4KR9A

Crystal structure of a 4-thiouridine synthetase - rna complex at 3.5 angstrom resolution
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
386
structure length
386
Chain Sequence
ELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA sulfurtransferase
publication title Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/rna
total genus 117
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.8.1.4: tRNA uracil 4-sulfurtransferase.
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02568 ThiI Thiamine biosynthesis protein (ThiI)
A PF02926 THUMP THUMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 4kr9A01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kr9A02
3AFHA 3COZA 4K0RA 1JGTA 1JEDA 2E21A 1RQGA 2H29A 1VLHA 2J08A 4YBRA 2DXIA 4Q16A 1QJCA 3P0IA 2HGZA 1O96A 1O97D 1N2GA 4MULA 2WQ6A 1M8KA 2NSYA 4R2LA 4EG6A 1COZA 4NDAA 1Q11A 3ZUGA 2OV4A 2GM3A 5J5AA 1XNGA 3SYTA 1Q19A 3IMCA 1WZ2A 1N2OA 1P7PA 2PG3A 1FYDA 3L93A 4YP6A 1O94D 5LFAA 3CLSC 2QUHA 1GTSA 4YMIA 3ZJVA 3RFFA 4G5FA 3CR8A 2DR2A 1N78A 1H3FA 2DPLA 1U0BB 1IHOA 3M5WA 4MWBA 3KT8A 1B6TA 1G8FA 1MAUA 3Q12A 4JYZA 1EFPB 3RHSA 1O95C 1T6ZA 2A1TS 2CFOA 3MXTA 3Q10A 4DNXA 2WQ7A 1ZH6A 3IOEA 5DB4A 3IODA 4AS1A 3PRHA 3A05A 3H9BA 3TNJA 2QJFA 1KP2A 3IVXA 3PNBA 2R5WA 5BNZA 1VL2A 3AG6A 1OBHA 1NI5A 4CDMA 3N2YA 3OP1A 2XRYA 3CVVA 1GZUA 3VU8A 2CYBA 1WXGA 1QU2A 3ND6A 2ZP1A 1N75A 4PBTA 2A1UB 5F23A 2VTBB 1O5TA 5LM3A 1IRXA 3V97A 1KR2A 1XJQA 4G6ZA 4MVCA 1N2EA 2BYTA 2CV1A 3S3TA 3AL0C 5HUJA 4EGAA 1IVSA 1VBKA 3MLBA 1LI7A 1KORA 1QRSA 4DDHA 4ZT4A 2OQ2A 1Y42X 1TEZA 3H99A 5H16A 1KKUA 3TMAA 4MW9A 4ZCSA 1KAMA 1EFPA 1KP3A 1WOYA 3D6UA 3D6VA 1EUQA 1OWLA 1U3CA 2QUJA 1N3LA 3FI0A 1KQPA 1VBNA 1V47A 1WXIA 3N8HA 1T9GS 1O0BA 3AKZA 3ELBA 2QUKA 4DE5A 1GAXA 3HV0A 5LLTA 2A7XA 1MJHA 1G8HA 1K4KA 1T9GR 3CA8A 3JXEA 3FHJA 3UY4A 1QRTA 2IJGX 3K32A 1F7VA 3DV2A 1X8XA 2DERA 3H97A 4MLPA 1WXFA 1LI5A 1YULA 2PZAA 1A8HA 2GOYA 2PZBA 1IQRA 2QTRA 4MW2A 1GN8A 3SZ3A 3UOWA 3X1KA 2A1UA 2IP1A 3H05A 4HPWA 2VTBA 2A88A 4DDKA 3ZXSA 2D54A 1PFUA 2X3FA 2Z3VA 3IOCA 1F4LA 4ZT2A 3FETA 4EG7A 3GUZA 5DEOA 3FNRA 2AG6A 4MUNA 1K92A 4J76A 2PIDA 3K9WA 1K4MA 1PFVA 2J07A 2QJTA 4JXZA 4HJXA 3TQIA 2YXNA 3N9IA 1I6KA 1V8FA 4FZJA 5J58A 1MOPA 1YIAA 1IFXA 5HG0A 3LDUA 1U3DA 3TZLA 1N2BA 1Q15A 1O97C 1LW7A 1R6TA 3ZJUA 5JBNA 1QQTA 1T6YA 5KHAA 3SEQA 1NZJA 4MW4A 2DETA 4I6JA 1BS2A 3RJZA 1ZJWA 2CT8A 4MW7A 3KFLA 2D13A 2CYCA 1EFVA 1O94C 1QRUA 1OD6A 2D5BA 3CVWA 4H3SA 3GLVA 3AG5A 3MUEA 2A86A 4NX2A 2J09A 5FO0A 3X1JA 1WY5A 3A4IA 3LE8A 2O8VA 4MUKA 4MW0A 1G8GA 4MQ6A 1J21A 3PNYA 3CLUD 4ZCPA 2Z08A 3FY4A 3ZXIA 2E18A 4R0NA 3INNA 1O6BA 1PG0A 2QUIA 1TQ8A 4ZCTA 4JFAA 4MUIA 3ZJTA 1Q77A 1XNJA 3IH5A 3IDFA 1JECA 4KR6A 4PY2A 3AIIA 2WSIA 3DO8A 2CUZA 1JIJA 2GKSA 4MAFA 4ZT7A 2V0GA 1OBCA 4U7JA 1EXDA 4MWCA 3SDBA 5DASA 2JAXA 4K03A 1N77A 3RBAA 2V0CA 3CVYA 3P0HA 1QNFA 5TEWA 5K0TA 3G59A 1PFWA 1JILA 1WXEA 3OTWA 1J20A 4UZEA 3X1MA 1N2JA 1VBMA 3TM4A 4EG1A 4E1AA 4MW6A 4TS1A 1F7UA 3CLRD 2CV2A 4X0EA 4U63A 4OUDA 4ARCA 1U7DA 2QTMA 4QBTA 3Q4GA 3KT6A 1YUMA 4MUGA 4I6EA 4L2IB 1JIIA 3G5AA 1S4MA 1I6MA 1H3EA 3KT0A 1WQ3A 3CVUA 1I6LA 1IQ0A 3FDXA 2YWBA 4J75A 1TYDE 1J09A 1OWPA 1T6XA 1KH3A 2J5BA 4ARIA 4YP7A 1IQUA 1EFVB 5FO1A 5IJXA 1KH1A 2E89A 1WKBA 4MWEA 3LDGA 3FIUA 3IVGA 1X6VA 3U1VA 4NAUA 2J4DA 4ZCRA 1OWOA 4GU5A 2A84A 4NZPA 3CLTD 5K0SA 3I05A 5KWVA 3CVXA 3RK0A 3H9CA 2BTEA 1NURA 1EJ2A 4ZT3A 1TFUA 2HMAA 3DLAA 4S1OA 1FFYA 1NSYA 3HFJA 3DPIA 4CT0A 3FH0A 1M8PA 3QTBA 4MUHA 5HUHA 2X1LA 3K0BA 4MW5A 3GMIA 1NYLA 3NV7A 3V8VA 4MVYA 4YP5A 2O5RA 2CV0A 4U8HA 4ZT6A 2WB2A 4ZT5A 1JEEA 3N05A 3IUEA 4BWVA 3UMVA 4MW1A 3VRHA 2ZUEA 4DLPA 2DUMA 1WXHA 2E0IA 3SZGA 2EJCA 2IELA 3L92A 1GTRA 1K97A 3CLSD 3CLTC 4WSOA 4XFDA 1R6XA 1JHDA 4WNYA 4RUKA 3HGMA 3FOCA 1NUSA 1MC1A 3IMEA 2EL7A 3UK2A 1J1UA 3KT3A 1N1DA 4HK4A 3IVCA 4NATA 4RPIA 1ZH0A 1IH8A 1M83A 4L2IA 1H1TA 1O95D 5TS2A 4OUDB 3COVA 4JZYA 3NBKA 1EE1A 1GPMA 3NBAA 4ND7A 4MUJA 4JXXA 1JIKA 1G59A 1WQ4A 5TEVA 2CYAA 3ND7A 3ISJA 3BL5A 1F9AA 1MB9A 1I2DA 2YWCA 4EF6A 1M1ZA 2A4MA 2RE8A 4MUEA 3IOBA 4KPUA 3TM5A 2H2AA 1NUTA 3ND5A 2PXHA 4G5YA 3P52A 3G6KA 1OWNA 4PBRA 2I1LA 1YI8A 3TS1A 4EG8A 3QE4A 4CQNA 4QREA 3RK1A 3FWKA 4EG4A 2A1TR 1R6UA 2DEUA 2G36A 1NP7A 4R2MA 1U7XA 1J1ZA 1NUPA 3F3MA 3LCJA 2JANA 1EUYA 3FG9A 1N2IA 1OWMA 1TYBE 1WJGA 2X1MA 3TLJA 4F3RA 1GLNA 3HL4A 1M8FA 4MVXA 3HZRA 2X0KA 3CLUC 2ZUFA 1O0CA 3MLAA 3IMGA 1NUUA 1SURA 4HJRA 4OJMX 3A04A 4MVWA 4A91A 3TQOA 1ZUNA 1TYCA 4MWDA 5KCMA 2QJOA 5AHWA 1N2HA 3ILVA 4EG3A 3UC5A 1QU3A 4EFKA 5DK4A 4P2BA 2RD2A 1O96B 4QRDA 3TZEA 4UZFA 3PNVA 1MAWA 4GRIA 1M8JA 5H7XA 4DJAA 1CT9A 1KH2A 3QTTA 4Q93A 4ND6A 2Z09A 3SP1A 3SEZA 4PBSA 5FNZA 4MUFA 1KQOA 4CDNA 2DLCX 2CSXA 4KR9A 2QTNA 3ZIUA 1HYBA 2AKEA 1NUQA 5EKDA 3P0JA 1MBZA 2AZXA 5J59A 1YIDA 1JZQA 1JZSA 3LOQA 1D2RA 1JMVA 3HMQA 2PFSA 1ILEA 2C5SA 3CLRC 3COWA 1QTQA 4KKVA 3COYA 5IHXA 2YY5A 1J70A 4KR7A 4KPUB 2XRZA 3E27A 4XFJA 4DDMA 5TGTA 4EG5A 1KQNA 4XSVA 3VGJA 4I6GA 4AQ7A 2B7LA 1MB2A 4F4HA 1YUNA 3PXUA 1MRZA 1TYAE 1PG2A 1XNHA 2JA2A 3MMXA 3ZGZA 1UFVA 2NZ2A 1DNPA 1H3NA 2PZ8A 3C8ZA 4ZCQA 1KAQA 3A2KA 1PFYA 3IUBA 2TS1A 4NAHA 2VXOA 1ULHA 1M8GA 2HZ7A
chains in the Genus database with same CATH superfamily
4B2IA 3WRWA 4Q4HA 1Y4SA 5SZJA 3TFWA 1LNQA 1RS0A 3WOHA 4N0MA 1ZKDA 4M7PA 1OMOA 2P9HA 2ACVA 3LDHA 3TOCA 3DE2X 4L4ZA 4C06A 4CT5A 4BASA 2UZ1B 3O91A 4QUGA 1E5LA 2JFPA 4IINA 4OTZA 2AK2A 3DE5X 2HV8A 1CD5A 3QJ5A 4IDEA 3CBQA 2GAIA 3EXHA 4C6RA 4NDAA 2B5OA 5C3MA 4QTYA 4LJ4A 4MQLA 1G38A 2G83A 3NBUA 1TAGA 4KXUA 3PD1A 5EZYA 3MCAA 4G0QA 2J0SA 3SOPA 5I4KA 1I32A 2Y1CA 3GBSA 5LSAA 1EHYA 1NHWA 2BZ0A 4EO7A 1N5KA 2H9AA 4KRYA 2EQBA 2GZ2A 4QL3A 1ODIA 2B69A 2G0NA 3VDXA 2QV7A 3I42A 1NQUA 3DEKA 3MUNA 2RG1A 3VH2A 5L3ZA 3DB2A 2WA1A 3DE3X 2D2VA 3EDOA 3HA3A 5T5QA 2V9ZA 3GJQA 3MGGA 3GA7A 2G06A 3UH0A 2A9PA 1U0BB 5IASA 1VMEA 2E48A 3NHSA 3SHFA 3D6NB 4UE3S 1LSOA 4OYHA 4MWBA 3W5UA 3UCEA 5B58C 2OQRA 1X94A 3Q2KA 1V96A 2Q1SA 3BTUA 2BFCB 1L7MA 3E3AA 4J7AA 4BZWA 2EDAA 1H2WA 3ZE2B 2PGLA 3MIIA 2A1TS 3BXHA 3RIYA 2ZPUA 1V9LA 2IUEA 2TYSB 2Y1WA 3PNPA 1JSRA 3MXTA 4NK4A 4D9FA 5LXTB 1UAYA 1ZN9A 1MHTA 1N2ZA 3KAQA 2KBFA 4C3UA 1ZD4A 3JCZA 3LUKA 1CUHA 3IBFA 4QLAA 4FMDB 3EVAA 1Z83A 3D5EA 1RHJA 4HEHA 4RW0A 2QP4A 5EWJA 1E6CA 3UTCA 4CQLA 1IJFA 4KAFA 3A31A 1W4AA 4I2NA 1NBWB 3FKQA 4ODIA 1RBYA 1VSQA 1X1TA 4QLOA 4BQNA 5JNLA 4N18A 1NF3A 4FS3A 4Z7JA 3GO4A 3O38A 5JZSA 4IMPA 2AYXA 5F3WB 4QJIA 3K15A 1XALA 4FTWA 3KR9A 3PPVA 4K9QA 3LHFA 3P0RA 2HNBA 3QBEA 4N7JA 4Y6GB 3SFVA 4WCDA 3WLFA 4CKWB 2Q0HA 4JEUA 2UZ1A 4YCMA 1QU2A 1SOVA 3H8JA 1Z28A 3Q98A 2ZIEA 5CA0B 2F59A 4RH1A 2I91A 4HS9A 1CDEA 4MMZB 4X54A 4IGEA 2RH4A 1IRXA 3G0CA 1VG0B 3A9UA 2RGEA 4K81B 5FPSA 5AYVA 5FBZA 4F04A 1BNCA 2V7WA 1L1QA 2XUJA 1CUSA 1ODTC 3M9XA 4M46A 4WZBE 3PTAA 2JH3A 3RT1A 4GPAA 2WQ6A 4EGAA 3DHWC 2QGZA 3IEMA 1FJXA 2UZ3A 3V7FA 2FFBA 4JROA 5JAHA 5TPWB 421PA 1Z73A 5EPOA 3DTVB 2YWJA 4EJSB 3OIGA 4HGPA 2IIVA 4ZQGA 4V3BA 5KPDA 3AP3A 1NBEA 3NH9A 1Y42X 2AMLA 1E3TA 3FF1A 3NHUA 5CLQA 3ZLUA 1TEZA 3AOEC 1E5TA 2AZTA 2FXVA 3G7UA 1KEPA 3U7GA 2QWXA 1PK7A 1KYTA 3GRPA 4PGAA 1ZK4A 2WWIA 3EZYA 4W9NA 2VIIA 4DLNA 3UK0A 3HYNA 4NC9A 3GXBA 3HN6A 1NHGA 1L5WA 1TD1A 1VBNA 1DRVA 1WTAA 3ABIA 2ZIFA 2E55A 5BSRA 2QN2A 1DX6A 2PKXA 3NUZA 4ZTZB 3QKSB 4MUAA 3QMWA 2E5WA 1O9HA 1Z45A 2O2CA 5JPDA 3TJRA 3TZCA 1ZH4A 1E1KA 4Z4IA 1T6NA 3LRXA 3GUYA 1PI3A 4IOLA 4TYPA 3G5UA 1U1FA 1IBMB 1NYRA 3K32A 3OT5A 3C7TA 1H0HA 4XB2A 4V02A 4YMWA 1E98A 4AJKA 3O4JA 1Q7TA 1VRVA 1UMCB 1JHQA 4N8EA 4C0JA 3K31A 3B36A 3RHZA 1ZW6A 3FLEA 4YJHB 3PQEA 2D7JA 1AE1A 3OESA 3PTZA 2XJ9A 4K9NA 4CKWA 1FJ2A 2HMSA 2IHZA 4I50B 4L78A 3E9EA 1GN8A 4BU0A 3E2MA 3P9PA 1B73A 5CA0A 2F8SA 4GM0A 4DNQA 1RAHA 4J2HA 2GCOA 4BB5A 1Q84A 3V6LA 1FU4A 4E5KA 3MS4A 2HPHA 2AXQA 5B3JA 3T9DA 2J9YB 3G88A 2CMHA 3D6TB 1NJ6A 3DM5A 4FSHA 4XFKA 4PLPA 1QPZA 1U8YA 2HDWA 1WV1A 5FXMA 2WF6A 4YRFA 2YWDA 1B8NA 3Q7QA 4PYJA 3GA5A 4V0KA 3KQYA 5EE5B 3LPAA 5TPWA 2CVHA 3DTVA 4EJSA 5CDGA 1KZGB 2YXNA 1SB9A 1O6CA 1TL7C 3AL2A 2C7PA 4IYJA 4FZJA 3DD1A 5AVQA 5J4HA 1T5IA 1TKCA 4I5EA 2DC1A 3DOIA 3OHMA 4LV5B 4BVJA 2CKDA 3DCYA 1YONA 4BE7B 1PJSA 3KYIB 5KPJA 2H5LA 4OFXA 4R8KA 4J43A 4F4FA 2WAXA 3WRXC 1LW7A 1I0IA 1R6TA 4BO7A 5DHUA 1OFUX 5E3HA 1GJRA 5KQMA 3LLMA 4HMPA 4CUJA 1HE3A 5KYVA 1ZU5A 2WFLA 4U9IS 2WM8A 3A1SA 1VOTA 3B1KA 3IURA 3LNCA 3EA4A 3C5WP 5EFOA 4LFCB 3WC4A 4BLTA 2Z4TA 4U5XA 3I12A 1B14A 3IXMA 3I64A 1IWPB 2DBQA 5BN3B 1U3TA 1QRUA 3U3OA 4R8LA 3D43A 1S2IA 3X1WA 3AR5A 1SA0A 4EEXA 4DHEA 4OFZA 2HBQA 4QFMA 1ST3A 1YNOA 4OA5A 3OKAA 1UMCA 2CFIA 4XR9A 4KCGA 4ZEXA 5I7SA 4F2PA 1JWLA 2G1AA 4H31A 5E1BA 1BVHA 3CYFA 3VR4A 2C7RA 1FFXB 4YJHA 3TPCA 5IXJA 2P8SA 4QGGA 4DNFA 1LBSA 1GYPA 1JFTA 2OP1A 4I50A 1I30A 2ZKIA 3H19A 5FTLA 2EAUA 1KXZA 1SCJA 1OAOA 3UHJA 4HP8A 5EIEA 3MM4A 3ULKA 2E87A 2XVYA 4JFAA 4YEDA 1SKQA 1CUIA 1I1OA 1ZONA 1CKEA 2X4GA 4ZU6X 4A6XA 4E51A 2IBSA 1Y5LA 4IGFA 2BL4A 3PWKA 1XMOB 1PBTA 5KDOA 4PCLA 2VYCA 3RYTC 1GA4A 4MI1A 2O2ZA 3GVXA 1AGNA 3L1UA 1XWFA 4HWSA 3WLEA 4Q9HA 4WXYB 4X5OA 4B4VA 1W7AA 3O8RA 3QHPA 3VVLA 1DBQA 1NJSA 4OP2A 1JLMA 1WMBA 3SHOA 5AXDA 3F6SA 1YF3A 5K3FA 3RBAA 1AK2A 1IUNA 2HQBA 4I55B 2IV3A 3TF5A 2VO1A 2DB3A 4YB8A 1YCHA 2UYGA 1JILA 4EL5A 1XLWA 3KOUA 1FFSA 4MOWA 3G8CA 4LOKA 2YY6A 3M6IA 4WAUA 4YXFA 3OU7A 2WWWA 4LXHA 4P6VF 4E1AA 3VX3A 5LDGA 2BGWA 5CB0A 1ZOOA 1H2EA 1K7FB 1Y1LA 3AB8A 4PC3A 3JALA 3WRYC 5BUZA 3U3ZA 3QXHA 2QMOA 5ARDA 2BMFA 4WOKA 4HZIA 2JK1A 3QKWA 4COOA 4MUGA 4LGYA 4ZOCA 3K5IA 1JIIA 1U98A 4ZMSA 4L8LA 4U7FA 2QJRA 2VPTA 1NP6A 5BN3A 2C2ZA 1NWCA 3JYLA 4ZHQB 3DG9A 1CNFA 2EKPA 1BGVA 1L5FA 1NFRA 2BGRA 2Q8PA 3ZWYA 3H7AA 5IF3A 4ARIA 3GK3A 2WHXA 1C8LA 1PGNA 4IIEA 4NI5A 2H65A 1A5TA 1VI2A 4O1MA 4RGYA 5THKA 2ZRCA 2J6HA 1RZRA 1VPVA 2XHEA 3AGQA 1PTJA 5FADA 1I01A 1FFXA 2B0CA 4WJZA 4PSAA 2G70A 3Q3GE 2BI8A 3RRJA 2XCUA 3SIWA 2V9PA 2JAQA 4ZCRA 3VYVA 3WDKA 4KXXA 2X5JO 3FJYA 2ZUCA 1WO8A 1YOBA 4N7BA 3TIGA 4DMUB 1KIAA 3CEMA 4EQZA 3CVXA 1UZUA 3HWRA 1H66A 4RHFA 1E7SA 1U81A 1FMJA 5ECYA 4EZBA 5KJ1A 2DWPA 1XD9A 4G86A 3L5OA 1G21A 4F5EA 2WILA 5J1SB 3CKKA 3DZJA 1W6UA 1GLGA 1JJIA 3B85A 1Q16A 3CNHA 3NTLA 3UAVA 2OD7A 4U8HA 2QG9A 1IN6A 1QHGA 2Q29A 2B8JA 1LJ8A 3NTXA 5AICA 1AMNA 5GVRA 3CRQA 3R0JA 4D26A 1BOFA 4ZMBA 1QG0A 3AR7A 3DGEC 4ETIA 2W90A 4HQFA 2Z5FA 4BWVA 5FI1B 5M2QA 1V3TA 3RYIB 4CQMB 1D0IA 4YT2A 5HIIA 2NUPB 2CFTA 2IELA 4I55A 4R84A 2BUCA 3VZCA 1NOKA 2UYCA 3NNNA 1E1QA 1RT9A 2NYVA 4LDRA 4YMSA 1G4AE 3JWGA 2FOIA 4GLJA 2VDUE 4G0OA 3WQQA 1P2TA 3T3OA 3HGMA 3KETA 1FBNA 5FL7A 4JCCA 2FPLA 2ZITA 5FH9A 1RAGA 3IMEA 3R8FA 2PGIA 5CK5A 4JQZA 3MMPA 3I23A 1D7AA 1P1IA 4HCJA 3BWDD 2VQ3A 1XU9A 4KWIA 5D5HA 3UMFA 2WI8A 3UAWA 3QUQA 3R7AA 4M0MA 2DHEA 2EZUA 2MSCB 1XRJA 2HWKA 4Y0NA 5FPYA 3WIDA 2Z2ZA 4B2YA 2H4FA 4F2WA 4EABA 3BD9A 2B2CA 3GLRA 4MXDA 5DISB 3OFND 1I9CA 1W2HA 3ZWBA 5PGMA 4MUJA 2FHSA 3ZV4A 2G40A 3ODGA 3AK4A 2NTVA 3EASA 1KBZA 1NUHA 1KAGA 4J8PA 1EFHA 4FYJA 4M55A 3AHIA 4JYCA 4JI3B 3K6KA 2VH2A 2ZBPA 4XCXA 3R3HA 3WOVA 2O3TA 3TIVA 4ZARA 3CIFA 4B79A 4DRXB 3KJQA 2NTNA 4ZVRA 1DAFA 1WSWA 3W8EA 1U2ZA 4HN2A 4EYSA 4EZEA 5KYTA 5I8WA 1W36C 3HXTA 1I7DA 2KB0A 5EG5A 4R1QA 4I14A 3CH6A 4CM9A 5K3OA 1H2YA 3KP1A 4ASUD 4LV8B 2QK4A 4W9MC 3F2VA 1LFDB 3U4IA 3PDUA 4JC5A 3UXHA 3TH5A 4K7JA 4RDIA 2VAVA 5DYYA 2GN2A 4RPHA 3TZBA 4PTZA 4EA8A 4JELA 3RK1A 4IIGA 2F17A 3S6JA 1NNLA 5FLXA 1HYEA 1SBYA 4ZU3A 3JR3A 3G9XA 2WAYA 4MMYB 4O0MA 5F64A 4K8RB 3H4VA 1D4OA 1X1EA 1AF7A 1KC1A 1JDUA 2W4IA 1GUYA 3RYIA 4CQMA 3AVUA 3TE6A 3HYRA 2NUPA 4KX5A 3PEWA 1NBIA 4R8MA 1ZPDA 3PFNA 3CLUC 4G5SA 4WY2A 1COWA 1X19A 5I9LA 3JVDA 3OA0A 5E9WA 5HNKA 3IP5A 2VDRB 5AK6A 1L3BA 2YL2A 3V1MA 1XP5A 1CIPA 2RGAA 3ZGLA 1OQAA 4YCJA 4NABA 3RJ5A 3WYEA 1CJKC 3MD0A 1RKVA 3ZI7A 3PUKA 3LLUA 4CLRB 5A0TA 4GMFA 3FZYA 2F4NA 5C4GB 3TO5A 1SZPA 4J1TC 3W34A 2WJHA 4ED9A 5AESA 2WU0A 1O96B 2OY0A 4ZAGA 1KYYA 4DLWA 2ZSHA 2QTCA 3M70A 2VRCA 4I9NA 3EGIA 3FUVA 4C4PA 2OGUA 4DV3B 4E5VA 3A6KA 4ZYXA 1RFGE 1XVLA 1H4VB 1FDUA 2Z09A 1QS0B 5U4QA 3JPWA 3GNQA 4PBSA 5CTJA 4BMDA 4TV9A 7REQB 4XD7A 3GT4A 4JJEA 3HZZA 4M38A 4AKTA 2V1XA 2XTNA 3FB4A 4QD3A 1GP2A 1HYBA 4MCIA 4AG3A 3L0SA 1OH8A 4J0JA 3LO5A 3ESXA 5E38A 3FW1A 1WL8A 1K7XB 2XEDA 1YAHA 4TXNA 5DHPA 3ZBTA 1JI0A 2HK7A 3TB6A 4QYIB 3UICA 4F8JA 3DVSX 5AR1A 2PJDA 1DL5A 4FJ1A 1W35A 2ERCA 1TX4B 5EVCA 1SXJB 2FRVA 3NOXA 2Z6VA 4O8CA 2I71A 1HSOA 4TLCA 3TGLA 4C2UA 2FR8C 3PX7A 1YFJA 5ALXA 4JJZA 3DWEX 3ONFA 1L3IA 5BMOA 3SM3A 2OXRA 4BNYA 3MA0A 3PEFA 1YS6A 4QG3A 2IITA 3H18A 1R16A 4HAYA 4EENA 3QM1A 3CLHA 3VAYA 2Y8EA 1CPYA 1J06A 1JKFA 1PKXA 1TT5B 1U8TA 1VM6A 2F1RA 2H4JA 2QZ4A 3GEBA 1U1DA 3OTQA 2P9CA 1FLAA 1HO3A 4MCHA 2EERA 2D8MA 1WAMA 4FEGA 4DCPA 2WC1A 2JASA 2O2IA 2VH1A 4W5QA 2IRWA 4L7VA 2J5KA 3TX6A 4F0JA 5I7HA 1CJUC 4GOXA 4KN9S 2QLNA 5K01A 1NWHA 3QXGA 3HUFA 4GR4A 4DIDA 5L6MB 2ZE5A 2NXEA 4ZKEA 3K7EA 1KS9A 1UDBA 3EHEA 4NZNA 5FPHA 5A71A 1WDLA 3TAUA 4CLRA 1GFIA 3BQMB 1P0FA 3I2FA 2LWIA 5F7ZA 1O96A 2HA2A 4CG2A 1XDDA 3CH4B 5GJCA 3U26A 2K2WA 1ZXXA 1NBOA 4JUAA 4MR8B 3FTDA 1O87A 2NSYA 4NE7A 3I1JA 1V35A 3P45A 4NYMQ 4OQZA 2E4UA 4Y2UA 2D7CA 2I7DA 2ZRJA 3E9QA 2OAGA 3ADBA 5D3KA 5DHQA 1COZA 4XUDA 1RE1A 3KB2A 3G9QA 4EGSA 5B64A 4J03A 5L3VA 2JPDA 3G1UA 3PGKA 3T5DA 5HRUA 4JYAB 1I13A 3OKFA 1S02A 4N5IX 3L4BA 2FQQA 2I3DA 4YP6A 4PIVA 2NU9B 4DWWA 1VJTA 2F64A 3CVJA 1N8TA 3EDYA 4OQQA 1CQXA 2DFTA 1DWOA 1ZJJA 3PPIA 1KIMA 3CR8A 3WAGA 1RAEA 2XXBA 2ZBQA 5FPPA 3V42A 3HVUA 3M5WA 1XZGA 1SXJA 4IDFA 3ACCA 1RRMA 2FKAA 1CJVC 3G2PA 1TA4A 1G8FA 2X4IA 3DONA 1JJVA 5D1HA 3RK4A 3U1BA 4HLUC 5LN1A 1YL7A 1CY6A 1P72A 2PTHA 4IOMA 4UUPA 1H8ED 1GTZA 1Z0SA 1KFJB 4LBZA 4BO5A 2Q45A 2B25A 4ZJYA 1A97A 3BL6A 4XM1A 4P34A 5AVJA 1NKSA 2EGHA 4AMYA 2Q1YA 1W1WA 1TT5A 1ULBA 4JA2A 4MQMA 4P33A 2WT8A 3IODA 1CDOA 4BBZA 5BQFA 4BC1A 1NVKA 2HJSA 5ELLA 1PEDA 3A05A 4Q3EA 2I1QA 3DGFC 2XCTB 1H4QA 4PRZA 3VTFA 4B3JA 9ABPA 2VKQA 2C5LA 5DCWA 4YHHB 4CM1A 1QLHA 4CGYA 4O8ZA 4OHBA 2R5WA 2RCNA 3FCYA 1EDEA 3GDFA 3BM5A 1EG7A 1BH6A 3EVCA 3F3KA 4AO8A 1L5NA 4I8XA 2NVWA 4FCWA 5KJFA 2C07A 1KPGA 4NLLA 4JGIA 5AQ1A 3QX9A 2HHLA 3OOEA 4FFNA 5IPFA 4M0LA 4UM9B 2EIXA 1EM8B 1E64A 2RGUA 3PYLA 1NZDA 2JNWA 2JI6A 5KMGB 2LP4Y 5LWHA 1JHXA 3HJUA 4E7PA 1L3CA 2R11A 1QG2A 1SUBA 2YZNA 3EXIA 4MR8A 2YCBA 4QYWA 2A59A 4GR5A 4H59A 3UPDA 4AYTA 2XYPA 1E18A 4OHUA 4D4MA 1ID1A 5JAZA 1SPBS 2WYVA 4DEYA 1IUOA 2GFQA 3IVRA 1MIHA 4XDHA 3IHTA 2NU9A 2R97A 2WLTA 2ZRNA 1XL1A 3WLNA 3OP4A 1KI4A 1V2GA 2JDIA 3C3MA 1JS1X 1HYHA 3FBTA 1I4LD 1GZHB 1LI7A 3OX4A 4ARBA 3F97A 4L50A 3U44B 1DKPA 5TGDA 2IPLA 3WDSA 1EBFA 1EGQA 3OLYA 4CL8A 3QY0A 1UPCA 1Z18A 4O2AF 2C9YA 4HNRA 2JGDB 5HKBA 1X7WB 2WZBA 2Q2OA 3TMAA 2ZK7A 3M83A 3ON5A 2O3RA 2P2DA 3ELDA 3PX2A 4L0MA 4QXOA 4RESA 3ZQUA 2L0XA 3HSSA 2ZE6A 3DMFA 1DLIA 4Z51A 1LPSA 3A3NA 5ALZA 3VR5H 4FEYA 2RHBA 3EW7A 3H9GA 4YJKA 1CEYA 1HKUA 1LK7A 4PLYA 4TM8A 2BMJA 2W2OA 1A50B 3N8HA 4CNQA 2VHZA 2ZJOA 2Z9DA 4R1OA 1TO2E 5HK8A 4JZKA 1RTKA 6Q21A 1WEHA 1H05A 1YVEI 4LTMA 4XDYA 4BDSA 4YQYA 3DPUA 2PXAA 2E1RA 1TVMA 3ZHZA 1UJ2A 3H86A 3O47A 2FWNA 3F5DA 2QTHA 3RS0A 3IUSA 4UTZA 2QAGB 4FKMA 1GZVA 4HQKA 5DDIP 3ID6C 2PUGA 1XF1A 3HLYA 2KS6A 2OYRA 5KMGA 3EQ7A 5DWDA 4I5GA 3BE8A 1XTBA 1UBFA 3FBGA 3SZ3A 1E69A 4HFJA 2R8YA 1LTHR 2Z04A 3ZWWA 3KKNA 4CIWA 4DDKA 2FOXA 4JJIA 3SF0A 2ODWA 1PFUA 2SHKA 4MI6A 3WKDA 1M2GA 4GOOD 2XMGA 2PT9A 2C96A 3D3QA 1C8KA 3NTVA 3LRPA 2PKWA 4D3SA 3A6ZA 4AJIA 5IW8A 4HWRA 4AROA 4EKYA 3EPKA 1ZVVA 1RLUA 3GD7A 1R27A 2ZBRA 3LS2A 4CLXA 2BEKA 2VHVA 2OHVA 2C4HA 3OEHA 5CMLA 2WIFA 5A1TA 3G2QA 3CMMA 2C3OA 2IX3A 3U44A 2HSZA 3IT3A 3ORHA 2ZM5A 3MWYW 5TE9A 1VQ1A 1ML3A 2H85A 1U4OA 2NOAA 2WMOB 2XYGA 4DILA 2HK8A 1X7WA 2K87A 2LZ0A 4PR3A 3ZK8A 3LDUA 2ZSJA 3RLIA 2X0RA 4ZN6A 5F12A 2DWUA 4NESA 2NNLD 4YXWD 5KYGA 3OPYI 3I53A 3IVAA 1IAQA 3GLGE 1VIYA 1MJGA 2X9GA 5H5JA 1I94B 4ES6A 4NCXA 1QIMA 2CHUA 4Z9YA 2HRBA 2ZE8A 1NZJA 3GMSA 1F1BA 4FLFA 4JC4A 4P4GA 5EWMB 2A3NA 2DF8A 3I1FA 2VP4A 2ZBFA 4U0KA 5SICE 1Z2AA 5JNRA 1A9XB 3VUEA 5A9RA 5GADl 1Q0LA 4TM7A 4AY3A 4C5AA 2ORIA 3GAAA 3EA0A 4GWGA 2CLEB 4PCVA 3D31A 3AM1A 4DJJA 1CQIA 5ES4B 1D1TA 2VHWA 3LM8A 6LDHA 1XDUA 1GYQA 2I6TA 3TYXA 1ABEA 2QAGA 3U39A 4AO7A 1FRNA 1HYQA 2RI0A 1CJTC 1CUYA 2FUCA 2V4MA 4G37A 4KXYA 4Q18A 1XAJA 3ICCA 1SU8A 1UC8A 4FX5A 4NEHB 4REMA 2Y27A 1O6FA 4L02A 1I7QB 1DBSA 3RGGA 2JA1A 3AHEA 3TLMA 3ROGA 3GGCA 2A94A 3QMVA 4IVPA 1T9DA 3WADA 1NQVA 3JQGB 4TUYB 2I6FA 3BE4A 4URYR 5FWXB 2AWOA 4BUZA 4GEKA 4GX1A 2UUCB 1FTSA 2IGTA 1S2LA 3H75A 1FXWF 1ZNYA 1GUAA 1K08A 3AVQA 2C0PA 4HAOA 2RH5A 4YWHA 2FEKA 4QJ3A 2VWQA 4ZA2A 3IULA 3KZNA 1ZMXA 2EX1A 1ZCBA 4Q3AA 2R6FA 2C2BA 1UPFA 2WJYA 2LNDA 1J2YA 2YYYA 4QO8A 3ZE6A 2HBYA 3PC4A 4E5UA 4L4RA 1M5TA 4LGCA 5LQDA 4GPD1 1KYZA 1MFZA 4MWZA 4X8LA 4LE2A 5FAXA 2QMYA 2GWRA 3Q8LA 5IMBA 3RKSA 3PUYA 2YXLA 2HO5A 2C20A 2WHQA 1JU4A 1QMGA 5CVJA 1X9HA 3I2YX 3X1ZA 3QLUC 1FSGA 2HXYA 3DP9A 4H3HB 5EOVA 3K1JA 4JJGA 3SD7A 3TRIA 1ZI6A 4ZGWA 5DI3B 3NX4A 1X9GA 4IDAA 4KAJA 4LDQA 4TN5A 5AVSA 3B78A 3IQEA 1VBMA 4PICA 3IL2A 2XGJA 2EX4A 4B34A 2CNNA 4FDMA 1Z6YA 2H2WA 1M67A 4P93A 4ZYLA 2HCJB 1IONA 2IYRA 2CK3D 5G0UA 3HVHA 5A03A 3WAJA 3LXUX 5EWMA 4EI9A 2Z30A 2ZDGA 2NP7A 1A9XA 3PDCA 3KOXA 2JHFA 2I87A 1QLJA 4PC6A 2IZ7A 4JUIA 1XWWA 1GRQA 2WKPA 4NV1A 3WGGA 3RS3A 1ZK3A 2NN3C 3S55A 2YRXA 4TVBA 4XD2A 3KM0A 4LG1A 3HBJA 5KYYB 1N34B 1N6HA 1Y6RA 4NMLA 1WBDA 2BMEA 1W581 2XWJI 3R3ZA 2MJLA 1HKHA 1S2GA 2LDXA 3IO3A 4L6AA 1DC4A 2J31A 4M8SA 2XUQA 1U6JA 4Y2SA 1QV9A 1GCAA 3JVIA 5D8DA 2A84A 3PI7A 1XKQA 1XD2B 2PLNA 3REOA 4F84A 4UBJA 1E1CB 5FWXA 3JQGA 4TUYA 1L5LA 4C0XA 2O8CB 4OQDA 5KWVA 4V0SA 1SXGA 3CEPB 2DLNA 1AKMA 1V7CA 2GLTA 3AYZB 4I99A 1U0NA 2EWMA 4TTQA 3E70C 4Z2YA 3SLKA 4AUNA 4IHKA 1L7AA 2Z4RA 3BL8A 4F06A 1QFZA 2J30A 3HUEA 2X3UA 1RU3A 4P7GA 5FPKA 5KUTA 1E3LA 1G41A 2YXDA 4C30A 3UHOA 4ZT5A 5I9SA 4NV0A 4R01A 3K35A 1N7JA 1UM8A 1T9ZA 3DLCA 2LGJA 1E20A 3CM0A 3OLQA 3P2YA 4P7BA 1K06A 4CTJA 5JBIA 1IN5A 3GLSA 3SZGA 1MUUA 2EJCA 2GR9A 1FDVA 2PH5A 1K97A 4OGWA 2C9ZA 3CLSD 2Z56A 2QPLA 4QAQA 1I6WA 2FNAA 3ZZTA 1GQYA 1FDRA 3VISA 5GWXA 2CY0A 1P1KA 2OG1A 1O1YA 4HNSA 4RUKA 5AM0A 4DUGD 2BBTA 1KEUA 1PX2A 1QRAA 1SMKA 2GF9A 2HHJA 4JJFA 4Y9DA 4TTJA 5E1DA 3WRVA 3RHTA 5AHRA 2REBA 3HCCA 2PDAA 2VUTA 1C7ZA 3AKYA 1KVTA 2WF9A 3IVCA 2VL7A 2EKBA 5CNJA 3UAXA 2IP4A 4FJ0A 3WHPA 4C1NA 9LDTA 2HF2A 1LDGA 3LC2O 3ZJYA 2Q28A 2QVYX 2Y68A 4GOLD 1FYXA 1WZUA 4G4JA 2A3RA 5I4BA 2OMEA 3D0QA 4CIBA 2XQKA 4NFHA 4JY7A 2EKZA 5EWLB 1KE1A 3V1NA 3FSJX 2P90A 3TXYA 3U37A 1EVLA 3DTTA 3A6EA 2DBVO 4WOCA 3MS2A 4TV8A 3EQZA 3F46A 3HK2A 4UDOA 5FEMA 2AF4C 5A06A 3DS8A 4CBVA 1HUQA 2YBDA 4U7WA 1IE3A 4AKEA 3NETA 2NUTB 4OV6B 5C1DA 1QH8B 2CXSA 1XD2A 3O8QB 4GOJA 4DR3B 1E1CA 2HQSA 5BVHB 2O8CA 1U8EA 1LBTA 2IVFA 3OF2A 2O2GA 1GNSA 3A3YA 2P41A 3U62A 1FFAA 4XARA 5GONF 1FXUA 2AMJA 1OTHA 3OE4A 5C1IA 3NFRA 3ZVRA 1EH5A 2GBGA 3O03A 2GRJA 4IYRA 4DWOA 5M7EA 4QPDA 3CIOA 3FWKA 3OFVA 4CUZA 4CU5A 3R9IA 2GZDA 2XOKD 3LGSA 3V3TA 2HRRA 3PE3A 1T6BY 3DZBA 1I80A 3FCUB 1SVOA 1PJ2A 3D2AA 1GPLA 3TL2A 3EARA 3B9QA 3ENNA 5JQGB 1AQJA 4MEJA 1E9EA 4HDOB 4Y2QA 1N2IA 2YZMA 2QN8A 4HMOA 4ZYYA 3LKBA 1A9PA 2YBEA 2N47A 3KQMA 3GJRA 1NDQA 2WNHA 2WPDD 1J99A 1YFLA 3TLYA 4NMXB 3UGTA 1SG0A 1T8SA 1W52X 1Y7PA 4FWIB 1SXHA 5KSZA 4MPRA 1HR0B 2GX6A 1MOZA 3PA8A 1E2LA 1TUBB 1B26A 2GO7A 2PO5A 4FXPA 4YO8A 4KXMA 4EKIA 3ZXUB 1EJBA 4YCCA 3F8WA 5IAEA 5FBHA 1N2CE 3M1IA 2YZ2A 2IS2A 1UH5A 1W6RA 1EB9A 3H6HA 3TZEA 3E8SA 2VAPA 1DC7A 1R0YA 4JODA 3GLQA 4UZFA 4WKBA 4UM7A 3PNVA 3M6AA 3TTWA 1OLUB 1IZ7A 2B4QA 2OCBA 3RJTA 5EWLA 1ST2A 3SQWA 1NONA 1FS6A 2QVBA 4RTPA 4R81A 5JAIA 3QU5A 4PZDA 1FP7A 1QPBA 2NO1A 3LOPA 1LV8A 3KYBA 6PFKA 3HLTA 3SOZA 1NOIA 2X7XA 2XUHA 3SNKA 4EY5A 3W5DA 3EGEA 4BFTA 2WAMA 4J0FA 3HXMA 4IOKA 4IAOA 5G4KB 3THRA 1B6GA 1PSDA 1RMYA 3I2IA 4OJYA 4YAJA 2NUTA 1QH8A 5JAOA 5JSHA 3O8QA 2MR5A 3VMMA 1Y5MA 1XJ5A 3QE3A 1HE2A 4WIAA 1XVAA 2VNIA 3B1YA 2HPZA 1UFRA 3GUUA 3K9LA 4IIJB 4J2OA 4NFYA 4RFSB 4PG8A 5CG1A 2C5SA 4QFBA 5FCDA 1C9JA 2YJ3A 3D9QX 2IY7A 1QQAA 2GZRA 1KE2A 4FMCF 2OSVA 5JS7A 1QO9A 1V3QE 3R6DA 2RKOA 3IKJA 3KOWA 2OR3A 4PSKA 1ZM2A 3OO1A 5I3ZA 1F2UB 3OPXA 3O5AA 3GV0A 4Q4JB 4BJ5A 1X1QA 3CB2A 4REOA 3RVMA 4AQ7A 2JD0A 3MWJA 1UC5B 5JQGA 2O8NA 3TRKA 1JXOA 1G5HA 1PD1A 5CD1A 4D4IA 4Y1EA 4YP1A 1LEHA 1SHZA 4JQYA 2J0UA 3IUBA 2A5FA 4UREA 3OZFA 2TS1A 1JQ3A 2YFKA 3B6MA 3EEYA 5K3AA 4HEJA 4EY6A 2PYZA 5K8VA 3A4LA 2OA0A 3OURA 4FDVA 4I1IA 2WSYB 3EMKA 5C7IO 1PWHA 1UKVY 4B6QA 1R2QA 4BPRA 1P1JA 2ON6A 5EZ5A 1H6AA 4A0HA 3HB9A 4ZO6A 3DVLA 4HDMB 2QZSA 1MC4A 1T25A 2RI1A 3F47A 1IBSA 1C0EA 2WYUA 4BNNA 1O97D 1E58A 1K63A 4IHJB 1WKCA 1B41A 3OUZA 4MKGA 3FX2A 2FK7A 2OE2A 3I4FA 4IWYA 1L5HB 4RY0A 4JL8A 4C4TA 5I7VA 4QU5A 4HR7A 4R2LA 3G82C 4QEKA 1PW5A 2R85A 1N2SA 1E0DA 2J59A 2OV4A 4GUDA 1Q19A 1E8DA 1NRWA 3M4ZA 2P30A 3KKKA 4KWTA 4E5YA 1WZ2A 3IUQA 1OJLA 1L7OA 2GUWA 3S5UA 2DSNA 1RR6A 2R6CA 4JYBA 1WDTA 4J49A 2R7NA 4JC8A 5G4KA 2B99A 2M1XA 3OE7D 4KLNA 2I4RA 5DNVA 4OY3A 5EIFA 1JB1A 1ORTA 2PUFA 2OUIA 2XE8A 2G6TA 4FMBB 4IIJA 4RFSA 1C80A 2L19A 4WBNF 1ZNWA 4OXNA 1PJTA 2WM3A 3W90A 4JUCA 2DBZA 3TX2A 2RDMA 3BAFA 3B9RA 3CW8X 3KKEA 1MJFA 3V80A 4JYZA 4LF9B 5DVZA 1SM4A 4N8DA 3FF4A 2JCGA 3LFUA 8LDHA 3BRQA 1HOTA 4Q4JA 1DG1G 2CFOA 2VHUA 4RVNA 3WYDA 2FY8A 3T3HA 5AKXA 4RQAA 3E23A 2OCPA 4HY3A 3ONDA 1EEXB 3RM3A 5B6PA 3UMRA 4MP3A 2Q1WA 1XZ8A 1A4UA 1F2DA 3W0LB 3N0TA 3WWYA 4RS4A 1S3SA 1M7GA 3BVPA 1NBMA 3ROMA 4KHPB 1FVFA 3M1AA 4MSUA 1O8BA 1NG9A 1XQVA 3B1JA 2OG2A 4XIFA 3V2IA 5IULC 1KY4A 2V55B 3OE1A 2D1TA 2AX3A 1WCWA 2GMWA 3I34X 3V4LA 5BNZA 1I3NA 4DA6A 2XKJE 4UEWA 3ZCUA 4Q3OA 4OQYA 5E6SB 3FMFA 5TQJA 5A3SA 1TGYA 3KUKA 3CSDA 4Y2YA 4EJFA 2XITA 3GT0A 1Z7YA 2CF6A 2CJWB 4BGUA 3W8NA 4CKBB 1OB5A 1U1EA 3ZHOA 1SOAA 3HB0A 2D2EA 4K2AA 1EFRD 2NZVG 3PD0A 1GUZA 1HLDA 1L5HA 3L8FA 4NOLA 1P33A 2DH5A 2PLRA 4IR7A 3I04A 3H17A 3CNEA 3Q5DA 3QVOA 2G17A 3GROA 3KZ1E 3BORA 1XJQA 4Y0VA 4C03A 4YLGA 3ZWNA 2AQHA 4A26A 1GPKA 1GZ4A 4GX2A 4NOKA 3CF2A 1JAZA 1VPDA 2PVCA 3D7RA 2IDJA 3GGGA 4X95A 3C1TA 3UAOA 4F4IA 2VZ9A 6ADHA 3RGWS 4L5AA 3UTDA 1ZCAA 4F7WA 3LKVA 4RVSA 1G3IA 4X45A 5BQXA 2P9GA 1UXKA 1J5PA 4AURA 4GKAA 2X41A 4KYIB 4YJFA 1OC4A 4H2DA 3SQOA 5JD5A 3ELWA 2CZGA 5DCUA 4C7VA 1E32A 4K1LA 4RJJA 3T3EA 1CUDA 1XMVA 4OPMA 4PO9A 2ZIUB 1VCNA 1FP2A 4YO7A 5EXDA 2AN5A 1G8SA 3K9HA 3QJGA 1P0QA 2D3TA 4WX2B 4DIFA 2W0MA 3VO8A 4MWOA 1V7PC 2FLKA 1CZUA 2QV0A 2C5FA 1XZDA 2XSZA 5KVVA 2YJGA 1NGSA 3KOZA 1CEEA 4DE5A 3I32A 2PJUA 2X19A 4HS4A 4Y9TA 2CUNA 5IZCC 2PH1A 1QAMA 4JLDA 5IVHA 1LDMA 1H2FA 3C20A 2JFHA 2P9YA 2G7MC 3E9YA 3HVJA 4S1NA 4PZPA 4UBKA 2ERYA 3FHTA 2QUZA 1DDOA 4CDGA 2HPVA 1X8XA 1NASA 2YOGA 4RKRA 4Z9AA 5E6SA 1LTQA 1CDDA 1NM5C 5JRDS 3J81A 4KN5A 5B7PA 3FXAA 1NMXA 3G0BA 1HF3A 5LCXA 5JDIC 4IZ6A 5FOWA 3N7AA 2X2FA 2CJWA 3P7MA 4CKBA 1M72A 2PYDA 2FK8A 2FW6A 2KX7A 3ECAA 4YPVA 2OHXA 3PDIB 5CM9C 5CXSA 2GSWA 2IQIA 4ZO4A 4GOKA 4HI0E 1AXGA 4CIVA 4AN0A 4W5TA 3D8NA 5K0CA 2A88A 2QQ0A 2Y1OA 1WSBA 3JY6A 1A2QA 2QLFA 4H16A 1MG5A 2B94A 4KFTA 3BH7A 5A4JA 4JVLA 3AJEA 3EZ9A 4PXAA 2C1XA 4J29A 3I01M 2BWJA 3QA3E 2Z2IA 4JLBA 5HPYB 3GP8A 4M88A 1T4MA 2JCSA 3FFAA 3DMRA 4IDOA 4HXFB 4J76A 4Q9AA 4RF5A 4ZYWA 3RC8A 2WWXA 1DI0A 3ML1A 4JBHA 4UXHA 4HLNA 3TQIA 5BW5A 5JD4A 4Q66C 5H3CA 3N86A 3WAKA 2Y6UA 1BGXT 1GYRA 1AIPA 1C4KA 2A0YA 3BZWA 5CYOA 1KDVA 1XTZA 2BLLA 4P86A 4Z53A 3KIPA 4ZRMA 3E9ZA 5IAJA 3B7GA 2IW1A 4V38A 1KVUA 5AKYA 2MSWA 5I47A 1BRTA 3UUGA 3BUSA 3CUVA 4N0EA 4KPEC 3FTEA 1T9CA 2Z8YM 1KXJA 4LJKA 2OORC 4FE4A 2OXCA 4IX9A 5DTMA 4BGVA 4QYSA 2EC5A 5MN6A 1VLQA 4YS6A 3FRIA 2NX2A 4N5LA 4V39A 2R79A 1TCBA 4WZ6A 1KK3A 3BE6A 5IJ9A 4P4TA 4PCAA 4RCYA 1G3MA 4HYTA 2XF2A 3S0JA 2CT8A 1GY8A 1PLKA 2G5CA 3RTAA 3U9SA 4BFUA 1WUIS 1W4BA 4Z3KA 1CNEA 1Q83A 3DBOB 4WI1A 2MYPA 5FUQA 1E6MA 3AHCA 5KEIA 3AG5A 3QFSA 4K9MA 3VGPA 1NDHA 4Q05A 5FO0A 4CF3A 5FI5A 3MQFA 3KSDO 4HGZA 4HNQA 1WM1A 2PGNA 1CR2A 3PNMA 3GNTA 5E9AA 1JFRA 3SC2B 3ZJ5A 2IF0A 1A8QA 1G8GA 1R9MA 2GK6A 3O4FA 4A2QA 4QATA 4DA8A 1KGSA 3KQNA 2OBXA 1FSSA 3R6GA 2G82A 3PDIA 3S2GA 621PA 1GKYA 2RHLA 1OI7A 4L22A 4RSGA 3WGHA 3FDIA 2W6IA 3AOEA 1AHNA 3CEJA 2XVAA 3GT7A 3UWMA 1DKMA 1XTPA 2GEDA 4AJJA 4AULA 4NBWA 2G07A 5YASA 4KQXA 4ZALA 3GELA 1X2EA 2E4XA 1N6RA 1O5IA 2HZBA 3Q7EA 5TF4A 3OJCA 4ND8B 4CCSA 2G1KA 3C6KA 2QTTA 3RS9A 3NOVA 3IYLW 1GOTA 1OW3B 4NJMB 4ZJUA 2BP7B 2ZJ8A 2BV3A 5DASA 4DADA 2VT6A 2FCRA 5KU1A 1LVGA 1E1DA 3MJ4A 1VPWA 3RROA 4ZWNA 2J9XB 4CCYB 1IHUA 3VR6H 5JXGA 2POQX 3PWZA 4P7JA 2XQJA 3WY9A 1S96A 1M6HA 1XZQA 4K9DA 5C7OO 3WP1B 2H1RA 2HB6A 4O5OA 5DLPA 3HBLA 5CDSA 1DIHA 1AT1A 4NARA 3HS3A 2Q4EA 3AQIA 4L5BA 4R2WA 2GF2A 2O3UA 3W9UA 1A69A 1Z38A 5DBHX 2QI9C 1OASA 5LZ2A 3LAWA 3NRJA 3MFYA 1KSGA 2P68A 5JADA 3BF8A 1Z5ZA 1X38A 3UT6A 3JX9A 2CL0X 4IEFB 2IP2A 2Y1KA 2CEKA 4OHFA 3T5PA 3DLHA 1S8FA 1TRKA 2QHXA 2CMFA 2XUIA 5E4FA 5EE9A 5IYZF 4O5AA 2AYYA 4JASB 1F14A 4XEHA 3W6NA 2JVJA 1RPNA 2Y2UA 3HDGA 5DYNA 3V00A 1UAGA 3CPEA 1WVIA 3R0ZA 1OWPA 4OJNA 2I7XA 2QG6A 2DH6A 4BQPA 1IJKA 2V5AA 2HLNA 4I4CA 3TOVA 1UBOS 2H7VA 2PKEA 3GUVA 3RW9A 4YT8A 4NE2A 3VFDA 1WKBA 5BNWA 1ILWA 2KI5A 1E79A 1Q1AA 2VHQA 5AP9A 4F85A 2Q5EA 3R3JA 1ND6A 4INOA 4PFKA 3VV2A 1K89A 3E7PA 2G08A 2N3ZA 2EOAA 2FETA 3FPBA 4A5SA 4J9UE 3GGDA 1YJCA 4BNTA 1MEEA 3D7LA 4N47A 1Z0IA 4FKZA 5HR5A 3RF6A 4BHTA 1JQ5A 1ZINA 1NU6A 1Y80A 2OB1A 3CISA 4MV3A 3WRXA 1FW6A 1CQJB 5EZ6B 5BRAA 1HRKA 5TJHA 3Q3IA 2IEBA 4JNCA 4ND8A 4JJKA 2HQ1A 4FDTA 1PU2A 3LDFA 4NJMA 3EIHA 3LG2A 2BP7A 1V95A 1UBEA 2XH8A 3AVYA 3C39A 1CFJA 2DHCA 4MIEA 1AJEA 4P82A 4RQBA 3RF7A 3DE4X 1C9DB 3L8MA 4MW1A 3KKOA 5CFQA 8ABPA 4MDEA 4CCYA 2NPOA 1UQUA 2Z5GA 3K0CC 2BHSA 3DZCA 4RJKA 1EB8A 2FWPA 1F51E 4WZZA 1JHDA 1YR8A 4N3BA 2A57A 3T7TA 4AKGA 4ND2A 3X1YA 1ZUNB 3WGIA 4OHZA 1QQ7A 3R3XA 4E6EA 3SF8B 4BFLA 2EP7A 3PF9A 1N1DA 1OYYA 2P6UA 4LJRA 1V48A 2GGSA 2P65A 1IWBB 2GAJA 3FNFA 4FJ2A 3ZTTA 1BFDA 1S01A 3JWJA 3RSOA 3PRKE 1H1TA 3R7SA 1UINA 4LXIA 1AGRA 2EVWX 3WNZA 3PHLA 4OHRA 4PLTA 1ZQ1A 3IQDB 3CJQA 4IHQA 2AOVA 2WWGA 3A1UA 3CO5A 1JIKA 1YFKA 3FR7A 3K2BA 2VRWA 3MJDA 4RZQA 4UPDA 3V4SA 4A7PA 5AW3A 3CNOA 4CF7A 5L45A 4IX1A 2BBWA 3DTVD 2BPOA 3V9PA 5CXUA 1HXHA 3K05A 1NNUA 4UNSA 1RPTA 3OICA 2OB2A 4IVRA 3Q1LA 1I2DA 2CNOA 4D9EA 2A4MA 4DGSA 3HV2A 3PLAE 3G23A 4ZYZA 1PNQA 1KWKA 4MGYR 4JEHA 1GTG1 3KJXA 1UPUA 2GBCA 3G6WA 1ZG3A 3BRWA 3R3WA 4LDNA 5F2KA 3UNXA 3TM5A 3UJBA 2HWWA 4QVKA 1D07A 1Q1NA 4GGOA 4XXHA 4G4IA 1P9OA 2DBRA 5BNTA 5L51A 1CQJA 1DT3A 3ORFA 1SRQA 3F2IA 3WRYA 1LFAA 3AR6A 3R7LA 3FMPB 1VL0A 3RWOA 3HEBA 4H4DA 4ZOLA 1P60A 1IK6A 3CMCO 3E4CA 1J1ZA 3GLIA 3WJAA 1Z7WA 1JLKA 4KWCA 3ROFA 1CQWA 1GTMA 4EF5A 3OZEA 3FG9A 3DE6X 1YJQA 2O19A 1PKEA 4ZDKA 5G1NA 4AJHA 3DXXA 2VHEA 2Y92A 1JT2A 5LDDC 1DXQA 1E1NA 4NS1A 1CVLA 3WLRA 1XHEA 3ESBA 5IVIA 3HZOA 1XAHA 1JKIA 3VR4D 5AJZA 4A91A 5LLSA 1B43A 4TWIA 1Z2NX 1BWQA 2PNFA 1ZUNA 2LCIA 4XAQA 1TYCA 2VH5R 1JL3A 4MWDA 5FJIA 3BJRA 3SF8A 4YMVA 1ENOA 5EP1A 4MUBA 1E0JA 4RJLA 4BCCA 1SVMA 1PJZA 4QQNA 1HDEA 3ZGOA 4B84A 1ZLXA 1Q92A 3AR3A 4F4UA 4GDMA 1RYEA 4MS4B 4E3ZA 1IMJA 1NLYA 4EFKA 3LP6A 4WKPA 1QCCA 4HRAA 2FQXA 1WLYA 3R20A 2QVCA 5B4TA 4QBGB 3BG5A 2PKRA 3JZDA 3TRFA 3W05A 4BWYA 4D0SA 4QM6A 3AI7A 3KVOA 3ZHCA 5SZKB 4ARSA 3O1LA 3LZDA 3C8MA 3WBJA 1GZ5A 1X39A 1JHRA 4HAIA 2GKOA 3NHAA 3RRMA 2WLSA 2YJTD 3AF2A 2QP3A 3MZ0A 4I1OA 1J0XO 4X3OA 2P9BA 2QN9A 2AKEA 4H7JA 1MBZA 1LJUA 2LE0A 2DULA 4V1CB 3JVUA 1W87A 4YRDA 3HMQA 2R1TB 4TKMA 5ERGB 4BX3A 5CVTA 1GVNB 2OV2A 3O0TA 5CB6A 2FSFA 1QTQA 1GNRA 3W3ZB 4KKVA 1I5EA 4MR9B 4JH0A 2FSVC 3GZNB 3KPJA 1J70A 1KO5A 2FWMX 3QE9Y 2DHQA 4I8IA 4GM4A 3M33A 1B0PA 1YCDA 3R2JA 4R1MA 7GPBA 4TROA 4JFRA 1Q7RA 3FLBA 2BI4A 4G0YA 4XIGS 2Q21A 4LISA 5KVSA 2XGGA 2JATA 2YFHA 3G7SA 4X1KB 5AI5A 1JR6A 1JQBA 1L5ZA 2X2PA 4HUJA 1Q2XA 4E5SA 4FGZA 2G71A 2YMMA 3MRSA 4MA5A 4OEHA 4PYLA 1JBKA 1RZRD 1QFMA 2J87A 4OIFA 3RVJA 3QPWA 4GQAA 4DIEA 1U3VA 4Q02A 4XEUA 5AOBA 3EMVA 3MJVA 1L5QA 1ZSNA 3FNQA 1XCOA 2VDNB 4HKTA 2WFZA 1QGOA 4MVJM 4Y2PA 4Q9JA 4BYGA 2G5GX 3OZSA 1QUFA 3HO8A 4ER5A 4EUFA 3AP2A 5CDUA 2UZIR 4CF6A 4RMNA 3W3AH 3RTEA 2FQWA 3BD7A 4P53A 1YKGA 3UHAA 3P0IA 3W9BA 1SCQA 2HMTA 1U2TA 3FYUC 3ABSB 3CNQS 5CT9A 5AMXA 3ZU4A 2O48X 1AUVA 5B12A 4LFBB 5CDHA 3RSLA 2AIRA 4MQFB 1CG6A 1FUUA 4KL8S 1YI0A 3KJEA 2I1WA 2B1JA 2PL3A 3TIFA 2W6JD 1XNGA 4Z49A 3L7NA 4E0BA 2BJWA 4RA6A 5EHXA 2CNLA 2XOXA 1YE8A 1ZOLA 1TZBA 3E5NA 3LBFA 4JP5A 4QYMA 3FA2A 3ZZ0A 2XZOA 3PFGA 1RM5A 4EHHA 3PR2B 3DL2A 4IP0A 4H7HA 4MVJI 1GTSA 5JPIA 3VNBA 4LECA 1E1QD 5I7AA 2CD7A 2BRUC 5BNFA 2OGSA 1QVZA 4MLCA 1IN8A 3V8NA 2O0KA 1N78A 2A78A 4DV6B 1IHOA 4X61A 1VE3A 2UXDB 1EX9A 1BG6A 3UPUA 1SIOA 3GZNA 3GLKA 3OEEA 2AXNA 5BUQA 1U28C 3R0IA 5H81A 3RVQA 1QFSA 1K2WA 1T6ZA 1XHLA 1G8MA 3CZ5A 3HBFA 2GJ9A 5DIFA 1T3GA 3DMHA 3VOAA 1P4GA 1R5JA 2PWAA 4J1TA 5GOZA 3JWHA 4X1KA 3NT2A 1RRVA 3QKRA 4AY4A 5J47A 5DF1A 2KLBA 3H04A 4F60A 1CS0A 2JRLA 2IUUA 2Q0QA 3WIUA 4DIKA 1R9GA 2GXUA 4Y30A 4IY1A 1HC7A 3RHFA 3FVRA 1DCTA 2I2AA 2GVNA 4U2KA 3KB8A 1EJ6A 2QNIA 2QGNA 2FKNA 2YXEA 4NNJA 2G9VA 4RPCA 4TMZA 2F67A 4M8KA 3U2QA 4G8CA 4LHZA 3UANA 3JD4A 1VL2A 3EYWA 1KF0A 1N8SA 2FVXA 3F6PA 5K4HA 1YQQA 2P27A 1RYBA 3LUFA 2CXRA 1D5CA 2JHCA 1II8B 1X7YB 2D1SA 3LFHA 1VPTA 2I4OA 4FQ5A 4HTAA 4PVCA 2VT3A 4CM9D 1EFTA 3AVTA 1GZUA 3KWMA 4UVDA 3C1MA 1R7RA 1WXGA 3P0EA 1HT2E 2R96A 5E6UA 1PD0A 1CIJA 4B6OA 1YRQA 4PBTA 1XJWA 1JR3A 4MQFA 2HL6A 2FR8A 4L0DA 1U11A 1RCFA 3HCFA 1JT9A 3W5VA 4C3VA 1XEAA 2BFAA 2J3EA 2QW1A 2VP0A 1SCBA 2C00A 2WUDA 4KPGA 5JLAA 4IILA 4QOSA 5LIPA 2HMUA 5TSDA 3RUPA 3WLLA 2JBAA 4CQMD 3FDZB 4WGGA 1L1FA 3IP1A 3EVBA 4FU0A 4LHVA 3JQAB 2B83A 5CLIA 1MRSA 1XK7A 3COPA 1S1CA 2J7PA 1GDHA 5I9MA 1T2CA 1COWD 3QA9A 4URWR 1CF4A 1T26A 3OEWA 2PZJA 1AS0A 1GO2A 2JD2A 4GVXA 3KG2A 4MB6A 4LNUB 2QA5A 4TPKA 3UH1A 1VL1A 5H16A 1DBPA 5G1OA 3S7TA 1G4HA 1K68A 3K9GA 4Q7EA 2Q1TA 1Z6TA 3N74A 3D6VA 5EE0A 5EKUA 4WLNA 3VHLB 4U39A 4BFZA 5EA2A 5EC8A 2VF4X 4H6VA 1TQ6A 1VIAA 3MS7A 4XE5A 4DBZA 2VRCD 3NHMA 4G8BA 3LXRA 4PSCA 4PYMA 4XB6B 3V4VB 1GM5A 4CHTA 5CM2Z 1DKRA 4U7TB 1XBTA 1E2IA 4QYXA 3EW9A 4NWIA 4XD7D 1P6UA 4Q5IA 1AZSC 2ZS9A 4A92A 4BMYA 2OUKA 2D1RA 1KZ9A 1LDEA 2X8BA 4H0FA 4YAGA 1HL3A 4OYLA 4Q1VA 1TTTA 3C1NA 1LF0A 2QW0X 1DVRA 1J24A 1Y7TA 1KYXA 1OAKA 3IJPA 1G5IA 3BA6A 5HE9A 1II8A 1X7YA 1Q1QA 2ZSBA 2NPFA 1O89A 1CUAA 2O8FA 1T5DX 1MLDA 7ADHA 4M98A 2C8LA 4L9AA 2PZAA 1VPLA 2YJZA 3W04A 1KYVA 2KMLA 4Q9NA 1E6WA 1XNQB 1ECJA 2XR1A 1KJWA 3P2KA 1DAGA 2WUGA 3ILHA 3BMQA 5D51S 3A6HA 3NBYC 4QNNA 2B9VA 1WXXA 2W2TA 4HLUA 1BQ3A 4R5MA 4KGVA 4AWBA 2VZ8A 3PL5A 3N75A 5JMOA 1E2NA 1BIFA 2AG6A 1MOQA 4JP8A 4TLAA 4FGSA 4DB4A 1R8SA 2NO5A 2O59A 3FDZA 5CP8A 1O94A 1USIA 2BONA 4RVFA 4BDTA 1GTVA 2JEOA 1ZGAA 3JQAA 4D6YA 4KQ6A 4ZMRA 5CT8A 2BKXA 2DRIA 3IS3A 4QWWA 2MWMA 3VMFA 3N9IA 2XT9A 4BEVA 1I6KA 1XVVA 4Y1RB 2VF7A 1MOPA 1Z2PX 2WBLC 1JIXA 3QPCA 2F3UA 2OO3A 3FKSA 4LNUA 4MTLA 1KAHA 1ZD2P 2FG6C 3LCMA 3VPSA 3OPNA 2XUZA 1NATA 1ZMTA 3ZCSA 5ALNA 5JI3E 4I0WB 1R4AA 1Q57A 1KVRA 2PWZA 3GX1A 3NIFB 2QD4A 4BKRA 1RAIA 5ALMA 2ZG6A 3AHGA 3CRRA 3TD9A 3U4CA 4GRAA 3WFJA 4BS9A 1HNNA 1QSGA 3FNHA 4C6HA 5JO0A 1W2GA 2YWGA 4QT0A 3ZLVA 3H2ZA 2Q3LA 1QIFA 2BKLA 2FF7A 2YHSA 4HDNB 5JZOA 2HR1A 1CRZA 1EVEA 1SU4A 4K5QA 1A98A 3SCZA 3SIXA 3UFXA 4CM7A 2PTGA 3KALA 4WLVA 1QQBA 2N0SA 1Z62A 3LVRE 1QGUB 1M10A 3OIWA 4OQPA 3BWYA 3C6YA 3USES 1SAYA 3B60A 4D5GA 5T57A 3V8BA 2ASEA 5DMXA 1LBHA 3WIEA 2J4CA 1NVBA 4ADSG 4F97A 2O8VA 4QODA 2DR0A 3WYGA 1L4NA 4UCXA 2PCJA 1MX1A 4YRZA 1LRJA 5I8PA 3SM9A 3GFBA 1L6IA 4G1VA 1SXJD 2Q3EA 1GT6A 5TR9A 3V2GA 4BO8A 2C5AA 5KNBA 1QDUA 3CN9A 4LNAA 4RVUA 2FMXA 1FDSA 1DQYA 2WJPA 3F3YA 3L7MA 1GIAA 3QP9A 4HB3A 4L3VA 3EVTA 4I8DA 3WLPA 3WWDA 2IY8A 4I36A 5TMDA 3IA7A 1Z8HA 1SN7A 2ZYTX 3WKAA 3H83A 4AZSA 3IJEB 4EECA 1V8DA 1CY1A 1RQ7A 5K0BA 4N01A 3ISVA 2VPPA 3CRVA 2GKSA 1P5FA 3D2LA 2OCGA 3EWSA 3GPDG 2PV0A 1D6MA 1Q20A 3N8DA 2GEVA 4MYRA 3N8IA 5DTJA 1DFHA 1LKZA 2YYZA 3OZAA 1YUBA 1HFEL 5FWNA 1IUPA 1QVRA 4MVJF 4EKDA 1KNXA 3PQDA 3ASVA 5I8ZA 2ARKA 1DEKA 1F0NA 4YNBA 3ZK7A 5F77A 3ZYZA 1ZNZA 3KDAA 4F8EA 4OYYA 4G0ZA 1J20A 1MQ9A 4KE9A 3MBKA 3CZPA 3X1MA 2JHAA 4B4DA 4CLHA 1T2NA 2EJTA 2Q4OA 3TDNA 2I3BA 4MV0A 3IUNA 1Y5IA 3INYA 3G0IA 1Y3CE 3M81A 5CBPA 3K70C 3FPJA 3OFJA 3AERB 1JG4A 4UHCA 4XA8A 4YR7A 4PFJA 3RUEA 1PWXA 4EHBA 4QPPA 4CTNA 1U7DA 2QRMA 4RTMA 1YBMA 4HDNA 4H7FA 1RHQA 2QRVB 3VKFA 2EX0A 2B8EA 4H0CA 1QCZA 4TQAA 1J8DA 1S2MA 1PIWA 3HPQA 1ZI9A 2XMPA 1NXWA 3LX4A 1IQ0A 3NXSA 2YWBA 1QGUA 4JJ8A 2JFFA 4OXIA 4WFQA 2BCEA 3T7CA 4DC1A 4C0HA 3Q1KA 3UXYA 2JDID 3PWTA 1HURA 1OA1A 5JRJA 3EIWA 1FB5A 4K05A 1QHYA 4XQCA 4RX1A 4KPFC 4PZCA 4QQRA 1SQ0A 1E7MA 2QSYA 2F1HA 4FFPA 9LDBA 3GOQA 4MWEA 3T7AA 5T3YA 3UGKA 4D9GA 5B3AA 3LDGA 2Y67A 3HWWA 1A3CA 1JQLB 4L5JA 2CKMA 3ADDA 1GPBA 1SZCA 4GOMD 5LQNA 4NZPA 1PYDA 2OBMA 5K51A 5FA8A 4Z6KA 4QULA 4PC1A 3RODA 1G8PA 3G2JA 1Z5VA 5TGZA 2Q27A 3OI7A 2CCGA 5SY4A 1A1SA 4NU6A 3VPHA 4MAFA 3AFOA 2NV2B 3EFOB 3DAPA 4OI0A 1NJGA 1PEYA 1GPH1 2CDBA 3KYDB 5BN4B 4CIAA 4DJTA 2CV0A 2GM9A 3WKCA 2IYFA 3IIMA 2TSYB 2B4AA 1NLMA 4GXRA 4O6VA 3LUHA 1JEEA 3WQBA 1YB7A 1GFWA 2XODA 4D9IA 3HY6A 3CCCA 4RY9A 2PUJA 3QFTA 1U4SA 5DHSA 3C3CA 5E9QA 5DTIA 5JNWA 1KZYC 1G0OA 1O9BA 5BYBA 5AJTA 3TG8A 1SXJE 3PSAA 2EBHX 3DOCA 1Y33E 2CJPA 1ZN8A 2ZUVA 5K1ZA 4FHEA 4BKOA 4P3OA 2WZCA 4XUGB 2A9RA 2QTZA 1NUSA 1PZHA 4UEQA 3AERA 1L5GB 2DQYA 5K20A 1P7YA 4XJTA 1S3GA 1X87A 1P91A 2AC2A 3CWCA 3N1UA 2BGMA 3PE6A 2QRVA 4GP7A 4OMFG 5DXAA 5T64A 2V7EA 5DWQA 3RVNA 4F8YA 2ONYA 2BFEA 2CBXA 2VK8A 3LZCA 4MKHA 4HHEA 5LZ4A 1BS9A 1G7RA 1S9HA 3AINA 5FKJA 3QKIA 3RIMA 3TW4A 2GXSA 2Q5QA 4MPDA 3LHIA 1HT1E 3KDSE 2VK4A 1M2JA 3CX3A 2R5NA 3ITNA 3X2EA 2REQB 1VHLA 3OEHD 1OXXK 2C9DA 2CXXA 3R3SA 1OHHD 3KWJA 2NWQA 4W1SA 2JLWA 1QMPA 1YL5A 1XVIA 3KXIA 5SY9A 4EVIA 3QFRA 3GPBA 3AUAA 3AM5A 2OYCA 2RE8A 4PNEA 3R5JA 4RU1A 1KGDA 2C2YA 1PK9A 1UJCA 1GU7A 3QLUA 1UP4A 4TZ6A 4UM5A 3ANYB 2DZDA 3N87A 3DP7A 4R16A 2I65A 5GJWC 5DT2A 4B33A 3MTEA 4QXMA 1LPBB 4RVHA 5MFZA 3VU0A 5AM1A 5JEEA 2HRDA 2VHJA 2AHRA 3L7OA 4XRRA 3SVZA 4AF6A 1YVPA 2ZRMA 3QE4A 4Y3UA 4YDQA 1PR9A 5A04A 4CQNA 3EFOA 3RBVA 4CVNA 4B2PA 4L9RA 1R6UA 5BN4A 3KYDA 3DKRA 2B1RA 5SZIA 2PSFA 3DMGA 1UPTA 1SVWA 1HDGO 1LWNA 1YRWA 2PVSA 1NUPA 1H69A 4M1EA 5DYGA 2FEXA 2HK9A 3LCJA 2R2GA 4KN8A 2JANA 4ZD6A 3EPLA 3H9UA 1HA3A 5G02A 4G0UA 1RM3A 2PZFA 3K1ZA 3RT7A 1NR5A 1OC2A 4HN4B 3C48A 1M8FA 2HY7A 5A05A 1G42A 1CJMA 1V1MB 1E5VA 3NYRA 3ECSA 4BLWA 1AM4D 1TUGA 3I9FA 1PYOA 1PBNA 1FSZA 3ACDA 2PBFA 4MVWA 4RQTA 4FN4A 4BZQA 3VA7A 3PEEA 2GN0A 2XDWA 1ZGBA 2I3AA 5ALOA 1N2HA 3ZZMA 2J4FA 3ADCA 2B92A 1SKMA 2D5LA 5A4DA 5EXSA 2YYAA 4B6RA 4KGZA 4L76A 1UJ6A 1Y8QB 4NYMR 1POWA 4URUR 2XTAA 1I0LA 5H82A 5H7XA 1CT9A 1KH2A 3WBBA 2P91A 2QS9A 2NXCA 4IRXA 4D9KA 2ZBUA 3O1IC 5CFNA 3C6QA 1GPNA 3IHLA 4AWAA 2REQA 4MS4A 4B9EA 2YS7A 3NXKA 4L7QA 3ZLTA 3ZQJA 1BXRB 1W0JA 4J3FA 3KOYA 2VDKB 1IUKA 1QYCA 4QARA 3ZX4A 5LL6P 3SK0A 3AB3A 4QGHA 4LRXA 2NTEA 3CH7A 1L4GA 4S0XA 5FULA 4YCSA 4KXVA 4UBNA 5TB5A 4URVR 4BC0A 2AZXA 1L1EA 1UT5A 1C9YA 1ZESA 3FROA 3FWYA 2IU0A 5JECA 3GVHA 1JDBC 1TC1A 3DVAB 4GE0A 3ZWCA 3EZ7A 3RTBA 4EPYA 2YH2A 4KQMA 2YY5A 3WDLA 4RZXA 3W7VA 4A15A 1RMTA 3PBKA 3BWEA 2PD3A 4YAEA 2XRZA 3B1FA 4XFJA 1JXMA 1EK2A 4II7A 4XCVA 3VGJA 1EXDA 1NV8A 1JHOA 5KAPA 5B4UA 4X92A 2P0AA 2JH8A 1YI1A 3I9V6 2B7LA 4B2LA 4DMKA 1CR1A 3JQ9C 5KTRA 1FJGB 1KDOA 4YGYA 1W0CA 3D5QA 3S99A 1MRZA 1VRCA 4M36A 2HSGA 1DAKA 2IZ0A 3MMXA 4G41A 4OXQA 5HRCA 4TL9A 2GNPA 2I6XA 2NZ2A 3JASB 1N25A 4ID9A 1DNPA 1H22A 3NP9A 3RRFA 1OLXA 1V1MA 5EZQA 3U3KA 3Q3EA 4B44A 2W2QA 3RVBA 1Z6GA 1N6LA 2FSSA 1ADCA 2XYVA 1USUA 3NUQA 3OBBA 4LNHA 3ZBQA 1H1LB 1KDPA 1VKNA 1YRYE 1U65A 4TS9A 1JEDA 1A8UA 1X74A 2NT3A 1OFUA 1LQTA 1RQGA 1XCPA 4YASA 1BO6A 1GU0A 1HEIA 2LDBA 4DLXA 3F73A 1W93A 4WEOA 4ETWA 2ZR9A 3GVIA 3S2UA 1QUEA 4TZ0A 1Y8QA 5HJ5A 4JU8A 5U9CA 3PRYA 1GPDG 4WDRA 8AT1A 4EPRA 4EL0A 4ZVSA 4GAEA 3BDAA 2HMFA 2RARA 1R00A 1QIDA 2XY4A 4KBGA 4US0R 3ZUGA 3NAQA 4A8TA 4BMZA 1A7AA 4P3KA 4CKCB 2R84A 3IMCA 4FZ3A 4P84A 3VU3A 3BHIA 1N2OA 1Y4DE 3E1GA 3NM4A 3O8NA 3Q9UA 3I45A 4WLUA 1IC6A 3VC3A 4E12A 2G76A 5AXCA 1D2CA 1RYYA 3KJIA 3V7WA 1R0KA 4XWKA 3K0SA 1RYZA 3TTSA 3RO7A 3ZDEA 4D4GA 2GNOA 3TWOA 1XGKA 2A14A 3I9LA 1F8YA 5JARA 5JSQA 1CY7A 1XJ0A 3AUYA 4H6WA 3RI3A 2DR2A 1JEYB 3DVAA 2FX3A 1OROA 3T0FA 1PGOA 5C8DA 1JJBA 1L7EA 3DKKA 1VKRA 2FUG6 5A0FA 3EGWA 2WWYA 3VU1A 3IAHA 3NHRA 1Z0UA 5EZSA 4CTMA 5AOCA 2GILA 2V58A 2FXIA 1LVHA 3AZQA 4K9OA 4FYXA 3U3RA 1PS9A 4Q47A 4DRZA 1E92A 3NRCA 4MJ3A 3RS7A 3U17A 2HIMA 4DNXA 3GNSA 1SC1A 3M7IA 1JQKA 3VI4B 1L7QA 5JVDF 4MQ5A 1CY0A 1OFIA 4D0LB 4AMUA 1LLDA 3P96A 2LIVA 4ZVVA 1W88A 3QPUA 1BFKA 3GLHB 4BEWA 3SN6A 5EIXA 4LZOA 2R86A 3GFPA 3WP0A 4YMLA 1C2TA 4L8WB 1T4CB 2YINC 5K8IA 1DTWB 1Y6QA 1TE2A 5CB4A 4MX8A 5ERXA 4L9SA 1NOJA 1H1LA 3UJ7A 3RTDA 3BTOA 1EP3B 3RAPR 1K7YA 1S2NA 4R51A 1JP7A 3F9CA 1M54A 3AETB 3IRVA 4GKKB 5I7EA 1W76A 4X8MA 3U0VA 4ZI3A 2PMKA 4LJ8A 4QOFA 4D45A 2ESRA 3E22B 1IM2A 1RTTA 1RWPA 1OF1A 2DQSA 4NG4A 4NU0A 4UQOA 3RSFA 4BZXA 3GYBA 3T5GA 4E07A 3UPTA 3ETDA 1QKJA 1DOAA 1TC2A 2AT1A 2D2FA 2WE8A 2ORYA 1G7SA 3BRCA 4EFNA 2HRZA 1JB9A 3C6MA 1P1BA 1YZTA 2UUOA 1AO0A 3MINA 3QMPA 1P7ZA 4MVCA 3RPEA 4NENB 4D0GA 1AKEA 3O3OB 2OT3B 3CE9A 2DX7A 1F2VA 4N7MA 5HUJA 4K9SA 4RCZA 1QLWA 3KBOA 3IT2A 5JSUA 1RADA 2JIDA 4BVBA 2X40A 3QOFA 4EK9A 3JQ8B 4M7OA 1JEYA 1FUIA 1P44A 4TYNA 2X58A 4MP6A 2HT6A 3OLZA 1S5PA 1KEVA 1E1YA 1GU1A 3MOSA 4TVOA 2XJ4A 3G9ZA 1CUWA 4W7IA 1IVYA 3R44A 5G2OA 5HF5A 4DCUA 5KJCA 2BFDB 3R5SA 4OATA 3WK7A 1V71A 3IDOA 2ETVA 4RMJA 1BHSA 4WOBA 1LB1B 2YQZA 2VSQA 1L5OA 4GPTA 1PE0A 1WRBA 4KC0A 4R2HA 4Z9BA 1MTZA 1UFKA 1T9GS 2Q4TA 3RTGA 4FW9A 1DEHA 1RWOA 1RQRA 2QUKA 4X8HA 3TCXB 2OM6A 3QVVA 3WKEA 1ZUD1 3GLHA 2RH8A 1NKVA 3AF5A 1QK5A 4W7HA 3ZHYA 1DB3A 4NXNB 4CEIA 1T4CA 4L75A 1DTWA 3WJ7A 1ACMA 1DPGA 1ANKA 2GRUA 2WWVD 1U8UA 2GT1A 2R1VB 1WX1A 3GZTB 3HTXA 3ZKWB 1UFOA 2GARA 3ZCXA 3AETA 2B37A 1QZUA 4TX1A 4A4DA 4KOEC 4NCKA 5HS4A 1YULA 3K3PA 3LNTA 1HTWA 5DYIA 3E22A 4AC9A 4ACBA 2JI7A 1TZ2A 2ATCA 4NJEB 1Y82A 3H1BA 3PD7A 3IKLA 3HM9A 3A1CA 1E0KA 1QO0D 3PFFA 1U04A 3G2KA 2QLLA 1UBTS 1QIIA 1L4FA 2Z3VA 4G63A 3WNBA 1DT5A 4RTOA 4IF4A 1JAIA 3IDZA 4X41A 4NENA 1OKKD 3JQDA 3AEYA 3TQQA 4CFSA 2XCIA 4NBKA 4WK2B 4MUNA 4MA0A 1ENYA 3VNRA 2GK7A 2WF5A 4OLFA 2ZVJA 1L8LA 5LVAA 2JBWA 1X1CA 2HCRA 2E85A 3DDCA 3JQ8A 3V1UA 3C6XA 5BSMA 4DBVO 1QOZA 5KQSA 1N9KA 3ZDZB 4JI2B 4TZTA 3EODA 3U81A 5LYJB 4OXXA 4C05A 4D6PA 3G5MA 5CDFE 1Q50A 5IX8A 1RWNA 1E1MA 1Y4AE 2BFDA 3HCWA 2X42A 2XMRA 3PYXA 4II3A 1ZUIA 3BEOA 4BNHA 3VX4A 2EW1A 5GONB 2H1CA 4ID3A 4IHAA 3OECA 3IE2A 4S2EA 3PLNA 5ER9A 3FOEC 2EU8A 5F1OA 1CUEA 1DXOA 5KSWB 4DJEC 4CT4B 4OD0A 4D6XA 5L4SA 1MN6A 3HYSA 1HOXA 4HVLA 1EK6A 5ICCA 1EP2B 3GRRA 3CR7A 1M6NA 3DEZA 3HJNA 3KFLA 2AVDA 2XVMA 1THMA 3M6UA 4G8JA 4EY4A 3NVKI 4PFQA 4AK9A 1RCTE 2YMLA 1E0AA 4LAFA 1G2OA 2DHDA 1VJ0A 4QBFA 4BNDB 5BMVF 4DLBA 4NX2A 4HDKB 2R1VA 4LVNA 3I9JA 3X1JA 5C5CA 3TI7A 2P2YA 1Z5GA 4ME6A 1XKXA 1BU5A 3IPAA 2FJ0A 4I46A 5ADWA 4Q6BA 5HJ7A 3C7KA 3IC5A 5ESDA 4YRPA 4URXR 3KEGA 5JSZB 5JTTA 5FUYA 2ZWOA 1V16B 2GETA 4HSEA 4NJEA 5ALLA 2MINB 4ZCMA 3FBWA 1RKXA 2HM7A 2PX0A 2X2EA 4PW0A 2J3QA 3CLKA 5ED0A 4B6SA 1HDRA 4CR6A 1TMYA 1SKUA 4P38A 4XQ0A 3PB3A 4MUIA 3T4EA 1XPOA 3FFBA 5B55A 4UUNA 1JWBB 1TDJA 2G67A 4BCBA 3LVQE 1P7VA 3QEKA 3VPBA 3SYMA 5E9JA 4MLDA 2CUZA 4GXNA 4WKNA 1FTYA 2X5KO 4NECA 1WNTA 1OBCA 3E5RA 5C81A 3G3EA 4MWCA 2Z5LA 5IZCA 5HM8A 2JAXA 3OUUA 4W8HA 2I54A 4OHCA 4DFDA 1W96A 5HBGA 1YDEA 5BSHA 1NW7A 2CXTA 1DINA 1F48A 4CN9A 3PSHA 1EDZA 1BE8A 3N0WA 1Z29A 1VCMA 4WECA 5LYJA 3TXAA 3WICA 2W48A 4D8TA 1Q1ZA 1NU8A 1NM5A 2BI7A 3GW8A 4N6OA 2REOA 4ND3A 4NRDA 1GSOA 3D0OA 4QUHA 4R98A 5DHFA 5JDIA 4WFKA 1EKXA 2QU7A 2QY9A 3C4JA 4QGBA 4WK4B 3CLRD 1WTCA 5BPFA 1D5WA 2NG1A 1HLGA 3JU3A 4MA4A 4XYBA 3H0EA 2Q07A 2CHVA 1NI4A 1JVBA 1R50A 2ID4A 2LRHA 2VJBA 3Q4GA 2WM9B 1QX3A 2Z8XA 3QVLA 3QWAA 5BOVA 4LBVA 3V4ZA 1KQGA 4C2TA 1I2CA 2NO0A 3D5TA 3SX2A 2QVXX 3ZW8A 2G9RA 1Y3BE 5E1MA 1UOQA 2ZI4A 4KNWA 2Q99A 2WJWA 2QEQA 1B4DA 3SEFA 2OBYA 4R9SA 4HDKA 1EK0A 2X1VA 3FTCA 2AJTA 1Q7BA 2OLKA 3LZ6A 1Z2OX 1UEXC 1V4VA 3AEQB 3WLTA 2VSXA 1EK1A 3DEIA 4RSHA 4YJ3F 1DO8A 1FMCA 2XZDA 3AJAA 3G2HA 2EZTA 2CBZA 1KFKB 5F76A 4K87A 1C1DB 4NBLA 1Z25A 1ETHA 2IBMA 1J0AA 3SXPA 4DQKA 4YTEA 4TVKA 5B5SA 1V16A 3D6MA 1E2DA 2OBFA 4GU5A 1YR7A 2MINA 2C4UA 5LQCA 3MHTA 4HVAA 2LBPA 1A8PA 3L6DA 1YCGA 2QMEA 2QLJA 3MPUA 4UATA 3UENA 3BDIA 4JLNA 5EJGA 3M3HA 1KHHA 4S1OA 2VJMB 1NXOA 4M1OA 5BVGB 3VNUA 3IBYA 1TK3A 2F3QA 3OCJA 2OORA 1RC1A 3IQFA 2IYSA 3K0BA 2V7QA 3NV7A 4F92B 2IS4A 5F2EA 3T54A 2WIGA 4D97A 3BXEA 3GJ8A 4HLQB 1YL6A 4CG3A 4XWOA 2QX7A 2Q3MA 5TMEA 1CZRA 3AJRA 3H2IA 1RXVA 3ZS8A 1NVXQ 3EZGA 5ILOA 4S1VA 1ETUA 1KTVA 5IM4A 2C94A 1G8AA 3PC6A 2Z9CA 3SYLA 3ZDBA 1T0BA 2XIQA 1NR1A 1OIXA 4FSDA 2ZJ6A 4RKQA 2P5SA 1UMDB 3STVA 4CMEC 2OV8A 3A6FA 3CT4A 5AM5A 3CH5A 5BRJA 2CFCA 1Y6FA 4P35A 4AMGA 1MC1A 2QB5A 3DAYA 1C81A 4GSYA 1FFHA 1RRFA 2JFNA 2AMVA 1DS6A 1QGED 1OGYA 4QEZA 3G5LA 5AI8A 1QG4A 1J7JA 2QRNA 3W8FA 1DZ3A 2P9TA