVQA 4WK4B 1D2AA 1BZYA 3D6JA 1ZX1A 5LSAA 5JYEA 2K5UA 2GD0A 4PYKA 2OCBA 3UK6A 5FV4A 1VCHA 5ALTA 2YVUA 5JVDF 1AT1A 1C3JA 3CLRC 1KMHB 3LY9A 3OIYA 4FDLA 3V4PB 1I4TD 5FBRB 1JT2A 5IK2A 3E9DA 1E59A 1W4RA 4M9UA 2C03A 3WGJA 5BPHA 1X7DA 1H2FA 1ZCFA 2EKBA 3AFOA 3C1TA 4LYFA 3CPSA 2A8YA 5HKKD 1F9EA 3N8IA 4RKRA 4AO7A 4PZZA 2AK2A 1CB7A 5AKEA 2YOGA 2X9QA 3I2IA 5LB4A 1HDOA 1Q7TA 1NSTA 3HL0A 3W7BA 2RG1A 3WXMA 2FMXA 3GG2A 4N12A 1MQ9A 1UQUA 5EE0A 1BNCA 4CKCA 1LC3A 2F3UA 3F8WA 3Q10A 1GT6A 5JNWA 4Q7JB 6LDHA 3DO8A 4ZZ3A 1EFVB 3HWX1 1Z2OX 1ZGBA 2OP1A 3OX3A 1JT9A 1I94B 3SHOA 2CKMA 4N3BA 4ETWA 1BC5A 3GCZA 2Z4RA 4DJAA 3DFKA 4DMHA 1LK7A 1PSZA 1X77A 4JC0A 5DM60 2D8MA 5DHTA 2CL0X 2ZT5A 4X20A 5HIMA 2O54A 1Z0FA 2CB9A 2DKNA 4B3XA 3AK4A 1UWKA 3MQ4A 5TF0A 5KYXB 2JGDA 2P1DA 1U4NA 3CZAA 3IOEA 1A77A 1APBA 5CA0A 2JFOA 2AZTA 2OSBA 4BKUA 4JU9A 4KH1A 4KKVA 4IW3B 3PFWO 1JG3A 1BEUB 1RI1A 3O0TA 4GOND 2JCSA 4PY2A 1GTMA 3ID6C 3HKEB 1DAPA 1E2QA 4OXRA 2RHBA 1M6NA 2GZ3A 1R0ZA 3HA5A 1IBMB 2J31A 1KAHA 4ZI2A 2ZI5A 2GFHA 4AICA 1DC7A 3OFVA 2RMKA 4TS3A 2J3EA 3BIJA 3QXXA 5C3UA 2UZ1B 4ER6A 5LQAA 4Y1RA 4GZ5A 4OB7A 2ABWA 1FRVA 2ID4A 4RENA 1GL9B 3RIMA 3HCCA 1WZ2A 1QYWA 1TRKA 2JAQA 2CWWA 2D5CA 3SGLA 2PT5A 3RK1A 1PN3A 1U0OC 5I7SA 3N58A 1P4AA 4L51A 3T9CA 1YS2X 5EN4A 2QZZA 3ONNA 2FX2A 2QX7A 1HR0B 3FTEA 3L7KA 3SMQA 5H68A 1TC2A 3U4DA 3ZNOA 1R4NA 2AUTA 1PK9A 2EV9A 4ZARA 3DZKA 4X66B 5EJ5A 4XIGS 1KYXA 1NZFA 1WDMA 2XYVA 1A5TA 4Z3KA 3ZE9A 2PV7A 1MX5A 5TQ2A 3FTFA 1FDVA 6REQB 1V5IA 4QPJC 3WGVA 2XKKA 4O4IB 1C8KA 1QNFA 4MO2A 3U49A 2HZBA 5B3AA 1U6IA 3RFCA 4NXMB 1XWIA 2R47A 3OI7A 2BEKA 2RGGA 3FHTA 2H2HA 1NOJA 1H3FA 5CLQA 4HD8A 5C32A 1EP2B 3PWSA 2IXGA 3KJEA 2Y9PB 4X7RA 5KMGB 2ZRNA 2ODTX 4RK0A 2ZSIA 1H85A 3W5DA 3BOSA 1Z06A 4R54A 5C5IA 1O1YA 4AY6A 2YV3A 3K2QA 5AM0A 1ENZA 1PG0A 4LVCA 1NMZA 1JDPA 2BFCA 2ASVA 2XD4A 4JGIA 3IGFA 3PEWA 5CIYA 3LM8A 3UJNA 2AFVA 2DLNA 2QMUA 2Y68A 1XVLA 3KEOA 1OHHD 3R0ZA 3NYQA 2HIHA 4KBYA 5CM8B 5ALQA 2P2GA 2ZAGA 4HF7A 1T6XA 5DNAA 4DCCA 4DA9A 4DRXA 2IV7A 5KS2A 1BO6A 1WD7A 2GJ4A 3FDJA 1KZHA 2MJLA 1Z33A 3H6KA 2R60A 3WRXC 4RGVA 1N92A 5AW3A 5KYUB 4RAQA 5KYWA 3WLFA 3TW6A 1G17A 5I9LA 4EBFA 1JKJA 1JIXA 1NKVA 1R6AA 1SXJB 2D3WA 1ZK4A 3ES9A 1Z5PA 3IAHA 4KQIA 4M38A 4P7FA 1VLZA 2CHVA 2NXCA 2VP4A 3GLSA 3SIWA 3VSDA 5K3DA 3IP3A 5LZ9A 3OM8A 3R6TA 4D92A 2CNWA 4MI6A 1FYEA 4ISBA 5SZIA 5BOSA 4Z4GA 3ZLTA 3AINA 2HI0A 1J2EA 3C74A 3Q2IA 3TQRA 5JAPA 2XCSB 3OF2A 3S40A 5K03A 1BFUA 4R2KA 5EINA 3EUAA 4M1SA 1RFLA 3MT9A 1N5OX 1VE7A 5JADA 3K0HA 3ANYB 4IHQA 1U0LA 3GZNA 3CTPA 1R16A 2ARKA 5FPPA 4JQOA 4R9RA 4A91A 5IX8A 4CL8A 1DUVG 1GDTA 3D6FA 2PHZA 3WHLA 2BLLA 3MM4A 1Z74A 4HP8A 3O95A 3VBEA 5IDYA 1ZSYA 3QXSA 4NF2A 2AZMA 2GCOB 3RJ9A 1TECE 1JHQA 5HZMA 4IHJF 3PTAA 4TVBA 1IK6A 3QBJA 4GQBA 2LE0A 2Z57A 2WM8A 3IESA 5HZKA 2WYOA 4NZ9A 5J1SB 3WA7A 2YMQA 2CFRA 4DLRA 3KX2A 5AJUA 2YJ6A 4O4HF 3I73A 3P9SA 5KKAA 5G3ZA 4IS2A 3PDCA 3WL5A 1Z6QA 4QASA 3SP1A 1FDWA 4R84A 2DWUA 2FLWA 2X6RA 2P9FA 1NG1A 2WWFA 4R2WA 3UXYA 3A6LA 3A8TA 3L93A 3D3QA 4MYSA 4ENRA 2EJCA 5MFPA 2XZOA 5I9MA 2BFEA 4YUYA 3CJTA 1RW4A 1XVUA 2POCA 1K27A 4BC0A 4ZHQF 5KYYA 4MV4A 1OREA 1HTWA 1T9DA 2AEEA 2AXPA 2ZKLA 4FOTA 4YUZA 1QP7A 2ZYTX 3LHIA 3SS7X 3AKDA 4BTLA 4FUTA 1U1GA 1O08A 3KEQA 3MF4A 4HDOB 4Q34A 5AJVB 5KNLA 1IOZA 3IHWA 2PYDA 1NYRA 1YE3A 3N7AA 3VR4H 3QLJA 1IRXA 221PA 1Z83A 2QV7A 4Q0MA 3D7SA 4QUJA 1V95A 4HNRA 1A9SA 2KBFA 4G36A 2I55A 3VYUB 4A0GA 1Z82A 1H69A 4E11A 1YJXA 3DLTA 3HBJA 3F73A 3VU8A 1WBBA 4WVLA 4RXUA 5TEWA 1H0KA 2IEIA 4LWPA 1R0WA 1F38A 3RTDA 4ZK2A 1UBJS 1BX1A 4DRZA 4KSYA 2XTNA 4GW3A 4MS1B 4KITB 3O8OA 2C99A 1B0AA 3B60A 3H2SA 3IEIA 1OH7A 3LNTA 4DV4B 2GZ2A 4K9RA 2P79A 2XLBA 3CNNA 5FNZA 2R6AA 3BJRA 1ZJYA 3OA2A 4K6GA 3ZHRA 5JU6A 2D0OB 1XTRA 5ED4A 1HYBA 3IAEA 2C54A 1XROA 2GOYA 1EBBA 2QF7A 3U5ZB 2HL6A 5GVRA 3IDFA 5DNUA 1R0XA 3DKVA 3PE6A 1UMDB 1R3UA 4QDZA 2Z4SA 3D8UA 3P2JA 4MICA 4QQRA 4EA7A 2Q8PA 2E9SA 2VP5A 3EA0A 1KI2A 4KTVE 2YBEA 1YZNA 3FYHA 5E2AA 5BYJA 3GCWA 5TT0A 2V54A 2WKRA 1BVRA 3E9MA 3DMNA 5DP1A 5DX1A 1X70A 1E2HA 1M6VA 3HUUA 3VH4A 4YV1A 5JLJA 1LK5A 5BUZA 4GDFA 4WH0A 1GZ5A 3O75A 3DBRB 3D4NA 3T6KA 5J2UF 2XUJA 4FILA 1B8PA 3SK0A 1SBQA 2LVBA 4H35A 1N6IA 5HYVA 4KLRA 1NNEA 4K0KB 3QFCA 2PBRA 1E1QA 1QZZA 4RLFA 2VXCA 5HUQA 2YS7A 3O8LA 2VTVA 3U5TA 3CMMA 5J5CA 3S7ZA 3WHPA 3NGXA 4QREA 4DLVA 3Q98A 3PF8A 2BGWA 4DNPA 1GLGA 1H1TA 4C1NA 1E5LA 4D02A 2ZI9A 2A57A 4R8KA 3NIWA 3W4KA 5KQGA 3SHQA 1BHSA 4RMGA 1L7QA 1ZAKA 1Y81A 5BNFA 2AYYA 2R8ZA 3ND7A 4QOGA 2PUWA 1ZJ4A 1TZBA 2O5RA 1HUQA 1N75A 4MB6A 4NJOA 1UBKS 4OA8A 3S5JA 1FFSA 3WRYA 1CNMA 1S3GA 1G21A 5DTIA 4BQPA 2BSAA 5AH0A 4EFMA 4EVQA 3A25A 2VN8A 2YW2A 5FI3A 1U2SA 4KREA 5LMCA 1EPUA 2CXRA 4AM8A 3Q8WA 1HYQA 3ZW9A 4C4SA 1LI5A 3C6XA 2R8OA 3WL4A 2RHHA 1L7EA 3JVIA 1T9GR 5BVHA 4FFLA 3EJWA 5I7RA 2FRVA 1GU1A 3BILA 3MBKA 3P71T 1F5NA 4TL9A 4MI9A 1JR3A 1QHSA 2QRVA 4IQFA 4H3KB 3FSRA 3QFSA 4E2YA 4EGCB 4GS5A 3HXQA 3FKSA 3EG5A 1HNXB 2P3SA 3OZVA 2IYWA 3EMDA 4XCQA 3ZQUA 3W6UA 1IXZA 4MUNA 3OY7A 2CDCA 4HDRA 2XQGA 3CLTD 2F62A 1LV7A 3D6VA 3KOWA 4ITRC 4L74A 3DTTA 4OIFA 4TQGA 1JR2A 4EMUA 3BS4A 4LY9A 1Z6XA 4MYCA 4F6RA 4FXOA 4A5SA 4ZMRA 4KHPB 1CRPA 2QL7A 4RNDB 4NVRA 2VYVA 4I81A 1TPYA 3QVLA 5JWOA 2L69A 3EARA 2OEPA 1CPYA 5F64A 4M54A 1I7PA 1TTHA 1XQXA 2VUUA 4W8OA 5KYNA 1QIIA 3HN6A 3L1HA 2CJPA 1BU8A 1PD1A 3A1WA 1FL9A 1QOQB 1TT5A 1HBJA 2OB1A 4MRAA 3SZGA 1VE9A 4Q82A 2F3PA 1W88A 4GMXA 5AYVA 1NY6A 3I8OA 5GVSA 1P75A 1RRGA 3GLHE 4JHLA 5CDYA 1P3Y1 3I8XA 2PUJA 1F06A 1QHHB 4L4SA 2AZXA 3MTGA 3RSQA 2XMSA 1NVUQ 3GP3A 4TSFD 2KM1A 1HFWA 1BXRB 2H08A 4HSEA 2Y92A 1XSEA 4IDQA 4NFLA 3UFXB 2C7OA 3HUTA 3HNOA 4TYWA 5DZSA 4LJ6A 4KAAA 4IVNA 1M76A 3N2IA 1ZZGA 1BDBA 3B3FA 3I83A 5LZ8A 4S3MA 2J0VA 2PRSA 4M9QA 3UMSA 3DVAB 5FI0B 1AQIA 1NNUA 4XPIA 3F7MA 1J56A 5EKUA 3OO0A 3F1KA 3DC2A 2BTOA 1YVRA 1LWOA 5AHXA 3I61A 4KPYA 4YT4A 4B83A 4QPZA 2ZOSA 2QTFA 5KINB 1RQRA 2C5BA 3IMGA 1ZIXA 5G4KA 4ZCLA 3VTKA 5TDHA 5FQOA 4CMIA 5AD1A 1BMDA 3MK31 2G67A 2H07A 2IHUA 3A37A 3TPFA 1PR4A 4DLTA 3SC3A 2VCYA 4JITA 4YDQA 1O95D 5HOEA 4E4YA 2Z9CA 4B3GA 4PNZA 4N5NA 3C39A 1SXIA 2HK8A 3L7LA 5E9WA 4E2WA 4CLRA 2G40A 3FPBA 1NXPA 1JXQA 5EXDA 4P0PB 2C5LA 2VJKA 2OXEA 5H82A 1D2NA 2MYTA 1DAEA 1EINA 1TYDE 4ABTA 5FBQB 4F8YA 3PP8A 1O94A 3IAUA 3HO8A 4N01A 3GLFB 1U6JA 4BNVA 1ZWLA 2JFQA 4YYZA 1IVSA 2P40A 3E22A 4PYLA 2QI9F 4G8BA 4UEOA 5H81A 4OV6B 2ZJYA 2WHPB 2O7NA 2H59A 2HLDA 3MFYA 4MVCA 3THOA 1SZPA 3MYYA 4BQOA 3DLHA 1FNSA 4WSOA 3SX0A 2BMWA 4MROA 5CB8A 1D0VA 2BFDB 2JASA 1X6VA 1CDOA 1DAMA 1HPLA 2QTWB 4PHCA 3RB8A 2WT8A 4I3GA 1MO5A 4H6WA 621PA 721PA 1ZH4A 2W6MA 4TTRA 3HJUA 1DIHA 5F1KA 4CG1A 1ML4A 4X3PA 4EENA 5AI0A 3L9XA 3FVTA 2GILA 9ABPA 3EHDA 3RD5A 4Y2VA 4Q1DA 3C3AA 2PJDA 5DNDA 2BBSA 3NI2A 5BQFA 2IEBA 2FX5A 1PJ8A 1R8SA 5I9NA 4AJ9A 2O2EA 1CUUA 2YCBA 3LHSA 3U7HB 3PPIA 4GSLA 4JYPA 3S2UA 1DNPA 1E2EA 2RGNC 5EMNA 3N1UA 4Y1EA 2X5JO 2OD7A 3WIEA 4BBAA 4G23A 2ZRDA 3L1IA 4E33A 1IWBB 2Q1UA 1E9SA 2KPOA 1RSZA 2OXTA 3NBZC 5KIAA 1TO6A 2WT4A 2JGEA 3KXKA 4EKNB 4QEZA 1Z7BA 2QUZA 5GJVC 4EY7A 1K5DA 1XQ1A 1ZHHA 3I2JA 3WIUA 4ROSA 4A5OA 2VRBA 4NJMB 4XJVA 1YQGA 4UEWA 4O63O 3T3NA 1CYEA 1P8JA 3ZE0B 1TAQA 3F8SA 2VHTA 4QGBA 3W5SA 1X2EA 3UO8B 4NE9A 1U7OA 3G0GA 1OXXK 1Y82A 4Q4DA 2LCQA 1XU7A 2ZRPA 3HCBA 1HURA 4BYMA 2B1QA 4K8RB 2OD9A 1K9VF 3A27A 3DEJA 4GQIA 5CX1A 3CLSC 4JP2A 4BJHB 2Q45A 4DARA 1ORWA 2B78A 1FXUA 1MDBA 4ND8A 1JHZA 5CJ2A 3B52X 3MTIA 4GLLA 2AB0A 4P92A 4HN2A 2MSNA 4PNPA 3OE4A 4Y0NA 1ZRMA 4QQNA 3S99A 1D3AA 3WWEA 3VHXA 1OX6A 1U80A 1P44A 2HA4A 1NVXQ 4B3CA 1OX4A 3HU1A 4RK1A 4ZICA 5AQ1A 4KHZA 4K9LA 3KAJA 5FTLA 4Q4CA 1BGXT 5LNK1 2EKPA 2Y99A 1L9XA 3BFPA 2BM9A 2FP3A 3MTQA 3WK7A 2VDVE 3AOGA 3THWA 5JWHA 4KGXA 2JLVA 4OHVA 2ID7A 1GPDG 3FTPA 1F51E 4M22A 4RZUA 4DM4A 4Y0VA 2FZCA 3ONVA 4TL6A 2VJCA 1L8LA 2WG2A 4B3HA 3FTCA 1C7QA 2HK9A 2QLBA 3PI7A 2DYKA 4QNMA 4CF3A 1L7PA 3RS4A 1LVGA 4PW0A 5A3JA 1X1EA 1GFSA 2RFLA 3GT7A 5LKAA 5DSTA 2PPVA 2J45A 1Y4DE 4GVXA 5B1EA 4FDAA 1P3DA 4K8OA 4RCVA 1RXVA 3UT5A 3IUBA 4II3A 1UBTS 2B4KA 5ENZA 1WOYA 4OI1A 3UGQA 3AB3A 4WERA 4Y0AA 3S3TA 1JFTA 2BEWB 2CLHB 1W49A 2V0NA 4W9NC 1ISGA 4G85A 5ALDA 3EX7C 3SIRA 4KDRA 4QDOA 1G3UA 4ZT7A 2ZB3A 1XRMA 2W43A 3O84A 1Z88A 1WNTA 4V39A 3RS5A 2I2XB 2O57A 4Q1CA 4TLMB 3RSLA 4FBGA 4RNCA 2C78A 2GPSA 2HFJA 2BVNA 2OP0A 2CHFA 4IIHA 3VPBA 4FDVA 4CM8A 3EZXA 1E9VA 2GF0A 2LKDA 2VA8A 3L6CA 3HR8A 1XTKA 4KXYA 5EQFA 5J63A 4RJJA 3TJMA 4ZV4A 1I3LA 2WJIA 3U40A 2X4LA 1Z6ZA 2R4TA 4QVKA 2EJWA 2AHRA 2EJTA 3ADDA 1W6UA 4F3NA 3GCDA 3PIDA 5DXFA 2WIFA 2O6LA 4HTAA 4C88A 1G9TA 2FF7A 3CC8A 3BE5A 4IHJB 3W0LB 4UTRA 2JJQA 4K9OA 2DFVA 1UK6A 3AP2A 5BSGA 4LK3A 2VWPA 3I9LA 3IUYA 1PKXA 2G36A 4B6EA 3MINA 5EFOA 4C0LA 3TG8A 4KPGA 4O4HB 6ABPA 1NIJA 4YGXB 2CNOA 1Q6YA 2Q1SA 4NCAA 1W2WB 3HHEA 2FW0A 3HY4A 4IXTA 1QHFA 4FLFA 1EQUA 4LRUA 4ZVQA 3WX0A 2BUAA 3EDCA 4XSVA 1ULUA 1WCXA 3AGPA 1KEEA 1YQEA 4OMFG 5D7BA 2PZJA 1T1RA 4ZHQB 3KUCA 1UQTA 4X84A 2YZKA 1NUHA 1DWPA 4ZRDA 5LD2B 4KAXA 5FTJA 1BX0A 3IBYA 3KFVA 3MCUA 3AIIA 2QRMA 4HN4B 3OPYB 1W85A 4WECA 3ZKWA 5BWBA 4O4JA 3SE7A 2OMKA 3A9VA 3EXHA 4F9TA 3KJNA 2EERA 1VL6A 4EQ6A 3A4TA 1ZA2A 3H4VA 3O83A 1ZQ9A 4N49A 2OA0A 3WV5A 1HGXA 3LRTA 5IWAB 3ORYA 3VH3A 3I9KA 4TROA 3HDQA 4EARA 1NVKA 3TLAA 1T8PA 1S9HA 3RSGA 4DIEA 1CBUA 3RRZA 2FQXA 4L22A 5DYWA 1G59A 1OI4A 1T9HA 1YVUA 1E58A 3MWJA 3PFIA 4L3VA 4M8SA 3THXB 4H17A 3AR9A 2H2AA 1EFHA 2VQSA 1P31A 1VMAA 1JJFA 2ZRAA 2IPOA 1L5OA 2GBFA 2G7ZA 4P3OA 3RG8A 3TLEA 3KQKA 1IN5A 2WMOB 4PCLA 2VJDA 3AMVA 3UOAB 3OBBA 2JNWA 2OM2A 3FSJX 5DYGA 2FZLA 3GHYA 2NZVG 3HLTA 3Q11A 4L8WB 4N5IX 2EVWX 5TQ0A 5GAJA 2ZR0A 4NECA 3A9RA 2V0CA 1LNQA 1C7JA 3T1HB 4V0MA 5C8VA 1RYNA 3SEQA 3TNLA 1GU7A 4YJKA 1LDMA 3N6VA 1WMFA 3L49A 4KXLA 3PXEA 4N6NA 3RLFA 4D26A 2VT3A 4COKA 4MP8A 1EHIA 1BGWA 3UKJA 3U3KA 4MKZA 1O54A 5J2UB 3WBJA 4DREA 4GBJA 5CVCA 5F52A 3PJFA 5E0KB 4A15A 3AFHA 4QQFA 5CLGA 2IYAA 2YFHA 3ZGLA 4DHWA 3P0RA 2FEKA 1PJSA 5TC4A 2VJPA 4TS9A 4XQ0A 1HLDA 1OILA 1YB6A 3T5AA 1T1IA 1U63A 3ISVA 1WO8A 2YXNA 1QOZA 3EOZA 4AECA 2POQX 1P1KA 1WPXA 1ZCAA 4PG8A 4RKWA 4M0EA 3D02A 2A0KA 1D6SA 2FSFA 1RRFA 4YY3B 3CUKA 2XF8A 3PZRA 3OZGA 4HDCA 2GEFA 2QN9A 5B55A 4B6RA 3QEJA 1PK8A 1YI8A 2I9PA 2HMFA 2QTNA 2Q5FA 3DOCA 3DQZA 3GROA 4FEYA 1ZI9A 1F2DA 4NCJA 3SQDA 3AXSA 3UUGA 3ZWMA 1A72A 1O6GA 3DAOA 5IRCD 3A3YA 5I4IA 1JX6A 3QVXA 4MK4A 1RIIA 3WVNA 3R5XA 1R6DA 1E2BA 1UBEA 2D5BA 2OZLA 2VSFA 2XMZA 1N9GA 5A5EA 4ML3A 3EVBA 1M7BA 5BRJA 3WWPA 4A8HA 3QK7A 1ORTA 4PZ0A 4PHHA 1RAIA 5EIWA 1XKTA 3M2PA 4GYKA 2A9KA 3HKBA 4X20B 4X44A 1NVDA 1C9EA 2NTJA 3NJ4A 1NAHA 4BX9A 1O6ZA 4X8OA 4PSAA 4RJIA 1WQ3A 3TCNA 5JJIA 1QHNA 4AJ2A 3IOCA 3KLMX 2JGDB 4YHBA 2PZKA 3LLSA 1EXMA 4M89A 3B9RA 1QGDA 1E3QA 1BDIA 4UQLA 2Y1WA 1CVRA 2I1LA 4IYJA 1H22A 4ZTBA 5FO0A 2QTRA 3TX2A 3FMFA 1E94E 5IBCA 1TUIA 3LVFO 5A3VA 5C1OA 1Y8AA 1NVWQ 4NYMR 3UM9A 1FFAA 1QWSA 3QU2A 1EWQA 4XJXA 4IJVA 2WAXA 3F3YA 4EELA 1Z17A 3JRXA 1NC3A 5TJHA 1G5RA 3QJ5A 4KMOA 1SVUA 2DAPA 1U0FA 2XADA 4NENB 2M9MA 5EP2A 2WY2D 5D5HA 3AB2A 2E4YA 2ZWMA 2OC4A 3SF0A 2YN0A 5ESXA 1CRQA 1HSOA 4PSKA 1JI0A 1OV4A 2CXUA 2Y1GA 1Y7IA 2BR5A 4PV7A 4Y1RB 1V11A 1KJYA 3PC7A 5AT1A 3V33A 5L8VA 1FNNA 2CSUA 4PG5A 1HDEA 1ORIA 5K5EA 2QRPA 4HEA1 1TA4A 4S1NA 1GZ3A 1TKAA 4KE6A 4MR9B 4NZNA 4ZA2A 3UAGA 2WFMA 1OXVA 2H7YA 4YLGA 5FV7A 4QA9A 2PR7A 3M3HA 3FH0A 5KTPA 1SNYA 5KNDH 1R4NB 1X92A 2GBLC 4D4IA 5CLJA 2R3SA 4ID3A 4UAGA 1KDTA 4FI3C 4EB3A 5HQ3A 1C4XA 2HKIA 3I52A 3OLVA 4TT8A 4URXR 3AC0A 4TM8A 4D4LA 3KLNA 4D3DA 1UT8A 4YJGA 5TQ2B 1CXZA 3GD7A 4TVSA 3LCRA 2CYAA 2C0PA 1M54A 2C7BA 3T9FA 1RPZA 3C7TA 4IZOA 3FJYA 1DKMA 4WZBE 3TRFA 1KJ9A 2Z04A 4MZXA 2JA1A 5K8UA 3ETNA 4CKWA 1K86A 2JIOA 4UCFA 4X71A 5CITA 2CMGA 1YE8A 8LDHA 3DDWA 3I0NA 4WOPA 5E7MA 5B58T 2Y2UA 2BFCB 2AZ4A 1G8AA 2G0TA 3KKNA 3KZCA 3LAWA 1E1RA 2HA6A 3L9WA 4NCIA 2NUAB 1DE0A 3T52A 4YXWD 2FY8A 2E7ZA 5B7QA 2JHGA 2HYIC 3FOBA 1GPKA 4DRXB 1BVHA 3WO0A 4QUEA 3QWHA 1FS4A 2OUIA 3V8NA 2O4UX 5KYWB 3PI6A 2P30A 1KI3A 1OZAA 1EHYA 3FNEA 2P75A 3OPXA 3OHMA 4PPFA 4PQEA 4Y2YA 3GJ6A 3GJ7A 2R2GA 3KKOA 1JKJB 2A7XA 4PU0A 2H7VA 1LPOA 4EUEA 5KTYA 1K6XA 4GKVA 4JYZA 1E2LA 1I4LD 4AWXA 3JARA 2ZYRA 1G7TA 4I66A 3CVXA 5C8YA 4UDYX 3MPUA 1HETA 2IW3A 2FPXA 2XJ9A 2D2XA 3K2BA 3L05A 3LPAA 4RD3A 4ZAYA 1E2IA 2ZSKA 5CPBA 5AVJA 3OOEA 1KGSA 5JJ5A 1FU4A 3UGJA 2X6TA 3CNBA 3MAAC 4FR2A 4HVTA 2B8EA 1YQ9A 5H3HA 1O6CA 5A9SA 1LBQA 3GZNB 4R8VA 3LBFA 4KWEA 3QI2A 1QH8A 4NARA 2FQQA 3PFCA 4X6LA 4S2EA 1RWWA 1V16A 1Z7WA 2H7CA 3AUJB 1FQKA 4X1KA 3LC0A 1VCMA 2GK4A 4MV1A 3EASA 9GPBA 2VBGA 4N5HX 2QP4A 1OXTA 3T3EA 3V2GA 3DL2A 1JEYA 2IXTA 5FPYA 4V02A 2QVBA 4DA4A 2W2OA 4LF4B 5DNCA 2PQ6A 2FI1A 3K0FA 2IUUA 1RWKA 3TPZA 4W5OA 3TH5A 2O2CA 3OTQA 4F5EA 3RARA 2P9ZA 4YLYA 1KK3A 3NBKA 3I9JA 3GN2A 3ZWQA 5LQNA 2VHVA 5HPYB 1MB0A 1IONA 3DKRA 4FW8A 2PWYA 2WIAA 4NOLA 4BC1A 2WIDA 4MLCA 2BFEB 1HH4A 3MHPA 3EVZA 3W6ZA 1PLJA 5KYYB 4OP3A 1MORA 2OB2A 1N32B 1E1CA 1ST2A 4NJEA 4X7PA 1LX7A 2NSLA 3HEMA 4DHEA 1TO2E 5CW1A 4IOLA 2IY9A 4O4JF 1OFHA 2O1SA 4YCJA 3AQ4A 4A7PA 3K94A 3Q8KA 1Z7EA 4RADA 3OZRA 4X97A 1O97D 1MEJA 1NXQA 4FNGA 3M70A 4FTWA 3TIGA 5HKBA 3WIBA 3RVOA 1IJFA 1RABA 3BMQB 3FZNA 4RUKA 4QU0A 1ZWKA 4W7IA 3RUPA 3PNYA 2XCTB 3CU5A 2YH2A 3N0WA 3O8OB 1O4WA 4HX9A 4IINA 4QT0A 4WOJA 3ZCUA 1XU9A 4HVLA 5B4TA 4NCBA 2VUSA 1R5BA 3GO4A 2CD9A 1NLUA 1JIKA 1UBOS 3ANMA 2I99A 3DFZA 4IX9A 4MUYA 4Q7MB 4DLAA 4EHLA 3IUSA 4FP9A 5KWEA 4S1PA 1J42A 1ZXXA 1ECJA 1S8OA 2FN9A 3CLUC 4ZT5A 3N6RA 5FFMA 1ZNZA 4KO1S 3RROA 1SZJG 4RWZA 4W5TA 3IJPA 2P9EA 2XWQA 4C5AA 5E3HA 4NBNA 1Q2UA 5EJIA 2G07A 3SYMA 3F9IA 2FU5C 1ECGA 2MDTA 5K3BA 5AW6A 4K28A 1B74A 3LHDA 3HUFA 1N2EA 3MRTA 3GIWA 2FSPA 3OOWA 2RHGB 3P8ZA 3DOFA 3EQ2A 3PXBA 1X15A 2WOJA 4PWYA 3QKUA 1TNDA 4XTCS 3FWPA 4A6PA 2PMKA 5EEGA 4LPKA 4DIUA 2DVMA 5CLFA 1TM7E 3L7AA 4HKTA 4CDRA 4DWOA 2Q7XA 1RNLA 4RIFA 3NWOA 3VX3A 1YIOA 3CF6R 2NG1A 2ZTLA 3HEBA 2WZCA 3KXPA 1XJWA 2OUKA 4Y2QA 4KRGA 1QP8A 3LCJA 1O57A 5A05A 3H4IA 1X1CA 1LBEA 3B2EA 3T8YA 1IXYA 2ZT6A 5T8KA 4KQEA 4ZHSA 1DBSA 1MV8A 2ZSHA 4EG7A 3MB5A 5KQRA 2IXDA 2OQRA 4MGKR 3IKJA 3KT3A 3T0FA 4QODA 1JWLA 2W2XA 1QFJA 4UMFA 3WL7A 1AGPA 3ABZA 1G21B 3UHAA 1IZ0A 3MTEA 3RS2A 4B3FX 3H65A 3LWBA 4KMMA 4PXYA 4B4KA 4I50F 4MB2A 1L5GB 1XMVA 1Y9EA 2EKLA 4O2BA 4HGQA 1UP6A 5JAIA 4XKJA 2XWBF 2GD2A 5BVHB 1OLXA 4I3HA 4BU1A 2FN4A 4BQQA 3TKAA 2ONJA 3H86A 3RK4A 2YQ4A 1O9GA 3K1AA 5CCXA 1OB2A 1XCPA 2OC9A 3FLMA 2QE7D 2QRVB 1KOJA 1P77A 4PIVA 3MUNA 1WB4A 5HE9A 1RWMA 3BMCB 3CUWA 3ZCXA 1N2CA 2G1KA 3TSCA 1YH3A 2F06A 2PXHA 5U4QA 4LQCA 4COOA 3ESZA 1ESZA 1RPJA 3QWIA 3H1EA 5L40A 2LR0A 3WTBA 2FPPB 3L07A 1FDUA 4PAOA 2ODAA 2V1UA 2CL5A 4D9MA 5E7QA 1IRIA 1T9CA 3QA9A 1TU4A 1I3MA 3GQVA 4F6RB 2HSJA 2XMBA 1ZVQA 1RRPA 1XNRB 1P18A 4GOJA 1ZS9A 4XGNA 2NZXA 4E5SA 1OZHA 4I46A 1KQGA 3SI7A 1KEWA 2FDRA 2Z3ZA 4UTOA 2VPWA 1YS4A 2X1VA 2FGJA 2WKWA 4ETNA 4WFIA 5AUPB 2YXPX 4HLCA 4DV1B 3MWEB 3ZH9B 2ZE7A 2VZ8A 4KNYA 3VJKA 1TT5B 4H3SA 3L0YA 2JEOA 3D4BA 3RKUA 1H4TA 1W88B 5DDIP 1W6RA 1HG0A 3U48A 1T9BA 4JD5A 3E4DA 5REQA 1EK5A 3JAKA 3R7AA 1DWUA 1J0BA 1DX6A 1SG6A 1YQTA 4OCZA 8ATCA 1PTJA 2X2FA 1TK3A 3QFHA 4NICA 5B12A 3VR6D 3Q9LA 4NKRA 1Y6FA 1CQXA 2C9DA 5DBOA 4HO1X 2XMCA 2GTPA 1TB4A 1PGOA 4RL4A 3EYWA 4HS4A 2HXSA 1C3XA 1K88A 3VR2D 1P8AA 1UK9A 3EODA 1CEQA 1QGUA 2RHCA 4WT7A 4EFNA 2ZSFA 2WVHA 3HNRA 3HDJA 3LKVA 2VP0A 4BQNA 3LW8A 4KIFA 1K2WA 1GRRA 4UHDA 2FWJA 4FYXA 1SCUA 4XGIA 2VTBA 2Q8NA 3N8GA 5AVUA 1T3LA 1JB1A 3P4XA 4B3SB 4GP9A 1SD2A 1XZDA 2RHOA 1FUYB 4HDNA 5G4KB 4CG0A 5IF3A 2QTVA 4CMIB 2AGVA 1V7PC 5MHTA 2FUNB 2KJQA 2PM8A 3AM5A 3MBOA 2AR0A 3QA3E 1M2WA 3DH0A 3GVXA 4QZVA 1N33B 4NQRA 4Y98A 5KOJA 3N8DA 2PKRA 2WZBA 4CLRB 4EY6A 1RVDA 5BWNA 1XPRA 1PJAA 1W29A 3DUFA 3ILXA 3H6HA 3AHEA 2OBYA 3A7EA 3MJFA 2GHQA 1GKLA 4QRDA 1H2YA 5KDDA 3RDPA 5IJZA 3MA0A 2WQ6A 2X1LA 3D7LA 2DCMA 1QO0D 4AKSA 1SWWA 1CCWA 2H48A 3E22B 4YASA 4DYHA 4UBJA 4EG0A 4MKXA 4PX3A 1L4GA 3R3XA 3U9TA 1Q0LA 3VZQA 3M6VA 3EULA 2BKUA 1YZTA 2XHEA 3AF3A 2JZOA 1C7RA 3CNOA 4U2DA 4YNBA 5IH7A 4HAVA 3T06B 1I7SB 2ZULA 4KYUA 2RH4A 4I5DA 4FGLA 3PCXA 1KHTA 4LXQA 3A2MA 4TXJA 4LJLA 5L3QB 4J43A 4AG6A 1PGQA 1X1QA 1ZRHA 3RWMB 5DTQA 3UMCA 4CI0B 3K2IA 4I36A 1NOIA 3JWEA 1YSCA 3G88A 3TZKA 3L6UA 1S2OA 2R65A 2AJLI 4CV2A 1ULTA 2JBWA 3CV3A 4D3FA 1NXTA 1VFNA 3PVSA 4HL6A 4DNFA 5EJEA 4PPNA 4EY3A 3GLIA 5CYOA 1N8NA 3M4YA 3IUPA 4AQYB 4P34A 4OHFA 1JSXA 3S68A 3OEED 3PUHA 4HMPA 5F4ZA 5HGJA 3ZV5A 1F8YA 1J21A 3GRVA 2WE8A 3FRHA 4X54A 5A3RA 2GWRA 1Z4LA 3FDIA 3TB6A 1SWVA 3LY8A 3FFTA 3HE3A 3E35A 2E82A 3FI9A 2FUCA 4YCBA 4B34A 1TX4B 3U3JA 5BYKA 1GG9A 2GH1A 3CB2A 1YUNA 5F7JA 1HT3A 4EMBA 5KNBA 1RYZA 3INGA 2D00A 3R6DA 2FEAA 4NPCA 4H4DA 4JT2A 2FP4A 2NNWB 1CRWG 1MDFA 2XYHA 1Y8RA 2J3JA 3D7MA 1C2YA 5AKLA 5HKLA 1A9YA 5ALHA 3TQCA 4DV2B 4C0JA 1UPAA 3G0HA 1LC0A 2CUTA 4N4AA 4GPBA 2O5EA 3II6X 3DD5A 4MULA 1QGOA 3V8QA 3NHFA 2K2QB 5BSWA 3W2HA 1EX6A 1RKVA 3D4LA 4AIIA 3CCBA 3LOQA 3OE7D 1P81A 1K98A 1RFGE 2QXUA 3ACCA 5CX1B 1ULBA 2W22A 1AO0A 2HFKA 3N0VA 2V9PA 4URWR 3VPAA 1H8EA 4DAEA 4ND8B 1EFDN 2LUOA 2JBHA 3KPYA 5AQEA 2CVPA 3RE1A 5AM5A 4B5KA 2PAFA 2YVAA 3VR3D 4HYTA 4CODB 4XIFA 1XU4A 2F64A 3SVTA 1U0HC 4Q3EA 3VHXB 5IZCA 1NBMA 1RXYA 2D3TA 1YOVB 2WAYA 3B3GA 4NK4A 5E9QA 3TXYA 2B92A 2CMFA 4RZXA 3VVCA 1R0LA 2DX7A 3VR5D 4CT5A 1B6GA 2ZWPA 4BAGA 2XZLA 3F3MA 2XPCA 1RQXA 4B7CA 3E5MA 5IASA 1C3VA 2EF0A 2OO5C 4YVFA 3T9AA 4CUKA 5IWCA 4PX2A 3ZHSA 5FFNA 4NDNE 4AJKA 4CTOA 2Q41A 2GBCA 1JJVA 3ZDCA 3H5LA 1DC3A 1NXXA 1NL3A 2XDAA 5KYVA 1PJTA 2BFBA 3JD0A 3LRXA 2LKCA 4C89A 4PNHA 4LRTB 4XVUA 3N0TA 4IDHA 1XDSA 5DOVA 2JLWA 4M86A 1B43A 5J4HA 4IMIB 4M1MA 4FFNA 4P38A 3VPXA 1KWGA 1M0EA 2CV1A 3V97A 4AMYA 1PWEA 3UT5B 4O4LA 4ZEMA 1SXQA 1YULA 3HUDA 1DAOA 1ZNQO 2YINC 3P1JA 2CJXA 2QVGA 3DJYA 4Y9RA 3L0OA 4A10A 5CH3A 3TF5A 3GL9A 3X1DA 4Q02A 3ZI7A 1Z75A 4QUIA 1UXIA 1ATIA 2XOEA 2X15A 1G66A 2G9VA 2AEMA 4LW8A 3FOFC 5DCYA 4YV2A 2WYIA 4BQFA 3O2QB 4BVLA 3W3AD 2EW1A 2ERXA 4YRAA 5EE9A 3MAJA 4EOGA 1OFIA 4G8JA 1D6JA 4JOSA 1SKYE 4M8IA 1XV5A