4KR9A

Crystal structure of a 4-thiouridine synthetase - rna complex at 3.5 angstrom resolution
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
386
structure length
386
Chain Sequence
ELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/rna
molecule keywords Probable tRNA sulfurtransferase
total genus 117
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.8.1.4: tRNA uracil 4-sulfurtransferase.
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02568 ThiI Thiamine biosynthesis protein (ThiI)
A PF02926 THUMP THUMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 4kr9A01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kr9A02
3TS1A 1PFWA 3CLTD 2RD2A 4QBTA 4FZJA 3CR8A 3VRHA 1PFVA 3P0HA 1NZJA 1FYDA 2CV1A 2YXNA 3M5WA 3ZGZA 5K0SA 1XNGA 1GPMA 3MLAA 1N2OA 4EG6A 1IQUA 4DLPA 1OWMA 1OWNA 3GMIA 4MVWA 1T9GR 4YP7A 3UOWA 3Q10A 1U7DA 4G5YA 3UMVA 2C5SA 2R5WA 1H1TA 2OQ2A 1N2HA 3KFLA 3TM4A 2JAXA 4P2BA 3AG5A 3SP1A 3K0BA 4EFKA 2RE8A 2J07A 1M8FA 3AIIA 5KHAA 2AZXA 3UK2A 2PZAA 1LI5A 3HMQA 3TQIA 3CA8A 3ZXSA 1WXHA 2QTRA 3AG6A 1TYDE 3G59A 1VLHA 1VL2A 3GLVA 4GRIA 5HUJA 4XSVA 1KP3A 3V97A 2JA2A 3ND6A 4Q93A 4CT0A 3AFHA 4MUHA 2IJGX 5IJXA 1KAQA 4KR7A 3SEQA 3SEZA 4MW1A 3DV2A 1U0BB 4MUEA 2Z09A 2GKSA 1J21A 2G36A 1NUSA 3U1VA 3IUEA 4GU5A 1I6MA 2QUKA 1M8KA 1N75A 1VBNA 4ZCSA 2GM3A 2VTBA 1KQPA 3N05A 4EG7A 1M1ZA 1SURA 3ZIUA 3PRHA 4JFAA 4MULA 1GLNA 1KORA 1U3CA 1HYBA 1G8FA 1JILA 4MWCA 3FNRA 1H3EA 1QU2A 1IFXA 1O95D 1NUUA 1QNFA 2J08A 3UY4A 1M8GA 3LE8A 1XJQA 3TZLA 1OWLA 3A05A 1N2IA 2DEUA 4MLPA 4AQ7A 5J59A 1IRXA 3F3MA 3H9CA 3ND5A 2E18A 1O6BA 1J70A 2YWBA 4UZFA 2WSIA 4NAHA 3LCJA 2CFOA 1VBKA 4NATA 1LI7A 3DLAA 3CLSD 2YY5A 3RK1A 3AL0C 3ELBA 2YWCA 4MW5A 5LM3A 1MAUA 2EJCA 2XRYA 4MW9A 4JZYA 4RPIA 1JEDA 2NZ2A 1EFVB 3D6VA 2DUMA 4EG3A 3MXTA 1N2GA 1PG0A 1ZH6A 3QTTA 5DEOA 1J1UA 3CLRC 3FI0A 5HG0A 4ND7A 2CT8A 1EXDA 3HGMA 4YBRA 1O97C 3CVYA 1O97D 1TFUA 1ZUNA 4PY2A 1KQOA 3FETA 3NBKA 2PIDA 2A86A 4MVYA 4KR6A 3TNJA 5BNZA 1WQ3A 1IQ0A 3AKZA 3VU8A 3L92A 1O94D 2CV2A 3JXEA 2ZP1A 1WXIA 2O5RA 4BWVA 2A1UA 4K03A 1OWOA 2Z08A 1G8HA 4R2MA 4XFDA 3H05A 4MUFA 5TEVA 1MC1A 2PZ8A 3KT8A 1J20A 3IVCA 5DK4A 4J76A 2A88A 2ZUFA 1M8PA 3I05A 2D5BA 1PG2A 1KAMA 4DNXA 1MRZA 1ILEA 2X1LA 1WY5A 4OUDB 1YUMA 1GTSA 3QTBA 1KH2A 2A84A 2QTNA 3K9WA 3MUEA 4L2IB 4MVCA 4YP5A 1QRUA 3KT3A 5LFAA 4X0EA 2D54A 5HUHA 3FWKA 1OD6A 2X0KA 1B6TA 3HL4A 1OWPA 4K0RA 2PFSA 4MUKA 1Q19A 2WB2A 3Q12A 1XNJA 2VTBB 1KH1A 1TYAE 1QU3A 1PFUA 2A1TS 1J1ZA 2DERA 1EFPA 2QTMA 1TYBE 2WQ7A 2QJOA 1X8XA 4QRDA 1QRTA 1WXFA 2I1LA 4ARIA 4CDNA 2CV0A 4H3SA 4ARCA 4KR9A 1QTQA 1KQNA 3ZXIA 1QJCA 2A1UB 3KT0A 3P52A 5FNZA 1X6VA 4S1OA 5EKDA 4G5FA 1LW7A 3HZRA 2AG6A 2QJTA 3A2KA 4PBTA 2DPLA 3CLTC 4OJMX 3IDFA 1MB9A 1JIJA 1MJHA 3IMCA 1N2JA 3N9IA 1IQRA 2GOYA 3H97A 3RBAA 2EL7A 3IVXA 2CSXA 3G5AA 2V0GA 4YMIA 3HV0A 5KWVA 4DDMA 1JZQA 4MWDA 4L2IA 1JIIA 1JHDA 1M8JA 4DJAA 3NBAA 3CLRD 3CLUC 1MB2A 4MW2A 3RJZA 1O96A 1ULHA 3ZJUA 2PXHA 3A04A 4MUNA 1O0BA 4U8HA 1O0CA 3IMGA 1COZA 1XNHA 1U3DA 1VBMA 1GZUA 2J4DA 2CYAA 4ZCPA 3TLJA 1JMVA 4ZT4A 1NURA 2DXIA 1JEEA 3X1MA 1KR2A 1TYCA 3D6UA 3L93A 1K4KA 1N2BA 2A4MA 2HZ7A 3SZGA 1Y42X 4MUGA 4ZCQA 3LOQA 5H7XA 5DASA 1PFYA 2BYTA 1BS2A 4MAFA 1N77A 1IHOA 4JXXA 3ZJTA 1P7PA 3PXUA 1TEZA 1R6TA 4YP6A 4MWBA 3FDXA 4ZCTA 3IODA 1JGTA 4I6EA 2DLCX 1NP7A 1QRSA 2CYBA 5DB4A 1YUNA 3DO8A 5LLTA 1G59A 3H9BA 4EG4A 1H3NA 3IH5A 1ZH0A 1EFVA 3FH0A 1O94C 3COZA 4ZCRA 3IVGA 2QUJA 4A91A 1KKUA 4AS1A 4ZT3A 3ND7A 3CVVA 2TS1A 1EFPB 3FOCA 1R6UA 1TQ8A 1F4LA 3Q4GA 2ZUEA 1GAXA 1G8GA 1UFVA 2CUZA 3N8HA 1DNPA 4I6GA 1N1DA 4NAUA 5JBNA 2IP1A 4RUKA 2E0IA 3TM5A 1QQTA 2QJFA 1WXGA 4F4HA 1IH8A 4KPUB 1YIDA 3V8VA 1NI5A 4EG8A 4MW4A 4MUJA 4JYZA 1MAWA 4HK4A 4XFJA 3QE4A 4KKVA 1A8HA 4TS1A 2DR2A 3IOEA 1EUYA 1O5TA 3PNVA 4CQNA 3S3TA 3LDGA 1N2EA 1NUPA 1T9GS 3TMAA 2PG3A 4F3RA 3C8ZA 3INNA 5TS2A 3X1KA 1Q77A 2AKEA 3H99A 3TZEA 3CVXA 1J09A 1U7XA 3G6KA 2B7LA 3CVUA 1S4MA 2WQ6A 2HGZA 3PNYA 1IVSA 3SZ3A 1I2DA 2DETA 1OBCA 3SYTA 4DE5A 2X1MA 2NSYA 3KT6A 3TQOA 3A4IA 1GTRA 4MUIA 3FG9A 1H3FA 1YI8A 4MW0A 2XRZA 3RHSA 5J58A 2CYCA 2E89A 4PBRA 1YIAA 4I6JA 5J5AA 2QUIA 4NDAA 1MBZA 2IELA 1T6XA 5FO1A 1JIKA 1CT9A 3CVWA 1GN8A 2A1TR 1WJGA 2X3FA 4MW6A 1MOPA 3LDUA 1KH3A 4MWEA 1FFYA 1NUQA 1OBHA 3DPIA 3ZUGA 5IHXA 1Q11A 3IMEA 5FO0A 5AHWA 4U7JA 1R6XA 3GUZA 4R0NA 1F9AA 4MW7A 3MLBA 1WZ2A 3OP1A 2JANA 3COWA 3FY4A 3K32A 5TGTA 4NZPA 4EG5A 1K4MA 2H29A 1YULA 2V0CA 4MVXA 2BTEA 4WNYA 1F7VA 4HJRA 1NUTA 2OV4A 2J09A 4E1AA 3ILVA 4ZT5A 2QUHA 1JZSA 4J75A 3VGJA 4ZT7A 4ZT6A 1KP2A 3P0JA 1I6KA 4UZEA 3IOCA 1I6LA 1Q15A 4DDHA 1K92A 3NV7A 3FIUA 4JXZA 1NSYA 1F7UA 1EE1A 1K97A 4R2LA 4DDKA 1V47A 1ZJWA 2H2AA 3CLSC 3ZJVA 4KPUA 1O95C 3ISJA 1T6YA 4Q16A 1EJ2A 3PNBA 4QREA 2VXOA 3COVA 4G6ZA 5KCMA 1D2RA 4U63A 3RFFA 1WOYA 3OTWA 3P0IA 1WKBA 4ZT2A 3CLUD 2J5BA 4OUDA 2Z3VA 3FHJA 4EGAA 4MQ6A 1EUQA 2HMAA 5K0TA 5F23A 3RK0A 1RQGA 2A7XA 3HFJA 3SDBA 4CDMA 4ND6A 3COYA 4NX2A 1O96B 5TEWA 4WSOA 1N78A 2O8VA 1WQ4A 4EF6A 1JECA 1V8FA 1WXEA 5H16A 3E27A 3IUBA 2PZBA 3IOBA 1T6ZA 1M83A 2D13A 3N2YA 1NYLA 3UC5A 4PBSA 3MMXA 3X1JA 1N3LA 2E21A 3BL5A 4HPWA 4EG1A 4HJXA
chains in the Genus database with same CATH superfamily
2FHPA 1R6AA 4RSHA 2ROQA 3UHJA 3KOZA 1WV0A 4CMKA 3ELWA 2Q0QA 4DADA 2DY1A 3OTGA 1X7ZB 5B6PA 1ZGHA 2XWBF 3AI1A 2P6MA 3JPYA 1LSJA 2O0JA 3DBIA 3PFGA 3CNOA 3UV3A 3P0HA 4D5EA 1FVXA 4QG3A 3D6FA 3G5MA 1VP3A 5T5QA 3WJ2A 3BMXA 2C95A 4TTIA 3GLHB 1EVEA 1NMXA 1XNGA 2H4HA 2YZNA 3EZ7A 2CLCX 4M2LA 3RRFA 2DQSA 1XZEA 4F6RB 2A5LA 1Q14A 5L6MB 1HZJA 4UUNA 3W7VA 1QCCA 4KO8A 3SZOA 4R40A 1HDIA 4Q1BA 3WNBA 1N6LA 2UZ1A 4AZ3A 4MV0A 2OQ2A 1N2HA 1RAAA 3CZPA 1A98A 3H11A 2OC4A 5EXTA 2JAXA 1Y3AA 4EFKA 3IT1A 1WVIA 1MT0A 1ZNXA 1Z13A 1RLOA 2HLPA 2I3ZA 2GS9A 5DFAA 3WLLA 2OGUA 1ZXBA 2Q5LA 3HACA 3QVVA 4KQFA 4WGGA 3LHDA 1H6BA 3NTLA 2Q7XA 2Z56A 4RYDA 4WASA 1ZAYA 3TQIA 4V2UA 4HQLA 1X2BA 4HWTA 5C8XA 4ENSA 3CX4A 1KO5A 3GLVA 4I7EA 3FPKA 1ZC4A 3LYUA 4WPGA 3IE1A 1HX7A 1NHWA 5EESA 3PXBA 3V7FA 3SG0A 1LC3A 2WG1A 2C8VA 1NUHA 3MT7A 2B4YA 3A6ZA 5EJ4A 1IN8A 1E0JA 3THYB 3TLXA 4NBTA 4AMZA 1XQ9A 5DYYA 1FEZA 1R8YA 1U0RA 1UFOA 4Q4HA 5A3VA 5JSYA 3C3CA 5C1IA 1EFTA 3RRJA 5LJLA 3U7IA 4UAUA 3T1TA 3HFGA 3URKA 1O4WA 2CNWA 2VTBA 1KQPA 4HGYA 4RJKA 4K9DA 3T38A 5IJZA 4V3BA 1B2LA 4ENQA 1CIVA 4X1KB 3ANYB 4I81A 2W2TA 4BV3A 1L4HA 4QDXA 1UBTS 4X62B 3THOA 4KAAA 1MZVA 5CA0A 4W6ZA 1I94B 2FPGA 5HFNA 1Z26A 4MO9A 3ZWWA 1R8JA 2EX1A 3TZLA 5EUCA 2PH3A 2WWTA 4LQLA 5AVVA 1LKZA 3DYBA 2G4VA 3Q3JB 2AIRA 4RZIA 5BWBA 2YIVX 3PJEA 5J59A 1GZSA 1DMSA 4JC8A 4A82A 3TIIA 5CBPB 5IM4F 5I8PA 5IUNC 4JT2A 3F71A 3HXKA 5ES3A 1YE3A 5KTTA 1HEIA 3ICQB 4RM2A 3A32A 1Y4UA 4JUDX 5LOVF 1A50B 3C4QA 1EP2B 5DTJA 3R4VA 3HBAA 1U90A 2SNIE 2XB4A 1Y8QB 3H7AA 2NV0A 3HHPA 3AINA 4ZA2A 5TGDA 4KOEC 3ABOB 3ELBA 4EYEA 3AL0C 3FMOB 1XVUA 4B84A 5IN5A 4XKJA 4J2HA 5FBKA 2EJCA 2YWXA 3RRZA 1TDJA 2OM2A 3L8DA 2NUAB 4JDPA 5IVPA 2XCQA 3PXXA 3MG9A 3O1IC 1GSAA 5CD9A 4QM7A 3NUGA 5KTPA 3Q8KA 3LX4A 5FOWA 5IAEA 5KNCA 2OE2A 3H1AA 3VTZA 1DKMA 4PN7A 2FWMX 2GNOA 2FZWA 3IEIA 3R5SA 2EC5A 1C4XA 1M2GA 4FFMA 3W5BA 4HNHA 1KDTA 3O91A 1Z4LA 3EVAA 5TB5A 3P94A 4I3GA 5ECGC 1KYTA 1YL6A 1BDJA 1R0BA 5EGSA 5AQEA 3REFA 2HJGA 1T25A 1ZHFA 2PIDA 3BGDA 3NIDB 4IW3B 4BX3A 4E32A 3BVPA 2QUBA 1NLZA 2O7NA 1BKSB 1DKLA 1G2QA 1O94D 2DM6A 2R3SA 4G1UC 4INAA 4YP0A 4JS0A 5F9MA 1KI1A 4DXDA 4OQPA 3O8OB 4XFDA 3LQRA 4PZDA 3ENNA 3U6BA 1ZK0A 1FYVA 1X77A 2Z8ZA 4FDLA 4Q0MA 4DIBA 4JMPA 3ZIAA 5GIPE 3T1HB 1XU9A 3ABZA 1M2WA 5HJ5A 1HLGA 1XMJA 1H66A 3GZNB 3VSBA 1WIWA 1JHUA 2FZKA 2V0NA 3JYLA 4KAFA 1Z0UA 1SAYA 3CLHA 3PEUA 1PRYA 2UUCB 1HK7A 1IOLA 1Z6TA 2IEYA 1I1HA 2VZEA 3AZQA 3JQ9C 3ZKWB 2GN2A 3EEOA 1PBTA 3SC2B 1JJ7A 4JLBA 3ZCTA 4IKPA 4EKYA 4NBWA 3U40A 3AP1A 1O8BA 3I6BA 2JC3A 1QIJA 1QG0A 5JASA 1JF8A 3MWLA 3CRMA 1SQGA 4DY6A 4TZ0A 2VDNB 3HLTA 4QQKA 1H65A 5C8YA 1QAQA 1X13A 2QSZA 2VPZA 3FROA 3NHFA 3PCTA 5HIJA 4UEWA 3SN6A 3RBXA 3DZBA 4NE2A 2UUOA 1B6TA 1L5RA 2XTAA 3HPRA 3IIMA 4OL9A 2GQ0A 3C7KA 4HNGA 1VPEA 3W4JA 4ALJA 2Q6KA 3DULA 3PQ8A 3W4IA 1XNJA 2LKDA 3T6KA 2DE0X 3QPUA 3TIFA 5FWXB 1KH1A 2AYZA 2CXQA 3NIWA 4YUVA 4XYLA 4LJRA 2JGAA 3K5HA 3QKUA 5JY1A 1J1ZA 4A73A 4IDFA 3EEQA 2I99A 2IUYA 2QYTA 4LBYA 2OHFA 2WLSA 3O1LA 4LHYA 1JALA 3TW0A 2NU6A 3T7JA 2I1LA 4JYAB 4RULA 3VMMA 3QHQA 2QHXA 3GRYA 4M22A 3RE1A 2E4UA 3PQFA 2QTFA 3GUYA 4E5YA 1EFAA 2ZK7A 1K0FA 4MVJM 4B09A 1KQFA 3EVNA 3MWYW 1HC7A 4KTTE 4H60A 5DM2A 1P4HA 2Z1DA 2XUQA 4BGVA 4QPDA 2AFHB 1RMTA 1G2PA 1KFJB 2Z4SA 2O5VA 1S7CA 3MPUA 4Y6SA 2REXB 2IDMA 4R6XA 4ZVUA 4ZRMA 3MT0A 4OKNA 5G02A 2XUGA 4L1KA 3FOAA 3U7EB 1L8OA 2H54A 3B85A 3ZTTA 2IU6A 3CLTC 3X44A 2FW7A 1LNQA 3C7AA 4XOIA 1U28C 2ZITA 1ZINA 4J43A 3ZW9A 1KPGA 1R0LA 1Y9ZA 3HUTA 4FDUA 1CZNA 4YYEA 2XQVA 3SOPA 4DB4A 4NJEB 3IVXA 3PE4A 1EP9A 1UKVY 3ANMA 2PX3A 3USCS 1BCRB 2EFCB 3EC2A 4FNOA 1C9DB 1A82A 4F5DA 3SQWA 5BR7A 1TRKA 1KTIA 3RAPR 4ND4A 4NBSA 4KODA 1TA4A 2VDKB 4M0LA 2GJ9A 3E81A 2QEQA 1NLMA 3M6FA 1ZP6A 1F3LA 5C5DA 1ZKDA 5AVQA 4PN3A 4CLEA 4JROA 1MB2A 3F3SA 4HC4A 4P3YA 3ZJUA 3LRXA 3VHLB 1TQ6A 2PXHA 2H48A 2GN9A 5I8WA 3P5SA 4BVLA 1NYRA 1E3WB 2AJDA 2E1PA 2C5AA 1PD0A 2J9YB 2BDTA 2FWBA 1ZVKA 2ZJ6A 4KLZA 3TLJA 5K3FB 4YY3B 3SSMA 1N1GA 3SNKA 2L82A 3VYSB 3WGYA 4GXTA 2VJAA 2XVMA 3KFXA 3NHWA 3F7TA 3QKRB 3FPJA 4LX8A 2GVZC 1RCFA 2R5NA 4BJ5A 5IKPA 1TECE 2KLHA 4F86A 5AHKA 1TYCA 3NWEA 4CKBA 5LLDA 5ELXA 2VRWA 2QXTA 2O2HA 2YASA 1YB4A 2FWIA 2O1WA 1USUA 4FW8A 3GLIB 4BMVA 3WGGA 3DF9A 4FN4A 3LT4A 1P6UA 3HA5A 4X6LA 5ALQA 5FF9A 3WBFA 4CJXA 5DIFA 2H2GA 3KL2A 4DYDA 2CMDA 1R16A 3PGVA 5C9ZA 3UH1A 2CC2A 2AE1A 3ESXA 1EWVA 1PFGA 1VJDA 3A58B 4Q1EA 4ETNA 3TAUA 4YAFA 3AF1A 1UDRA 4XVQA 4DWOA 2N75A 3P4YA 1EWRA 4FI3C 1JGTA 3LZDA 5B1HA 2XBMA 1VI2A 5JCZA 2GAAA 3AUAA 3UXYA 2G5TA 2R6R1 1E7YA 2RH9B 4DNPA 2HMFA 1J5XA 3KVRA 3IH5A 3Q7RA 3EPPA 1QPZA 2YMLA 3VV2A 2H4XA 3QKRA 2ISCA 2ZRPA 1EDOA 1JT2A 1T3TA 1IBKB 1CNEA 4JI8B 2VUTA 4R9NA 1BX0A 3A9TA 4JBLA 3RUEA 3ZHTA 3QELA 2X0NA 4PZ0A 1S3GA 1A1SA 4YCJA 1OFIA 5DSXA 4MQFA 1E1RA 1KFCB 2H2DA 2Q21A 5FHRA 4YRTA 4ZQBA 2D2IA 1NVVR 3EWIA 1V96A 3HJHA 4CM8B 2H0AA 2YWGA 2XGSA 3ZD6A 1QYIA 3II6X 1SR8A 3SKVA 2AEJA 3B9RA 2K5UA 4IVPA 1LPPA 4PPNA 2E0IA 3WRXC 2GAFA 1XF1A 5LB4A 2D5CA 5AKLA 2VF5X 2R8BA 3V8VA 1IZYA 3TLGB 4KIUA 3G7SA 4OMUA 3TVIA 3VISA 1R9MA 5IARA 3DP7A 4XB1A 3U3KA 3M1AA 1ETUA 4XIFA 4Z8YA 4BQPA 1ODSA 3NHKA 3IOEA 3P0EA 4G8DA 3U3ZA 5A05A 2SECE 1D9ZA 2X6RA 3LM8A 4JGGA 1X7YA 4K9KA 1Z9BA 4Q21A 4XRRA 1DARA 4HQRA 4Z9XA 2F59A 3T35A 3VM6A 3LOPA 4GP6A 1TT7A 4WXMA 1SBCA 1I10A 5THQA 2YRXA 2GEUA 2ZIXB 2Q0HA 5LZ5A 1H2WA 1AE1A 4Q19A 4RZ2A 5GV8A 3TEJA 2PUGA 4IDAA 1CRPA 1DWUA 3EAFA 1QHNA 4BP8A 3D0QA 1YVDA 2MDTA 1HZZA 4X3OA 2BSAA 4ZTUB 4EMTA 4K6GA 3QWFA 3JTEA 4NF2A 1HURA 2Q4BA 4OB7A 1JSRA 1GN9A 2WQ6A 3ZXYA 3U4QB 1I4WA 3AF3A 1CR1A 2G72A 4QULA 1ODTC 1P45A 1VKHA 3GNQA 3LO5A 3H4MA 1V43A 4N5DA 3T9AA 2GAOA 2Y93A 4BMPB 2WF7A 3IS3A 5CVCA 3H9UA 4RCYA 3RABA 4YJFB 1RBQA 1P31A 2I3DA 1R0YA 4ZU1X 4F3CA 4RJJA 4BO5A 2M1ZA 5DBEX 2UZAA 4ZMRA 3K16A 4D80A 1A8QA 1QXSA 1C0LA 1YI8A 1OMOA 4PLCA 3BFKA 5DPMA 3RRBA 3TTWA 2CLSA 4I8DA 3RVNA 5KQSA 1JFTA 5CUQA 5J40A 1EIZA 3N2EA 3FKQA 2C8LA 1E99A 4TVBA 4Q9KA 1FOEB 4HDKA 4KL8S 5EHIA 3IA7A 3WL3A 3N2GA 3EIWA 3QF4A 1KK2A 2XNHA 4YV0A 4EYKA 1T13A 3CVWA 2B34A 3EF3A 1VHQA 2ZYGA 4B2YA 2ONZA 1ORRA 3S99A 1QH0A 4LNUB 3I73A 3IP7A 4RE5A 1DG9A 5ABPA 8AT1A 2COUA 1J56A 4L5JA 3PCRB 4M89A 1B93A 1YS7A 3A1EA 4F91B 1ODCA 1OBHA 3WBBA 3BL8A 1DXHA 2VHXA 3U0BA 1WXQA 5IHXA 5IU6A 2YHSA 4BZZA 3ETGA 3I2HA 2QAJA 1OILA 2R6AA 2RC5A 1GY8A 3CB2A 4XSHA 1BDIA 1OKKD 1CUUA 3PS9A 5HDBB 2EP8A 3GV0A 2O8BA 1UJ2A 3LL4A 4C2TA 1TAUA 4L75A 1U5CA 2EQ5A 2OAQ1 2J7KA 3H0KA 4V0SA 4ZZ1A 4I5IA 1H1LB 1BCRA 2JRCA 3Q1LA 4FKZA 3N0WA 4NZPA 1YULA 4Z2YA 4ZYVA 3KJHA 5CT6A 3UB2A 3TNYA 4BAUA 1YBAA 4TRJA 1GA6A 4YRIA 1AKUA 1PTJA 1DT5A 1UBMS 4CM7A 4RVHA 3A3PA 4BRUA 2W6ID 4OPMA 4KVZA 4LYEA 2CNDA 2DHDA 2JVJA 1I6LA 3ONDA 3UKDA 2AGVA 4BWFB 1DFIA 1I9CA 1RAEA 5A02A 5EWJA 4IIHA 4UVHA 2Y1LA 3VU1A 2ZUBA 4ZOEA 1FDOA 4YRNA 1UBNA 1V3TA 4OTZA 4BATA 4C6HA 2RBGA 1XVTA 4RZQA 1HG0A 2QX8A 4R2LA 3QITA 1W19A 3KPYA 4WZBB 3GFGA 3K9GA 1N1EA 5IK2A 3AKDA 2JI9A 4D44A 5AVSA 4MITA 1YZVA 4TKUA 1H9AA 1DFHA 5AIBA 5JFTA 3AP3A 1U7HA 2FFHA 1FVFA 3IAFA 4X1YA 2H4FA 5KVQA 1G8JA 2JBHA 3EEBA 4M87A 3N8DA 1XN1A 1WP4A 3FVRA 3BMOB 4GYYA 3WIBA 4F1KA 2H92A 3JD2A 3ZTYA 5AJTA 4PM4A 2D00A 1JQJC 1WKBA 1C4OA 3T0FA 3NAQA 3W3AH 3C7TA 2CL5A 2PL5A 3HKEB 3LK6A 2PSDA 1M6VA 1FS6A 4H1WA 4HGQA 1YB5A 2DWQA 5EMMA 3UANA 2B36A 5DP1A 3QKTA 1IEXA 3PJFA 2X5KO 3GMDA 5FUWA 1ARZA 1N4AA 2BKLA 4HRYA 1G6OA 4MGEA 1W8IA 3DDSA 3H11B 3W8DA 3WDKA 4MJ3A 1XROA 5JBQA 5EHGA 4C7VA 1V8FA 3VOSA 1ND6A 3INYA 2W6MA 2OKCA 1JT9A 4R2XA 1RFLA 1WX1A 4OQZA 3N8GA 4F38A 3SJAA 4YNBA 1ADCA 3VNSA 3TQFA 3BL5A 1VFNA 3U7QA 3IT3A 4DDWA 2X5JO 5DW3A 4DRZA 5KU1A 5JDIA 5JWHA 1Q44A 1U0TA 1Y4AE 3MAJA 1HYHA 2PVPA 4QHSA 2FPKA 4HZIA 4QWWA 2C9OA 4D97A 4ZI7B 4GI3A 4AJPA 3F5SA 1QB7A 2CLMB 1DXYA 1EX9A 2I03A 4W9RA 2P2NA 1G2OA 1PVDA 4FOPA 4LJ7A 4LQCA 1MEEA 3T54A 1R5OA 1NZJA 2QT1A 9LDBA 5I7RA 3EQ8A 2YXNA 4MIKA 2H5LA 3P20A 3KKLA 1WDTA 2ZXFA 5KVVA 2Q0SA 3MWKA 1LI4A 1BE8A 5K8LA 4Y9TA 2YZKA 1VYUA 3DE2X 4HX2A 4GKBA 3ZK9A 3V34A 1DLIA 1IN6A 1E2DA 1JKXA 1RJGA 1RBZA 1V3VA 2IPLA 2PBFA 3WGNA 1QQ5A 3MT8A 4X6XA 5A71A 1WXWA 5JO0A 1Y9DA 3MOIA 2ODWA 3KFLA 4OQ4A 1IATA 3DZGA 4Q05A 5DCWA 4CEIA 1L7BA 2V7UA 3IGFA 2VDMB 2EARA 3KEOA 3HYLA 2ZIXA 1EM6A 1U2RA 2B8NA 3EDMA 3V4RA 3KHTA 4N8SA 4MKHA 4A4DA 2F64A 2QVZX 2FN9A 4B46A 4P0QB 3PSAA 1WOMA 1H5NA 1H2EA 2FFQA 5I4IA 3Q7EA 4MS1A 1BG6A 4F5YA 1E1RD 2CVFA 2EKBA 4H2DA 1AU9A 4N6GA 1PAUA 3P9ZA 4UZSA 5AJXA 5G0TA 3VR2A 2NZJA 4CMBA 5SY6A 4CT0A 1XXHE 2BCGY 3DE4X 2I2DA 2XA9A 1FP1D 3DDUA 4G26A 1A8UA 1Z4MA 3K2IA 2AI1A 3EDOA 3IPAA 4JWTA 2R8XA 2ZRNA 4N7MA 3HGQA 1Y8QA 4P33A 4RY9A 4JKYA 2CBGA 3LUBA 3L8GA 2E55A 3HWWA 1TXGA 3WGQA 5KQGA 4TZ6A 1WR8A 3U5TA 3EPHA 2RHOA 2O54A 4LMBA 2ETVA 1VIAA 4EG7A 3S1SA 1NW5A 3CO0S 1E1CA 3T9FA 3W6PA 5UKDA 5C3UA 4A5OA 5TIIA 3A6PC 3PQ3A 2PRKA 1JMYA 3QXJA 4ZVQA 4ETIA 4MWCA 3AC0A 3M2TA 5E95A 2PA3A 4DPKA 2I7CA 3JWEA 4D57A 7MHTA 1E3SA 2NXJA 4GOKA 3OURA 4GRDA 1RKQA 3DLHA 1SHKA 1FNCA 4BE9A 4GDFA 3NORA 5IF9A 1G3MA 4WKNA 4IDGA 4LZWA 5E2IA 3WJ1A 4I55B 5ENZA 1BTOA 1R27A 4BQIA 1KMIY 1GQOA 5JYEA 2JAOA 3K9HA 1MLDA 2P6NA 4WA7A 2W43A 3E2IA 3OF3A 3IDZA 5BO5A 5DO9A 1P4SA 4BEBA 3E82A 1XMOB 1MVLA 1I2ZA 4UVIA 4KXYA 3BWCA 4J2TA 4TN5A 2ZQYA 4H9GA 2HXSA 3DBHA 4OXNA 4D0LB 1FDWA 2POQX 3VMFA 2JFVA 1IN4A 1EX1A 5CVUA 4BECA 1MJGM 4A36A 1QMPA 2AZMA 1DJOA 1U9IA 3LY9A 3O2SB 4CDRA 1MAUA 1XJ0A 1P5JA 2NV2B 5DEIA 1WNTA 1JPVA 1ZRHA 3BBPA 3FF1A 3P2YA 5GQSA 5T67A 3U7JA 4X3CA 5HM6A 2Q4RA 1EFVB 1EHYA 2WINI 3CMCO 4KQEA 5JC1A 4WOPA 4QECA 1WBDA 3BE8A 5AI9A 1U9JA 1YU6A 4ZO7A 2JHAA 4QDTA 4EW2A 5MN5A 3FI0A 1H8HA 2C4MA 4K40A 5ER9A 1FMFA 3DOHA 1WY7A 1ZKMA 2F1IA 3QBEA 5BUQA 5ALYA 2VKTA 1UCFA 4BQOA 2VJYA 1WZCA 5G0SA 1TIPA 1ONSA 3DXZA 3AY0A 3LA6A 2OXEA 2PRIA 4Q7EA 5REQA 1ACJA 1IQPA 2XYHA 3OH8A 1V9LA 3CRZA 1GLGA 2XUHA 1CE8B 1EINA 3L7CA 4QUDA 5HCIA 4FOTA 4G0YA 2Q9UA 3UGKA 4BYGA 1IQ0A 2AN5A 3CUWA 4JQCA 1KOLA 2I78A 4RDHA 3GCWA 1L6IA 3JXEA 2R6FA 4G1MB 1FS4A 5L8VA 1I36A 1NBWB 3GEPA 4MB0A 3AQIA 3GZTB 3S1LA 3BCHA 1E89A 2QS9A 3GQBB 1SUEA 3WP1B 4KMMA 1J0CA 4L28A 5F64A 2EDCA 5ED4A 4O25A 3RASA 4CKCA 4FBMA 2R00A 4D02A 3NTOA 3I1YA 4W82A 2NO9A 5JQGF 3TD6A 2V7QA 1M2HA 3GI1A 3K09C 4AMVA 2MOKA 2WI8A 2LV8A 1HA3A 4A3SA 4RKRA 5A5VA 1YQUA 2YV4A 5C81A 5K8UA 1GKKA 2Y2UA 3QF7A 4HH0A 4E88A 1YRQA 2VQ6A 2GNPA 1TKAA 2A30A 3KQQA 3L0YA 4ED9A 1T36B 2JEOA 4NCHA 1ZG3A 3WWOA 4W5JA 3C3JA 2ATXA 3H19A 1RIIA 2ACWA 2GAIA 3NBZC 3E9NA 4K6FA 4MVCA 4UPVA 3OICA 1NW4A 5AI8A 4HPXB 5JAOA 5LMCA 4XWKA 3VDXA 2HF2A 4M83A 3LUKA 4P7JA 4PSVA 4RA6B 2GTPA 2NSHA 2X0KA 2C57A 2P65A 2R9VA 2WWWA 2NQTA 3ABSB 3FCOA 3G8CA 3KTFA 1E94E 3NU1A 2EP5A 2R4UA 4MUKA 5D3KA 2WB2A 3T0GA 1QHSA 2ANCA 1Y48E 221PA 4ZPXA 2ATCA 2L2QA 4PE5B 5C8YB 3MHTA 1PFUA 4EFLA 4NNPA 4XI9A 3AWDA 2P4UA 2ZDQA 1XRLA 5H02A 4ENRA 3WXMA 1C1XB 1SXJE 1IHUA 2FR8A 1AXRA 1ECJA 2XD4A 2FPMA 3AHCA 2BM9A 3PPIA 1XTJA 2ISSD 3BN3A 5AJYA 4WKPA 3D1VA 2YUTA 2XNKA 3UJAA 3ZGNA 1Q0TA 1X0VA 4HN9A 4CMEA 2A1UB 3DDOA 1SU8A 3RC3A 2EKLA 1MC4A 3EGXA 4X44A 1KAGA 3A8TA 1CP2A 3FNEA 5ITZB 1E5QA 3JQRA 2QM3A 3D3EA 4PCLA 2GTIA 3HY4A 1A7JA 4O0LA 1XWFA 1FFDA 1U28A 4PBTA 1LNSA 1EK1A 3KJGA 2DPLA 4U9IS 3IDFA 2AVNA 1RXSA 3ZDCA 4N1AA 3AUXA 3IMCA 5EFZA 2P9YA 3ZLBA 1AY0A 3MC1A 1LDGA 2BFEB 3SMVA 3ZDRA 2OBYA 1Q5PA 5TT0A 3CIOA 2GPYA 3ICPA 3IUMA 1MJNA 2F2TA 3K8OE 5SY9A 5KWVA 1SCBA 2P4HX 2WG2A 2A57A 4DDMA 5JV5A 5LSAA 2NVOA 3Q9SA 1WRBA 4TMKA 2G9ZA 1OC4A 1C3OA 3D59A 2A94A 1RAIA 1X1SA 4KACA 5BR4A 1V7QA 2GH1A 4I8IA 4YO8A 3OT4A 1W87A 4HUQB 1LB1B 5LKAA 4X61A 5KYGA 4DLKA 4DJ5X 1CUCA 1NA5A 1ZFNA 3ONVA 4O2AA 3UK0A 3ASYA 1G9TA 3CH7A 3R7AA 3WIOA 4KJXA 3OQOA 1SCUA 4JVNA 5AXCA 3S40A 1C30B 1T34A 1TC2A 3K94A 5HZHA 4QAJA 4JXKA 4MRVA 5JEEA 5L3SA 4MTCA 3Q2IA 5L45A 1ULZA 3EVZA 5BSTA 1AUVA 4OQNA 2HK8A 4PEVA 2G6TA 4RV4A 3X1MA 5LMUB 1T1SA 1U8UA 3SXUB 2QROA 1FJ2A 5B7NA 5BW5A 3IE0A 4B8ZA 2O05A 2C4KA 5K1ZA 3HSKA 1WSBA 3UK1A 2ZB2A 4PIMA 4DMGA 1DVRA 4M4SA 3SZGA 1A2BA 2OC9A 3PDIB 4RFSA 2FPUA 4BKRA 1D3AA 4AG6A 3AETB 3AV0B 4M8KA 5I9BA 1DWOA 4OQDA 3O95A 2FY8A 2AYYA 2PR7A 3V8PA 1P74A 4KQWA 1CS4C 4EPRA 2IZ1A 4JC0A 3OTOB 4JEUA 1EBUA 3K9CA 4JXXA 2YUIA 4H3KB 3GJ4A 5FTKA 1O57A 3AEYA 3LLCA 3R9XA 4P3OA 2PWBA 2QRZA 4OMDA 2WIGA 1KDZA 1KMHB 4YJ3F 2BL4A 4KU4A 3T5BA 2GXQA 2E7ZA 1N5KA 5ANRB 1R4MB 4RXTA 2CYBA 3NOXA 1C3XA 3O0DA 2FE4A 1RJFA 4XUEA 1EFVA 4RA6A 1DBRA 2CLFB 3V80A 1JB1A 1U3VA 4YT5A 1P0CA 5A2QA 1V37A 2QU8A 1E9RA 4LOLA 4ZT3A 1ZRSA 4HNAA 1GVHA 2WNHA 3VZCA 3PX7A 2BFMA 3OCJA 4KPFC 3EGVA 4HTAA 5JNUA 5C31A 2GJ8A 5JVDB 4UCWA 5J1SB 2YZ7A 3OOJA 3QBTA 1K75A 2GESA 2IQIA 1L5VA 4TLCA 4CCWA 1CFZA 4DXAA 1XCJA 2JIRA 3BDIA 3EE6A 3IEXA 3ZI7A 4BJHB 3QWBA 4WKGA 3SF8B 3ESRA 2JFXA 1HYQA 4AZTA 3B60A 5A2GA 3B6MA 5JZSA 2P6UA 5ISMA 4YIHA 1XRPA 5CIWA 2JD2A 4AM8A 4LZOA 1QQTA 3PDUA 3V4OA 3WOHA 1VGRA 1Y34E 2Z5FA 3E3NA 3VDRA 1MGOA 1WZNA 1YIDA 5CDFA 4DABA 3BSWA 5LQUA 1CY8A 1M1NB 3GQBA 3L7MA 1LRLA 4EJSA 3B2EA 2VO1A 4ZRDA 1WCYA 4KKVA 4XH9B 3ER8A 1J1IA 3VR2D 4MB6A 3WGHA 3NDJA 4CHGA 2IS1A 3IE2A 4U6NA 1ZJ5A 2V59A 1WDLA 5CB6A 4OFBA 1RYBA 4UXIA 3T5MA 2V7WA 2UAGA 3IUQA 1JIQA 2IKSA 3CS3A 3OIGA 3FSGD 3INNA 5EJEA 4BO1A 1VB5A 2V9ZA 1LV8A 5C18A 1DOZA 1NE7A 3L0CA 4CLOA 1Z3CA 1GR1A 4MO2A 2IPMA 4L6IA 1KWGA 4KVAA 5FHQA 3GP5A 3VR6H 2VUIB 2XI4A 2HLDD 5EHQA 1J09A 1VRWA 3CBQA 2DT5A 3MW8A 4W5HA 4D5GA 1XB2A 3ONFA 4QEZA 3ILXA 2XW6A 5AKGA 3VZQA 3MWDA 2AJCA 3W8NA 1WF3A 1LFDB 1SBZA 3DFFA 1K8ZB 1PTJC 2O2ZA 4LC1A 5JWOA 1T10A 2DC1A 4TL7A 3OMXA 3AWIA 5AM0A 3RU9A 2DETA 1FBTA 2XOKA 5B1SA 4O2AB 4XCVA 4YO7A 2HWKA 3E0QA 5T4HA 2OYCA 3ROFA 5A9TA 3T99A 1C30A 2ZSDA 4D4GA 1SG9A 1FU4A 3BS4A 5F78A 3L9WA 3QBDA 5IMSA 1C0KA 4GKVA 5HFJA 3DE3X 2X1VA 3NP9A 3ZGLA 5J5AA 4GRAA 1J07A 3PDIA 2Y05A 1ABEA 2DR3A 2JLBA 1JJAA 2WTAA 3HJCA 4RFSB 1Q92A 1DC3A 1I3NA 4BGEA 1RRCA 1OH7A 1PV1A 3E58A 3KQVA 5FWDA 1M2EA 3TFQA 2VDPB 4GP7A 4PQEA 4MRSA 1NAIA 1WJGA 1QYWA 2QGFA 1Y4SA 4QVKA 5AKKA 4DSUA 2HA0A 4P7BA 1PN3A 3ZU6A 1YACA 2ZRCA 1RWKA 1UKYA 4BKPA 5K8TA 1JEYB 5CLQA 2A14A 2XYPA 3A9RA 3QX9A 4LZJA 2VAMA 3HCCA 3HBLA 3KUXA 2VT7A 1PR6A 4X1OA 5E7MA 1XKLA 4EEKA 4LJKA 3QEMA 2DFKB 1ZM7A 4DA6A 4B71A 3I2YX 5KNDH 4TWBA 1T91A 3K6KA 4V0MA 3SYLA 1IOZA 1EDEA 1QZZA 2WM3A 1PL0A 2R6ZA 4GG1A 2G4CA 3T1QA 4A23A 3OUZA 3PNPA 2VUSA 2BEUA 2P6PA 3MEQA 3BK1A 1GAWA 4FQ8A 4FYYA 4ZVKA 1AQ6A 4GQAA 1RQPA 3DTYA 4UCXA 4JHXA 2PBZA 1JZSA 2NZ8A 3E4CA 4JLDA 3UFBA 3L7BA 2BFBB 3PUXA 3QPCA 4I4CA 2FETA 3RFXA 3VAZA 3ZNOA 4CLRA 1J2RA 1ZWKA 3U61B 3EASA 3BTOA 1AG9A 1AS0A 1LRJA 2E5LB 1Z37A 4C7JA 2VSXA 2IOQA 4DV4B 1AT1A 1G5RA 3V8MA 3OM1A 5DRYA 4I50B 4MS4B 4WY2A 3RYFB 4S0ZA 2O6LA 5K2OA 1ZR2A 4K6KA 1YFZA 3CLSC 5FLEX 4ARSA 3ODGA 1X92A 2XRFA 3OQ6A 3VI4B 1NOKA 2V96A 2FSVC 3NM5A 4L85A 4BGUA 4RPCA 2Y71A 5DBOA 1L7PA 4JVOA 4D4KA 1P60A 1GKUB 1PSZA 5TVKA 3ES9A 5DX8A 1YVPA 1GL3A 3GPIA 3N6XA 4FHFA 3LNTA 3DVSX 5EHNA 1J4AA 1QUFA 4LNAA 3UXHA 2ZRFA 3RB8A 2XMDA 4ZT2A 1J8QA 2XCOA 4QLOA 3T7SA 3UT0A 4H16A 3VKUA 4B7ZA 2FSGA 7REQB 4KR2A 3RM3A 1QWSA 2GWRA 3PXCX 1N8KA 1GRNA 3HN6A 4U0KA 4TVOA 3SI7A 1E3DA 3BH6A 4EJFA 1EX7A 3MRTA 1CUJA 1M7HA 1MGPA 2XADA 2YXLA 1OKKA 4KQCA 4BFXA 2QIPA 4QUHA 4F9TA 3ZZUA 4A26A 2JK1A 3T7AA 1SA0A 1R6VA 1JJBA 4L4YA 5EZ5A 3S28A 4Q5IA 3WGTA 4H3VA 3NTVA 1T4CB 2E4YA 4WZZA 4EJ6A 5K20A 5BW8A 1SRQA 3K70C 3KZCA 4UQLA 1JS1X 4RU1A 1Q0HA 1QYCA 1T3GA 2EEZA 2RI1A 4I5DA 1B41A 4LSZA 1YHYA 4B80A 4AQDA 1FIUA 2JLWA 5TXGA 3I4CA 4OHMA 4Q7KA 1FS5A 1ACMA 3KTOA 4LGMA 2PA0A 3LRPA 4KWIA 5D3ZA 3AEKB 4E4TA 1F48A 1Q74A 3NV9A 4Z0TA 2VDUE 4G4IA 2X23A 3SIXA 4HY3A 4V38A 4I1VA 4BNWA 4V1CA 1QUEA 1ST2A 1UANA 1VMEA 2GPJA 4OFZA 3CR8A 4PX5A 4UAGA 5EYPA 3U44B 3LHKA 5EERA 4FHEA 3UJ3X 4K9MA 5J5VA 3F46A 2ZSIA 3BGWA 521PA 3SZUA 5A5GA 2X0EA 2ZB8A 3LLUA 3NEYA 3UFXB 1Z5UA 5BOVA 4MEBA 4R9SA 1DB3A 2NSDA 3MLAA 2UZ4A 1JE0A 3K1AA 4OIFA 4IO1A 4L9AA 2NTEA 4PO1A 2VHUA 4N39A 3OZSA 3L0SA 1RNLA 4MWTA 4EVQA 4DDUA 1RRVA 2XWSA 3R6TA 3EIUA 3HNRA 3KSRA 2IA5A 2NAPA 1WUJS 4HLQB 2EYUA 2C8JA 2HHAA 4Q9AA 4Y6GB 3ZZTA 5I4KA 3GG2A 4P2BA 1TA9A 2HFJA 1Z6QA 5HGXA 2XMQA 4MZDA 3JQGB 5SZIA 1BO6A 1UAAA 1RYEA 1Y6FA 3RSLA 5ALHA 4L50A 2C61A 2ALJA 1JIVA 4JA0A 1NVAA 2ZCJA 4RLQA 3U1BA 4ECEA 4TX1A 3WLTA 4DLTA 1P9OA 1FFCA 3GY0A 4E11A 5CFQA 1T1GA 1Q57A 1W25A 3C3AA 1HDCA 2EFJA 4XSVA 4B4OA 1KP3A 1TTQB 3GMSA 5IAJA 5GJBA 2ZE5A 1NW7A 2J3DA 3FUCA 1NX6A 3P9SA 1JKIA 3FVVA 5BSUA 1AUOA 4XLTA 5FUVA 5FUQA 2W2KA 1TKRA 1U0BB 4U7GA 3QUQA 1N9ZA 2A8YA 3CPHA 4KXFB 3RV4A 5BV0A 1FX0A 3I52A 1NDUA 1OGJA 2WWGA 1ZMXA 3AU8A 2XVAA 4L8VA 4P83A 3A6JA 2ATIA 2WYUA 2HWWA 4M1KA 4QSHA 1RHRA 3FYDA 3ACDA 2YN0A 5CLGA 5CHEA 4BGIA 1ESDA 4WJZA 4ZCMA 1G38A 3K72B 2A9QA 4QPNA 1UBJS 5F1OA 4MULA 4AWAA 4CQLA 1GLNA 3WHPA 4TLEA 5DMXA 3HUEA 4IZOA 4BNDB 2JLVA 2BKUA 3EPKA 5IFKA 1QU2A 5CTJA 4G25A 1ZW6A 4BCDA 3BCRA 4CM9A 3LFUA 3U31A 4AO7A 2BLNA 2I3GA 3IAEA 4F2HA 5F51A 4M21A 3UQYS 2XZLA 5FR2A 3K9NA 5FBVB 4H27A 1FSZA 2OXIA 3PGA1 3HEAA 1JDBC 2WJIA 1N0UA 5FAKA 2AJBA 2ZT7A 4PVDA 1QQ7A 1UZAA 4IQFA 5CG1A 1MHPA 4X7MA 4C0QC 1FLNA 4WAUA 2I9PA 2ODTX 1AD2A 3CISA 4B6OA 1UWLA 3WC4A 1SKYB 2CFOA 2JVIA 3DL0A 3CHYA 3GUUA 2G71A 1FLVA 3FBTA 3HM2A 4GM4A 4PAGA 4YAUA 2WK1A 2B35A 2IXTA 4TXJA 2WU4A 1SKMA 3ZDYB 1F0PA 2I29A 2VCEA 2D5IA 1UOQA 2XRYA 1N6NA 3HWX1 1B2RA 4IIGA 5J9FA 4E94A 4TYNA 1RXVA 1A7AA 4BO6A 4GMXA 1T0JB 1P39A 1OYYA 1QGUA 1I7DA 1N2GA 1KZ7B 1NM5A 3D8TA 5D6NA 5LZ8A 1COWD 1LPSA 4CMIA 4DSZA 1E9EA 4CIBA 3GLGA 4AY2A 2PN1A 3EOZA 2Z9CA 2CT8A 3DOOA 1VI5A 3FOBA 1FFBA 1J8FA 4MYTA 3TMYA 2WD7A 1SCJA 2PV0A 1A5ZA 4ZAXA 5L3ZA 1A9XA 1Y8RB 2R65A 3FYUB 4BUCA 3SJCA 4F3KA 3DC2A 4F6CA 1QBKC 2DVMA 2KPOA 3L6OO 4ENTA 3HCDA 4Q1VA 1PGPA 3TEFA 5IM4A 4V02A 2W2LA 3SS8A 1KBOA 2DKOA 2PMFA 2YMQA 3V4VB 2AQKA 5HQ3A 3V8EA 2FFJA 2AR9A 2WYVA 2Z1NA 2QE7A 2WHYA 4ND1A 2Z08A 1OXSC 4IDHA 1HYEA 1XCMA 4BC1A 4B3RB 4CIYA 5JCJD 1RCUA 1AKMA 4HTFA 4V0OA 3A1SA 2YJ5A 2NMVA 2XMGA 4Z4QA 3MGCA 2W2VA 3IHKA 3IJRA 3IOYA 5DK4A 4C6TA 4ODIA 4ARBA 3IOMA 4Y2XA 1SUAA 4CMJA 5G41A 5BV2P 3OLXA 3HCPA 4V0ME 3DMFA 4DNXA 3WNQA 1JHRA 2BMEA 3GELA 2ZBGA 2ZE8A 2CVQA 4KVFA 4Z7OB 1OLXB 3LC2O 1OAAA 1Z36A 5BN5A 4HDMA 2W83A 2WW8A 4PZEA 2F06A 3ZQKA 5C8ZA 1J2TA 3FYSA 1E3QA 4KK3A 3HU1A 3D02A 4BZWA 2PYIA 4YK7A 3BFVA 3PWSA 4B4VA 5KTMA 3DLTA 5JYBA 4DR7B 1V8ZA 4I8XA 2DLNA 1QOZA 5ITSA 2MR6A 5CB4F 3Q9NA 3DCJA 4TMYA 3H0EA 2PAFA 1USKA 3CG4A 4EGFA 1H8ED 3D4NA 1NKSA 4RTNA 4JBHA 1BXRB 3BMCA 4CCAA 3OLCX 1PT7A 2BFWA 2EATA 5DRTA 2R68A 2O0MA 4GPAA 4JR0A 4UMDA 2WOOA 3ZX5A 3AR8A 3H87A 4RV9A 3RQIA 5ELMA 4CTJA 2FN7A 2YIMA 4WOCA 3F4LA 2CXNA 1P0PA 4ALIA 4NDNE 5DGCA 4ARCA 4TQAA 4HDMB 4FB5A 5I01A 5KYUB 5CM8B 2WV9A 1RYNA 1QJCA 3KWFA 2BWJA 4LCBA 1FFHA 1UDBA 2GLTA 3F3KA 4PS0A 4LK2A 4JUCA 4YJGB 5GWXA 3RYFA 1P0MA 2IPAB 3UTCA 4AUKA 1PFKA 2IBMA 2GRAA 2J9XB 2C54A 2QVGA 3OSZA 4HADA 1OX5A 3RT1A 1KZ4A 3UMSA 1HI9A 4KN8A 4JGIA 4YBZA 1P3DA 2Q28A 3T06B 2P2LA 1AGPA 1W73A 1P61B 3SC6A 3AETA 3H97A 1WLSA 2IX3A 3WYEA 3LPDA 3NANA 1JU9A 1MAHA 2ZIZA 3WDLA 3VHRA 5BORA 1PI3A 5F33A 1CB7A 1JDUA 3AOEC 5IYZB 5IC4A 4M49A 2EW8A 3U7RA 5E3IA 1EESA 4NH4A 3MRXA 4KH0A 4MNTA 4RIGA 2DUJA 1DCTA 4PZAA 2R84A 4IGAA 3E5MA 5FWXA 3DMTA 5CEFA 2OO5C 4U8HA 5KEIA 2GF2A 1UJMA 3SQMA 1UBFA 2YYYA 3O8QA 4EVIA 1WZIA 4X90A 5D87A 2J5QA 3JQCA 1DAFA 2G83A 1FVOA 1CZKA 2WSSA 4EBFA 4EFNA 1CKEA 5C5IA 2DWOA 4C7MA 1JEEA 2PO7A 1D5CA 4PR0A 2PKWA 2F1KA 4PNZA 4UOQA 4YV1A 2WTUA 2A9VA 3T3PB 5EKXA 3AGPA 1BA3A 2VPIA 1A5SB 1CCWA 2WPDD 3KVOA 4CXMA 2H7VA 3U17A 3KFVA 3X2EA 1A9PA 3HRKA 3SQOA 3LZCA 1PTKA 3WHLA 1S6YA 4H15A 4G1CA 1K6IA 4GOOD 5DHAA 1OFHA 3FCXA 1H2FA 4PXYA 2AC4A 4YP1A 6REQB 9ATCA 2Y0DA 1TAGA 5D8DA 5E3HA 4TVKA 3AX6A 1Y5LA 8MHTA 3BYZA 4MPDA 5HRAA 1TM7E 1DO2A 3J80A 1TO1E 2ZJOA 3NDBB 4GE3A 2M98A 5FTMA 1WD7A 3HHEA 2FKAA 1UUFA 4YLEA 1QLWA 3ED5A 3IPRA 1PT5A 4O63O 4I1YA 1L4LA 4FS3A 4RGQA 5FIUA 2FEKA 4NBKA 2IHZA 4TWZA 3JPWA 3ONNA 4NV0A 1N2CA 1IIBA 2QR3A 3GVXA 4FPXA 1WG8A 2PGIA 3EXHA 5EE3A 1YR2A 2DWUA 4E6PA 1X1DA 3DEJA 3G6WA 3HP1A 3HR7A 4J4TA 1A4RA 2OGWA 2W90A 4AKEA 1V6SA 4ZI7F 4F8JA 2CXUA 1CLEA 1DPFA 2C1ZA 2WHQA 2WWYA 5EL0A 1JQKA 2PZEA 1SVUA 4JOCA 3DGFC 3DCIA 2CUZA 4AK9A 1U11A 4B33A 4H4CA 1VSUA 4LUCA 2W2PA 3WXBA 4ARVA 5KQPA 4I9UA 4PLYA 2HN9A 4O3FA 4DZZA 3TM5A 3LX6A 2HLDA 3OFSA 1L5LA 5IXYA 1TM1E 5DNCA 4MQUA 4CBVA 3LIPA 1XZIA 3DXXA 1RFGE 1OXVA 1E2MA 4P53A 2C9BA 1HT2E 2Q6VA 1XJ5A 2OG1A 4KE7A 4NG5A 2VQDA 1W9MA 4R2JA 1U2SA 3O4VA 4OQYA 3UT5A 2J9RA 3CZCA 3V1KA 1O5TA 1NBMA 1O94A 3BXOA 2QQGA 4I0WB 2JFGA 5FL7D 4GC5A 4NCXA 5HE9A 1XUOA 1VJ5A 1FFXA 5JQGB 1ZI8A 2C7GA 2UUPA 4JYBA 1LWOA 4ZK6A 3KQOA 1TK9A 4HAOA 4WN3A 3U56A 1Y63A 4KQ9A 1MF7A 3PPWA 3O9ZA 3CF6R 1KEZA 4E7OA 4RESA 3ZXUB 1S2OA 1JWBB 2B7LA 3UWMA 2XXAB 1S4MA 5HUQA 3CG0A 1MMFB 2VHTA 3LPCA 3QFHA 2IQ5A 1ZNWA 3C43A 1XMIA 4GPEA 3EJWA 4C43A 1WD5A 1XG5A 2J45A 2NYUA 3IAM6 3JTMA 3TTYA 4NCBA 2YR0A 3B1VA 3BDVA 1RKBA 3F67A 4YLGA 4R84A 2N3ZA 3E7XA 3W3ZB 5LQNA 3FG9A 5K3FA 3A1TA 5AVUA 3KYDB 4ACAA 5KOIA 4XGIA 5LQMA 2QBYB 3AMVA 3ZWMA 4C4RA 1CYDA 4FK8A 4GPBA 4DTIA 5H9VA 1VB3A 2YZGA 3SLKA 2Q1TA 2BUAA 1NW9B 2IS4A 3A0RB 2BONA 4EQZA 1RHUA 3IEPA 2CJXA 3Q7PA 2WY2D 4Z4FA 1PV2A 4P5DA 2QUIA 3R7LA 4A8JC 3EIEA 2VDWA 5FO1A 4WK0B 1FLAA 3HKBA 5F35A 5KYUA 4Q3OA 3FWPA 4U39A 4DQLA 1CE8A 2ZI9A 4I5GA 4I66A 5GOZA 4N7RA 1I3OA 1OYWA 3L0PA 4ZKEA 4QVGA 4CG0A 2JFYA 1LDEA 3OZTA 1EWTA 3Q0IA 4MWEA 4YPFA 3V4ZA 3VJMA 1EP3B 2G88A 3C98A 3WMWA 5H3CA 2ASVA 2H51A 4U7JA 2WQZA 3OJOA 3SR0A 4NZZA 2GPNA 4DDTA 5I4CA 2X5NA 3BEOA 3ACCA 4QNMA 3OPMA 1A5AB 1F2DA 1Z33A 4LJAA 5FNVA 3GCXA 3AAWA 4HNQA 2RGBA 1ZUHA 3ZIDA 1QPBA 1H4SA 4J9UE 1JFSA 4M6WA 2DMRA 3H84A 5ALFA 3OWHA 1V1RA 1EXVA 1SU6A 4S24A 2MIIA 4J75A 4RENA 5JZMA 2YX1A 2GZRA 1C3EA 3NYIA 3O26A 3WWDA 4XSGA 4E09A 1YJ8A 2P35A 1YV9A 3I04A 3PC6A 1ENPA 2AEMA 2YC4C 3AFIA 3MJTA 3P4XA 1S0UA 3DVAB 3C4JA 3O9VA 4HYEA 4ZEMA 4MPTA 4M8LA 4BBAA 3EPJA 1B42A 4F21A 3K09A 5EKSA 1OZAA 1E9AA 1ENZA 2CXOA 1PDVA 2OBLA 1ZJWA 1CSEE 2H2AA 3QXXA 4EJSB 5CEJA 5EXDA 5L3RA 5D3MB 3KHKA 1HMPA 2ICAA 1DX4A 2OEPA 2PSJA 3WB2A 1SK9A 2FKNA 1A2OA 4G1EB 3GLGE 2JGJA 5BYAA 2OHHA 3IEKA 3K0EA 3SYKA 3D7LA 4WECA 2WJ3A 4HR7A 1H4TA 1QGDA 2OO3A 4PNPA 1QG4A 4Y6OA 1YS1X 3AF2A 4HO1X 1RBMA 1WVMA 5AI6A 3BD8A 4DCPA 5EQTA 2ZIEA 3ZHZA 4W5QA 3VR3A 3WKEA 1A72A 1KMNA 2BN4A 2VJDA 1CQIB 1QPGA 1QOQB 2VPQA 3IIJA 4ISCA 4LXHA 5FB3A 3ZGYA 4YCSA 2ILVA 4ZDKA 5TV2A 5K0JA 1YB2A 2SKEA 2UYYA 2WILA 2AK3A 3ECCA 3HWSA 4XQEA 2FXVA 4GT1A 4WSOA 4ZARA 1TMKA 4HX5A 4Y1RB 1VGQA 3SC3A 1WZEA 4R8RA 1X80B 4RPHA 2DPXA 1N2CB 4WLOA 5EEGA 1HOTA 2PZBA 3B3AA 4HL6A 2D13A 4YH1A 5FBZA 4N5HX 3MMXA 1N3LA 1QFMA 1RZ3A 2XOXA 3BFXA 5KSZA 4LOJA 3HXOA 3NHRA 2Z57A 3QVJA 4FD2A 5H3LA 5K51A 3ZGOA 5AM3A 3R76A 3WKDA 1NONA 1CRWG 3CH6A 2KWIA 1CQXA 4INPA 1YT5A 3VR1A 1ZEMA 1SVLA 4FZJA 3OEYA 1GCOA 3PD1A 4K9PA 5HTKA 5BMVA 5AVYA 1PFVA 3V3KA 3PC8A 3FHLA 1DZIA 4J3JA 2XR1A 3R5FA 1AVTA 1JHOA 3KUCA 2WF8A 3SC4A 5IYZA 3ER9A 2PH5A 4MS3A 1S9HA 2VDWB 1NF2A 1YJCA 1BJTA 3LBHA 5GJWC 2VYNA 2PCLA 3BWDD 2X9NA 1ZOPA 3QBVA 4XGKA 2IODA 1Z7WA 2WABA 2GYUA 4RMGA 2P0YA 4D9EA 3SAJA 2WT4A 4FDTA 2ST1A 1X7WB 5JOQA 1ZI9A 3E3AA 2ZRLA 2BGLA 2JHCA 3S2UA 3A0UA 4AN0A 4LXXA 3ZI4A 2QB5A 1E7QA 4RD2A 1HQYE 2WUVA 2W4MA 3N1UA 2GEFA 4G1VA 2JVKA 3BWYA 1S89A 4NR0A 1B74A 1GPJA 2PZAA 2OAGA 4HRXA 2YV2A 5BQ3A 2YS7A 1ZVVA 4HDNB 5JD5A 4ETWA 1ZCZA 1P44A 2AL7A 1RWQA 1DX9A 3QYFA 3WWCA 1N5LA 1NHGA 1VL2A 4OGGA 2H3HA 1B4DA 1C7JA 1RM3A 1Z2NX 3IL2A 3DMGA 1IK6A 4H0FA 5E2BA 3CLVA 3AFHA 1T3ZA 3EQ6A 3RTCA 1RJEA 3JAKB 4PQRA 4CKXA 5TX7A 4J7XA 1Y33E 1VE3A 1BW9A 3M4JA 3SEZA 4BX2A 2G28A 4KRXA 2RK4A 4I50A 1QC5A 2HIGA 3LKVA 4MGIR 3WWZA 1SXGA 3R0ZA 3PYXA 4BMSA 4OM8A 4XVRA 1V16A 4KZPA 4GU5A 4QDUA 2C2MA 2Q1SA 5EY5B 2C2OA 2GM3A 3WNDA 1O6ZA 2VK1A 3OX4A 4KN9S 3ZIUA 1JDNA 5AO9A 2JGFA 3ZE6A 1E63A 5E0KB 1Y98A 1UBHS 2FFRA 1BA2A 4LHSA 4MP3A 4KOAA 1U7ZA 3GVCA 4DM3A 2W2XA 2YC2C 2AN3A 1SC3A 1O95D 3C3DA 3H5RA 1ZSNA 4BQRA 1XWWA 3W6UA 4CRWB 3NGMA 3H75A 4KGZA 5LA6A 2J08A 5CM2Z 1SUIA 4DQUA 2OGZA 3B7WA 3P45A 5B37A 1WXDA 4F1WA 5JATA 4EUFA 3I9KA 1ML4A 4LTNA 4R2IA 3AQ4A 3SJBA 1ZOLA 2YZMA 4XRGA 1MUUA 4LA4A 2OHIA 1C9MA 3OX1A 3I53A 4BKQA 4RJTA 3RU3A 1O6BA 3EGWA 2FE1A 3U2QA 1N8SA 1QGOA 5EIBC 1VIYA 1IY1A 2VHWA 2Z9DA 3PUZA 2IUUA 2GNAA 1FQKA 2R4QA 2RONA 3OM0A 3UQZA 4WMLA 2DZDA 1ZW1A 1KFBB 2BGRA 4X41A 5HXAA 3CPJB 2G76A 3D2LA 2IXFA 1X1RA 3MELA 1ODKA 3K3PA 3NT5A 2PYZA 3DBVO 3NWJA 3CSUA 1OI4A 1RWMA 2X4IA 3H1FA 3KL4A 1GGMA 3R3ZA 3TPFA 2DUMA 4LYFA 4BRSA 3LZ6A 3AVQA 4HFMA 4HOYA 5AXBA 4EG3A 1ZUD1 5FYDA 3THXB 2VJNA 2Y0EA 4IQ0A 4DCTA 1NNSA 4PLTA 2XZPA 5JADA 4JKIA 3CYFA 2E37A 3DE0X 4IDCA 3PENA 1KK1A 2AFIA 2WSMA 1XKQA 2W2LD 2GLUA 3C0KA 5DNEA 3PHIA 3F6RA 3N5KA 1W94A 4Z99A 5FLKA 2ZIFA 3LXMA 4GF5A 2CVZA 4IWXA 2W0SA 2E5FA 4QJ4A 1BVRA 1EFDN 1I1OA 4G0ZA 3WGMA 3ZWOA 3ZHBA 4KR6A 4CM9D 5C8YF 1FDRA 1R66A 2WJ6A 4TSFD 4CEHB 1KE2A 1PW5A 3V3TA 4NXMB 2DBQA 1E4EB 2CBXA 3OG9A 3LBFA 5AJVB 1KJYA 4R7ZA 4CHTA 3H05A 2WWVD 1I2MA 3OQBA 5EZYB 2ZBDA 4MUFA 1KYWA 1QRRA 3PTLA 3A37A 4W4TA 1MC1A 1TZMA 4BB5A 4GO1A 3BH0A 4F4IA 4ND2A 1VOTA 2A88A 2J3EA 2PT6A 2W6IA 3DLPX 3I5MA 2I54A 3KM0A 5JALA 1KVUA 1DC5A 2QTCA 4UNNA 2FWRA 1CX9B 2PL1A 4JODA 1GHTA 1WY5A 3WICA 5KOYA 4BNXA 1XDZA 2V74B 3KB6A 1KH2A 2WBLC 4JC4A 5A7GA 5KI6A 1RABA 3D7RA 1VCNA 4IDPA 4MB2A 1UFKA 2Z5VA 2J48A 3RUCA 4ZYZA 2V1XA 4H1HA 3V9AA 1RHKA 3JAKA 4OUKX 1O5OA 1IPFA 3A6EA 4DHWA 2MMGA 4NJOA 2VLBA 5EJ7A 1DAMA 1Y89A 4DMHA 5HM8A 1ADFA 1Z6YA 3HL4A 4E12A 1RI1A 2PFSA 3U80A 2I6QA 1R8XA 2Q62A 4H7IA 4JD5A 1I0LA 3CLKA 3EB9A 3Q12A 1II8A 2XUZA 4LQDA 1SCAA 4W7HA 3AF5A 4ALLA 1KJ9A 2DERA 1G63A 1DUSA 2XE7A 3VR4A 2IYWA 1R8SA 3WAKA 1A1VA 2ZUDA 3I32A 2INGX 1BQ3A 1K6EA 2A2ZA 2XHEA 1SPBS 3BFPA 3TUIC 3UPUA 3OOYA 3QG5A 3L4BA 4AXXA 1CR4A 4HNTA 4HZUA 4TXLA 4Z54A 3ESYA 1I4OA 2V8BA 4C7XA 2BV3A 1PT6A 2GN0A 3FFAA 3DB1A 2QG9A 4QBKA 5B1DA 3SVLA 2ARKA 2H1FA 1YMVA 4RVOA 3HR4A 2QJTA 3A1DA 3M4NA 3G85A 4Y9RA 2GZ1A 2JI4A 5TF0A 1P3Y1 1UEIA 1YR8A 2R7LA 4IEEA 2QTZA 4IOMA 4QPPA 4B4DA 5FEMA 1B0AA 4E07A 3PT9A 2Q3DA 2QTHA 5GMOA 4EJSC 4KNWA 2NTNA 4LY0A 4UEQA 4UU7A 3IESA 2GSWA 4RF3A 1YI0A 4B2PA 3R4CA 5K99A 2ZATA 1L4GA 4UDNA 1O3YA 3OPYI 4XD7A 2XCRB 1BEUB 4BX0A 2XMSA 1D4AA 3GIDA 4C3UA 1M8JA 1JQAA 5EJAA 2VI5A 3QU9A 2H1RA 3KEQA 4B3XA 4BDTA 2D3TA 1GCUA 3CUYA 5KYKA 2NU7B 1F8GA 2XWPA 2ZRHA 4LHVA 3USES 1O0CA 1D4OA 4G63A 4IF4A 3W9BA 3DOIA 1NC3A 2CYAA 1K63A 3CONA 3FTQA 2FFAA 2I2FA 4KX3A 3MTDA 3PNOA 3FTPA 4PFKA 4F4CA 1K08A 3QLJA 4OD0A 1SULA 4TWJA 2Q5OA 4OHUA 5YASA 2B3TA 4M7RA 5MN4A 1YK0A 1OYOA 2NUTB 4UASA 3IP6A 5DX0A 3M6WA 1Z2EA 1NASA 5D51S 4JQZA 1ZVPA 1CQJA 2VYND 1ODLA 2OXRA 3ODPA 3OVMA 5DASA 3DCYA 1XTUA 1SG0A 1WUTA 3BFJA 3DXFA 5ALMA 3S44A 3BKWA 1XN4A 3V8NA 4RD4A 1M6EX 2D0PB 3C85A 3PFCA 3UF0A 4ZN6A 4JVLA 3W5SA 3KD2A 4DKJA 4YP6A 5DLDA 4YCLA 4D6PA 2QZ4A 4Q4CA 2P9FA 4IJ6A 3R6DA 3OT5A 4HSGA 1FMLA 3UZUA 1CFJA 1LK7A 3MCZA 5K8IA 4DIFA 1BZYA 4YJ2A 4QRIA 3EZFA 3WRYA 4UUOA 1ZH0A 1PZXA 4CLXA 4NI5A 4WOBA 4BRZA 3GO4A 1IBMB 3RC1A 1VA4A 3WOVA 2WNIA 5EIWA 2FA9A 4PTYA 1JHZA 4J6FA 3EXG2 1EGHA 3LDAA 1RPTA 5JAQA 3IILA 2TS1A 1GEEA 1BXRA 3BMCB 1F8UA 4LZAA 3SBOA 4I14A 3VC2A 2FQWA 3IBYA 3RYHA 4P5EA 1YS9A 1BNCA 4PLWA 3ENQA 4Q9NA 4UMFA 1G20B 1Y1QA 3GNSA 1ZMTA 3KKNA 2DFTA 2WTEA 3MTBA 4MVJP 2FMTA 2NW6A 4Z6KA 1SUDA 1SEVA 2DU8A 4TUYA 4U2BA 1KYQA 3QPBA 1E6WA 2H4JA 2OO7A 3W78A 2FMKA 5EMKA 2ODBA 3CVJA 2OSBA 3L41A 4UUPA 4WNAA 5M29A 4PHFA 4QUJA 3NVDA 3HKDB 4R7TA 5BSEA 4Q9LA 3WBKA 2E9SA 3GEMA 2JDIA 2HPVA 3L04A 3QMPA 3V2IA 5KS2A 4P92A 3W6ZA 4F2GA 4WEOA 4H0NA 3AM3A 4Q9DA 2A4KA 2PKXA 4UM5A 3RVPA 4DEVA 4U3JA 2C88A 5A5EA 4Q4JA 2C78A 2WTMA 4EHNA 1RI3A 3DAPA 3NMUF 2BM8A 2HDWA 3WVNA 2B8TA 1EG2A 4MR8B 2FEXA 4DR1B 2HF9A 3MWEA 1JFLA 2DFVA 3PSHA 3H99A 1RMYA 4RH3A 2BI4A 4PF1A 1KEWA 3TJZA 3RK4A 4CN8A 2FG5A 3LPMA 4Q12A 3I61A 3UO8B 1U0LA 3STWA 2Y0PA 2E49A 3OPYA 1B00A 4YACA 4ZHSA 1MV8A 1TCCA 3AK4A 2QVCA 4XQ9A 1J0BA 4C0XA 1NBEA 2UU9B 2YYSA 4JEMA 3WFIA 3DKKA 1R0RE 1JI0A 2W6CX 3CX8A 4FYKA 4JP3A 2QLTA 4KQKA 4PRYA 3RSOA 2QG6A 5J47A 4P4GA 4DY4A 2PJZA 2WJWA 1SVOA 3U3JA 3DBRA 1C7QA 2YXBA 2PMEA 1WSAA 1MVNA 3MYYA 3TQOA 4ESOA 3HN7A 2W98A 3SX4A 5KTYA 3UWKA 1K2WA 5TQVA 3L5OA 4EAQA 1DOHA 4OIMA 4U1RA 4Y2GA 3WS7A 3MCTA 1T4DA 3I5AA 3V8RA 1U0GA 3ANLA 4D4LA 1N25A 3DDZX 3IT0A 4E08A 3GX1A 4WL0A 3RS2A 3DZ8A 2CVOA 1OH5A 5ADVA 3VYVA 1FTYA 3HZOA 3W2IA 2CF5A 2XUJA 5BUSA 3C6YA 2X4GA 4KYUA 2QRPA 3JX9A 4FWIB 4NQZA 2GZSA 1ZU5A 4MI6A 1NXOA 4PZUA 2N0SA 3HP7A 1FNDA 1M9NA 3VTAA 1M10A 3B2NA 2AQ8A 4KYIB 2CLIB 2KHZA 1JQ5A 3OPYB 2QPOA 2JJ1A 3J81k 2ZVDA 1UDAA 2P2ZA 4UQPA 5TPWB 4AKSA 2ID4A 4ZAYA 2IXBA 4P2GA 3WGUA 3NQ41 5AM4A 4YCNA 5CURA 3S2ZA 1WTAA 1VA5A 4LE1A 2OXTA 4ZO9A 5EJIA 5MHTA 1E7SA 2I7TA 4UQOA 4MW7A 3EFBA 4KZKA 1NMYA 1ZC3A 1ZITA 3HLYA 4NBNA 3OETA 4H7JA 1K4MA 1XZAA 1I4DD 2ZBEA 1WSDA 3EXFA 2FOXA 3QXHA 4MWOA 4NJEA 2WKPA 2R62A 2Y66A 1U8AA 1PL8A 1RYZA 2V4UA 4G97A 3KELA 5KJ6A 4RDIA 2IY8A 2QUHA 4C3ZA 3GFSA 2QVLA 2JGDA 4IS2A 1V2HE 1P29A 1ZL0A 4B4UA 1D9XA 1GITA 3OLQA 1BSVA 1ZD8A 3A6GA 3NHPA 3G9UA 3KOXA 4FB4A 2NN3C 3INTA 1MOQA 3NPAA 3CM0A 1HE8B 1IXYA 3VPAA 1U7UA 1LGYA 4AKIA 1K8RA 5A1JA 2BKAA 1U6KA 3T9CA 1YDFA 4O3MA 3N2KA 1Q7GA 4BE7B 1DBVO 2P4QA 1R2QA 2CVHA 4U2FA 4L6AA 4G0QA 3MD9A 3ZJVA 4Y8VA 3GUVA 3EIFA 5I7VA 2QX6A 5C7LO 2CZQA 1W44A 3A6DA 3TE6A 1NPDA 3SM3A 1FFGA 2O23A 2OSVA 4QXOA 3C87A 5EZYA 3BC1A 3H42B 4UBNA 3WLFA 1HNZB 2EL9A 2O1SA 3PUIA 2D8AA 1Q1ZA 1CQZA 1PX0A 2X8AA 5F3WB 1Y82A 4FCWA 2WWFA 2COEA 2OESA 3U49A 2QD4A 3VZRA 4BFCA 4J0DA 4E5PA 5CLFA 4Q4JB 3HJBA 5EIEA 2J0VA 1N2ZA 1QAMA 1GRQA 1LQUA 1ORIA 2YRWA 3UMBA 1REQB 2BBSA 2ZJAA 2GERA 1EA5A 5LLSA 1RQGA 1B1CA 1SXIA 3HU2A 5EE9A 4DV3B 4GS5A 4PFJA 3GVIA 1B6SA 5DM1A 1OJLA 5ALUA 1WQ4A 5I7UA 3GRCA 3I09A 1JR6A 2I1WA 2IZ7A 4URHA 1Z4OA 2Z3ZA 3E27A 1XHEA 1X9IA 2NO0A 2EX0A 3OKFA 3PWZA 1T6ZA 1DAIA 2WPNA 3AUFA 3NTQA 2CBZA 1J49A 3MJHA 5AT1A 4L8FA 4XIGS 1WA5A 5ALZA 4ZV9A 1ZJ4A 4E21A 4HB3A 2K2WA 4QKQA 3IBSA 1FRNA 3S5UA 4YAIA 2GXUA 2PUJA 1Y3IA 3M3PA 1II8B 4U9UA 2IYVA 1FSGA 1XX6A 4EW6A 3E7DA 2FK7A 4E22A 2AKYA 1UIRA 4PX2A 2KBEA 3KWJA 4MYUA 4UNSA 3WGKA 2VJOA 1SIUA 1G6HA 3NEJA 5K45A 2A67A 2HM7A 4WFQA 2IZ6A 3D2CA 5FUXA 4ZYUA 2C2ZA 5B2FA 5LDGA 2XECA 5IASA 3LA8A 5IN4A 1XZCA 1ZM2A 3OFND 5JJLA 4JVSB 5G4LA 2EGUA 2C4VA 4IH4A 2CDAA 2Q3LA 2F3UA 5CYOA 1ISRA 5D7BA 4YRRA 1U7DA 2PGJA 1EDBA 1P4RA 2C5SA 1Y3BE 1WZUA 3W5JA 2GM9A 2Q8QA 1OLSB 4MTLA 3SDSA 5A4DA 4UBKA 1BVHA 2XMCA 4OP3A 4BFWA 4X95A 2P27A 4RFLA 5FT9A 4YMGA 4TM7A 3EMKA 2V55B 3MIZA 3WFZA 3F4KA 2LCIA 1AQUA 2RIPA 1JU3A 3K0BA 1BXGA 5TJ9A 2BFAA 3BUSA 2P79A 2NU9A 4RJ2A 1YRBA 4AS2A 5H8WA 3LLVA 2ANBA 3ZBPA 4GPZA 1U94A 3BRWD 4JBIA 3ZXSA 4QZVA 4GRIA 5KDDA 3HU3A 1H6CA 3WRXA 4Z9AA 1UKEA 3PHLA 4WCVA 1YBFA 3F73A 3PQEA 2BFBA 3RUAA 3ND6A 2JA2A 2B6HA 2BZ1A 5ETJA 2QZPA 1W59A 3W5UA 3JZFA 1H9CA 1DBQA 1E7WA 5ICMA 1H23A 3ETDA 2G70A 2FG6C 5CLIA 3RS3A 4CIDA 5L4SA 5JPDA 3E84A 5L7YA 4BXOA 2BGGA 5CBKA 1J21A 2ZGVA 3N2KB 3TX2A 4P3KA 5GADl 3GCGA 5DM70 1L8QA 3BL6A 2XT9A 4KXVA 5KC9A 4EI9A 1Z47A 2AG8A 1HETA 1L3BA 3THXA 3PYLA 1UINA 2X5OA 2HIAA 2VBIA 5DSZA 3UCXA 1Z07A 1T9BA 2WUDA 2QAGC 3BXXA 5AHRA 1TL7C 4DBLE 1Y1RA 4KQMA 4F7WA 1G5HA 4D25A 5JXJA 3FZEA 2P4EA 1ULSA 3LCUA 1YRAA 3MJFA 4URUR 3WMXA 5GIOE 1E8DA 2G40A 3QPVA 1KHTA 3K15A 2AJLI 1K88A 2YJGA 1KSFX 4D8XA 3U4DA 4Q1AA 4OX9Y 3GVHA 3ISTA 4K8OA 5BNTA 2G0AA 3UCEA 4XAQA 4EY5A 4Q18A 3KZNA 2JH8A 3OUTA 3GC6A 1KFKB 3MWGA 3AERB 4E5DA 5HZMA 4YJDA 4HXGA 3HYNA 2ZETA 4J4HA 2FEMA 5HIAA 1USWA 5LYJB 4KUGA 1TMGE 1Q1BA 1IUOA 1MIOA 1PYOA 3COSA 2C03A 3Q11A 1NPTO 1R10A 1R5JA 3OJEA 4NDZA 1C7RA 4BVAA 2BP7A 4YXFA 4OB6A 3CLSD 5FDFA 2YNMA 4NG4A 1E9VA 2X9VA 2ZOSA 4GZ3A 3PPVA 2IXEA 2QW1A 4KLNA 3D1LA 4LJ4A 4NMWA 4QL3A 3WZMA 1AK1A 5LVAA 1YJQA 1SIWA 1WL8A 1XQ6A 3NG1A 3ZDZB 5BV8A 2VDLB 3RIMA 3AJ8A 4AS3A 3MXTA 1E1QA 3MBKA 1H2RS 4PGFA 4XIIA 4DMKA 2HNBA 1TGYA 4FUQA 2O8CA 2G0NA 4DM4A 3UJDA 3THRA 1M5UA 1ZRMA 2DPHA 2FUNB 4UU1A 4EP1A 5ITVA 1L0BA 3B1ZA 1UH5A 3B52X 5AWFC 3HCNA 4HRAA 1SVMA 3QHPA 4R1OA 1ESZA 1LWNA 1KQOA 2W7TA 3B82A 4BPBA 4KE9A 2CXPA 4HAWA 3NVMB 1QTIA 1XMVA 4KMOA 2YXEA 4TTTS 3RSSA 1L9KA 2FOLA 3NTUA 5ICGA 4HWPA 1L1FA 3TNJA 3Q1KA 4OQMA 3BIFA 3ZEAA 2B25A 2PWZA 4C78A 4GLOA 4EM6A 3WL6A 4F6RA 4NQRA 1AMUA 3BHJA 1FDSA 4C6RA 2CHGA 4WOJA 3I4LA 2ECOA 3LK7A 3R0JA 4S3MA 2BE9A 2YOFA 4EUKA 1BFDA 2BHNA 3HI6A 5EWMB 4MRMA 4EKEA 4AWBA 4WLVA 2JAUA 3KJNA 4UHCA 1UJNA 1LX6A 2R87A 2V5AA 4KSBA 3SHVA 4D9FA 2B4KA 5JJCA 5DYIA 5LQJA 5L9AA 1D2EA 1E3JA 2GAJA 3E18A 5SYAA 3OU7A 5AW4A 1RMQA 1UT8A 3MINA 3L7JA 1EGQA 1R1DA 1XK6A 4O4JB 4NMXB 1M6VB 1RLUA 3S1AB 1ULAA 1F1BA 2I67A 2JJ8A 4X54A 3RS8A 5LQKA 4JOQA 3O4JA 3FPCA 1Z5WA 4A9AA 2PX6A 3ICWA 3JYQA 1GTMA 3AM1A 2VAXA 2NT4A 2HY7A 2XA1A 5JDCC 5GAJA 3SK0A 3UWDA 1BW9B 4L2IB 3SLRA 5AW1A 5DCUA 1UBEA 5DOVA 1FDUA 1KO8A 2I6GA 3H5IA 1S8AA 4RVFA 4UEJA 4YJ2F 5J2UF 1Q0RA 4R7GA 1UJCA 3OOHA 1UADA 4ND3A 5AVOA 1OD6A 3L7IA 3C6ZA 5FULA 4JLVA 4PYOA 5BUCA 2HEGA 1UMCA 3D3KA 1CUIA 2A9PA 1TT5A 4LISA 4D41A 4EY3A 4M1ZA 1TUEA 4OL0A 5CTAA 5IVHA 1QK4A 1QHFA 1P1IA 2VTBB 2XD9A 3WFJA 2FSSA 3AJ9A 1T1RA 3B20A 3Q6MA 4DNFA 5K0NA 2C3YA 2ZZMA 1DTWA 3R6LA 4K26A 1UZUA 3VH1A 1UAYA 1QVAA 4LMPA 4DCGA 2H06A 1XTSA 2BI7A 2RAVA 4HUJA 2OUIA 5IT9A 3L8EA 1Z5GA 3KS9A 4BL5A 3Q5GA 2OLJA 4UD2A 1JKJB 5EE0A 2E1RA 3B3JA 4OH7A 1O1YA 2C2BA 3ZDBA 4EK9A 3EZNA 3U39A 2FEPA 3L8YA 3HSYA 1YR1A 3E1KA 3YASA 1J0XO 2W71A 5EKDA 2PUEA 1V8OA 2HTFA 3FNBA 3SYMA 4S2EA 4WNIA 2Y4NA 1P19A 1RQRA 2AI3A 4R31A 1MNQA 4N12A 2DECA 3FX2A 5KYTA 5MFPA 1X70A 3G68A 4G5HA 3G2LA 3WA7A 2QENA 6PFKA 2EFEB 1C1DA 1JIJA 4N5IX 3DBLB 3DF7A 5SZHB 3HJRA 3SSOA 3TR5A 3T1OA 1QDLB 3LUGA 4C7OB 1QF6A 4AZSA 4RK5A 2G07A 1BS9A 2EKDA 3EYWA 3Q41A 2CZCA 2JIDA 5AJHA 2QNRA 4J94A 4ZIRB 4PLPA 1TMYA 3C5CA 4B6FA 3VSCA 1Z6XA 4RA9B 4AO8A 2HEIA 2XX3A 3GJ5A 1GO2A 3SIPA 4A27A 2Q2WA 4E70A 5KMGA 3VJRA 4IDEA 2DTXA 3O4HA 1YNSA 1RSZA 2VQSA 4PWZA 3FRIA 3UV7A 4DAEA 3F47A 5DCLA 2P68A 1LBQA 3NHSA 3BQ9A 4AUNA 1PV4A 4US0R 4TKVA 4GMKA 2UV8A 4JL5A 4ER5A 2QMQA 1NURA 3F96A 4KWEA 2OENG 3HCRA 6YASA 1JLMA 2PQ0A 3LT2A 3PGXA 4IEFB 2J9FB 3GZJA 1FNMA 4COOA 1I5OA 1QF7A 2ZJ2A 1ES9A 3EDRA 3N6VA 4RK0A 4CKBB 5IK2D 3U16A 3FM9A 2ZZNA 5IKXA 2ZYDA 1OF1A 1JQDA 2LDBA 3RYIB 5I4BA 1R00A 1YA8A 1NFFA 3QLUC 2O0KA 1GNSA 1YJBA 3OTHA 4HVLA 3GEIA 1HTBA 3E9RA 4LYYA 2C7OA 1RZRA 3G13A 4KO3S 1YDHA 1REQA 2H5IA 4JASB 1CUWA 2PGAA 4JX9A 5CK4A 3RKUA 3UXEA 4D9NA 1CJUC 2CD7A 3P1JA 1MZPA 2C94A 4AP6A 1JLKA 1H69A 1LDYA 1M7BA 3NHYA 4UEKA 1QO7A 1LSUA 1PK9A 4AJHA 8ADHA 3DXYA 4MPJA 3TDNA 4WX2B 2J0SA 4BVHA 5BSVA 3H65A 3H5AA 5DGDA 4C0AC 5C1BA 2RFLA 3H9BA 3ELUA 2DQKA 3PHHA 1TD9A 3ZGXA 2FZEA 2I87A 3WLIA 2QRQA 3FH0A 1VIDA 1I6WA 1EJBA 2J9FA 3GEDA 3OC0A 4H31A 5CU7A 1T8PA 2JLYA 3F7MA 3FBGA 5F1KA 3U4AA 4FFSA 4CDGA 5HKKA 2AD5A 1VLVA 4AS1A 4EA7A 2HX1A 2B4QA 3H2GA 5IS2A 3SGLA 1CUVA 1W0JD 3F1KA 5CA1F 3G02A 4JLPA 4BNYA 4QTZA 2BGWA 5EMHA 1NN1A 3TQTA 1RACA 3BE6A 1W4AA 1RPAA 2BGIA 3GJRA 3OHSX 4G81A 4JBXA 3E9DA 2ZSJA 4II2A 1LH0A 5EMJA 5DM0A 2YN4A 4XDZA 2ACEA 1G6KA 1TEHA 3PUVA 1MW9X 1YGPA 2XDYA 5IWCA 3HKEA 2WHRA 1QS0A 4KXUA 3TNLA 2PRYA 3OKPA 3VR5H 3NZEA 1L1QA 1T3HA 1XDBA 5I9MA 5TMBA 2HJVA 4L0CA 2ZJ4A 5LZ7A 4IDNA 1IM2A 1I7LA 1GDHA 3FVTA 3QE0A 4EOGA 2VZ9A 4BN0A 4WNCA 4UHHA 2C2WA 4ZMSA 1DRVA 3RSFA 5U4XA 1R4MA 1ZZGA 4F2DA 4WZBE 3IMFA 4CF5A 1YZFA 3WLMA 1UF9A 2XCSB 1TEVA 4UBLA 3LDGA 2EBWA 3TTSA 4WK4B 3X1WA 4B34A 2XF2A 2AOTB 2A35A 1BXGB 4OQQA 1U0EA 4IICA 3VYRB 2K7FA 1FP6A 2EZ9A 5BNFA 3C8ZA 2C31A 3S1AA 3ZU2A 4JV5B 4K8RB 2X3YA 4RS4A 4CV2A 3PUWA 4QO7A 2GD2A 2BC9A 2FFBA 2B3DA 1R3UA 2JI6A 5FFFA 3SF0A 3ZXXA 4ZI7A 1BD4A 1P7WA 3PR3A 4AW9A 5IM5A 3L8CA 3UTDA 2FLVA 1AB6A 4I9HA 5ERGB 2CKDA 1HDOA 3LX8A 4QGBA 3UMJA 2PPLA 4NESA 2QM0A 3K9BA 4DCOA 1MNAA 5C7OO 1JJFA 1CIJA 3I04M