4KR7A

Crystal structure of a 4-thiouridine synthetase - rna complex with bound atp
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
386
structure length
386
Chain Sequence
b'ELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA sulfurtransferase
molecule tags Transferase/rna
source organism Thermotoga maritima
publication title Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
pubmed doi rcsb
total genus 119
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.8.1.4: tRNA uracil 4-sulfurtransferase.
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02568 ThiI Thiamine biosynthesis protein (ThiI)
A PF02926 THUMP THUMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 4kr7A01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kr7A02
3IMCA 3PNBA 1FYDA 2AZXA 3CVXA 1T9GR 3Q10A 2DR2A 1P7PA 1VLHA 4G5FA 4JZYA 1NYLA 1T9GS 2GOYA 2CFOA 3HL4A 1I6LA 1O6BA 1LW7A 2J09A 1BS2A 1VL2A 2A7XA 1NUQA 1I6MA 1KKUA 1MB2A 4CDNA 3Q4GA 2O8VA 1N77A 3ZJUA 2Z08A 4DDKA 2CYBA 4EGAA 3LOQA 1M8PA 1KAMA 4MVXA 3KT0A 1QRTA 3P52A 3FG9A 4MUIA 2A4MA 1GLNA 4MW4A 5DK4A 1YUMA 3RBAA 1TYDE 1T6YA 1GAXA 1F9AA 2EL7A 3UOWA 3AFHA 2XRYA 3X1JA 2QJTA 1S4MA 3IVXA 1O97D 2PFSA 2QJOA 3CLSD 3CLUD 3G5AA 1TEZA 3CLTC 5KHAA 5JBNA 3F3MA 2AG6A 1N2GA 5J58A 3GMIA 1F4LA 4KKVA 1XNGA 1WXHA 1IQUA 4MW1A 2GM3A 4MVCA 1VBNA 3GUZA 3RHSA 3VGJA 2DLCX 4KR9A 2I1LA 4EG1A 2DEUA 1KP2A 1EFPB 4ZCRA 5DB4A 2IJGX 2QTNA 4CT0A 3AL0C 3COZA 3PRHA 4HPWA 1EUYA 3FWKA 3AKZA 1T6ZA 4MW9A 4OUDA 1JIJA 4KR7A 3DV2A 1JEDA 1IRXA 1U7XA 2NZ2A 2X1LA 3IDFA 1MOPA 3M5WA 3IOBA 2G36A 2EJCA 1YIAA 4ZT3A 3IVCA 4XFJA 1OD6A 4PBRA 3SZGA 1WJGA 1WXGA 3ELBA 1NUPA 3L92A 4NAHA 3KT8A 4CQNA 4I6EA 1DNPA 3COYA 1OWPA 4R2MA 1JEEA 1YULA 1LI7A 2A88A 2CT8A 4H3SA 4MULA 3QE4A 3SZ3A 1KQPA 1N2IA 4ZCPA 4K0RA 4MUKA 1D2RA 4PBTA 4ND7A 4DDHA 1K4MA 1WXFA 2J08A 1O94D 1TQ8A 3Q12A 4L2IA 1IH8A 4MVWA 4ZT5A 2CYCA 1PFVA 2A86A 4ZCTA 1YI8A 2H29A 3N2YA 4X0EA 1KORA 3SEZA 4GRIA 1U7DA 4PBSA 1ZH0A 5EKDA 1PFYA 3TQIA 1NZJA 1J1UA 1U3CA 4YBRA 4EG7A 1LI5A 1N2BA 3K9WA 4MLPA 1KP3A 3N9IA 1I2DA 5KWVA 5DASA 1MC1A 2VXOA 4MUFA 5F23A 3VRHA 2Z3VA 3TMAA 3AG5A 4MUHA 3CVVA 3ZIUA 3KT3A 1ILEA 3CA8A 2E0IA 1I6KA 5J59A 3KFLA 3FOCA 4PY2A 5AHWA 1JGTA 4DDMA 4MW2A 1OWNA 4KPUA 3FNRA 1IHOA 1KH3A 1JECA 4EFKA 1WZ2A 3TM4A 3FIUA 2HZ7A 1HYBA 4TS1A 1WKBA 1JILA 1X6VA 3H05A 1MB9A 3ZUGA 4EF6A 3TS1A 3NBKA 1OBCA 3A4IA 1KR2A 3AIIA 4DJAA 1VBKA 4ZT7A 1A8HA 1N1DA 1V8FA 1IQ0A 1U0BB 1Q77A 5IHXA 2QUIA 3CLRD 1K92A 2RD2A 4QBTA 3FDXA 1Q19A 3PNYA 2J07A 5BNZA 2YXNA 3TNJA 1PG2A 2J4DA 2CYAA 2YWBA 1B6TA 5HUJA 1OWOA 4MW0A 2DERA 1TFUA 2X3FA 3ZJTA 2JA2A 3LDGA 3FH0A 2QTMA 1IVSA 2PG3A 3P0JA 2H2AA 4MUGA 1TYAE 4WNYA 5TEWA 4MUJA 1ZJWA 1OWMA 1J20A 1V47A 2CV0A 3N05A 1MJHA 1NI5A 3V8VA 4Q16A 4MWEA 4ZT4A 1N2HA 2J5BA 2JANA 1KAQA 4NATA 2YWCA 5FO1A 2HGZA 2VTBA 1G8HA 3IOCA 1EE1A 1H3EA 1TYBE 2E21A 3SYTA 5HG0A 3UC5A 2WQ7A 2A84A 1O0BA 3HZRA 2D13A 2QUHA 3MLBA 3RK1A 2B7LA 3CVYA 4ND6A 3D6VA 3G59A 2HMAA 1H3NA 1R6UA 2Z09A 3ZJVA 3CLRC 5LFAA 4EG4A 1Q15A 3SP1A 4CDMA 3FHJA 3TQOA 1TYCA 2A1UB 4KR6A 1PG0A 3P0IA 2XRZA 5TS2A 4AQ7A 1O94C 4P2BA 3IUEA 4MW6A 2A1UA 3DLAA 4MQ6A 3S3TA 1M8FA 3IMGA 4R0NA 4YP7A 1H1TA 4ARIA 2OV4A 4EG6A 4ZT2A 2IP1A 3G6KA 1OBHA 4MAFA 3UMVA 4G6ZA 3RK0A 3BL5A 1FFYA 4YP5A 3H97A 3IODA 2ZUEA 1Q11A 1QU3A 3ISJA 3LDUA 4J75A 1JIKA 3CLUC 2DPLA 1RQGA 3CVUA 4JXZA 1J21A 1IQRA 5J5AA 3D6UA 1WXIA 4U63A 1KQNA 4OJMX 4U7JA 4OUDB 2PXHA 4YP6A 1O95D 1O96B 1XNJA 1JMVA 4FZJA 3DPIA 3OTWA 4XSVA 3HFJA 1JIIA 1O5TA 2PZ8A 2O5RA 2DXIA 4ZCSA 1MAWA 3VU8A 3ZXSA 3GLVA 4MWDA 2CSXA 2WSIA 2QJFA 3IVGA 1T6XA 1N2JA 3AG6A 3QTBA 4WSOA 1NUTA 5H16A 1NUUA 2DUMA 2RE8A 3LCJA 2GKSA 4MWCA 1QTQA 1QJCA 4K03A 3X1MA 1EUQA 3IMEA 1M8KA 4R2LA 3ND5A 1GN8A 1WQ4A 4RPIA 3I05A 3UK2A 3DO8A 1J1ZA 4S1OA 3H99A 2D54A 4Q93A 3C8ZA 1G8GA 4ZCQA 2CV2A 1COZA 3X1KA 2A1TR 4HJRA 5FO0A 1MRZA 3LE8A 2C5SA 4F4HA 1GTRA 1YUNA 1GZUA 3MMXA 2E18A 1UFVA 3V97A 4NAUA 2QUKA 1O0CA 1KH1A 2OQ2A 4JXXA 3CVWA 1QRSA 4ZT6A 1M8JA 2R5WA 5FNZA 4HK4A 4F3RA 2BYTA 4AS1A 2AKEA 3IH5A 1KQOA 1XJQA 4L2IB 4NDAA 3TZEA 1QQTA 4RUKA 1MAUA 3TM5A 3HMQA 3QTTA 5TGTA 1K97A 2ZP1A 4HJXA 1NSYA 3MLAA 3COVA 1M8GA 3A04A 3K0BA 3CLTD 2X1MA 3H9BA 4MWBA 4I6GA 1O97C 2QUJA 4KPUB 3K32A 3NBAA 1O95C 5K0TA 2VTBB 5H7XA 4YMIA 2WB2A 1N75A 4MW7A 3ZXIA 3JXEA 2DETA 4NX2A 3RJZA 1IFXA 2IELA 1F7VA 1QNFA 3MXTA 3NV7A 1WY5A 1EXDA 1Y42X 1ZH6A 4MVYA 3TLJA 2E89A 1EFPA 1X8XA 1NURA 3A05A 4GU5A 4QREA 4BWVA 2TS1A 3ND7A 4NZPA 1KH2A 3E27A 2BTEA 3PXUA 4MUNA 5DEOA 1R6TA 3SEQA 3FY4A 3RFFA 3P0HA 3H9CA 1EJ2A 1J09A 3U1VA 2JAXA 4DLPA 4G5YA 4DE5A 1R6XA 1N3LA 3CLSC 4EG8A 1WXEA 1ZUNA 3OP1A 1GPMA 2PIDA 3CR8A 3HV0A 1U3DA 1SURA 1YIDA 1H3FA 1ULHA 1WOYA 3ILVA 3SDBA 2QTRA 2CV1A 3HGMA 3UY4A 3INNA 4MUEA 4I6JA 4EG3A 1M83A 1JHDA 2A1TS 2YY5A 5HUHA 4U8HA 1J70A 1G8FA 4A91A 1MBZA 4DNXA 1JZQA 1NP7A 3PNVA 1N78A 3IUBA 1N2OA 1CT9A 4QRDA 4E1AA 5IJXA 4EG5A 1EFVA 1NUSA 3KT6A 3FI0A 5TEVA 3ZGZA 3A2KA 2PZBA 1JZSA 1WQ3A 4J76A 2NSYA 4JYZA 1OWLA 3IOEA 1EFVB 3L93A 4JFAA 2X0KA 1F7UA 2D5BA 4UZEA 2V0CA 1QU2A 1N2EA 5KCMA 4XFDA 5LLTA 2V0GA 1PFWA 1GTSA 1G59A 1K4KA 3TZLA 1VBMA 4ARCA 1XNHA 3ND6A 4UZFA 5K0SA 2WQ6A 5LM3A 1M1ZA 1QRUA 3FETA 3MUEA 2ZUFA 4MW5A 3COWA 2PZAA 2CUZA 1PFUA 1O96A 3N8HA
chains in the Genus database with same CATH superfamily
5FWYA 1WD5A 1NJFA 4UQLA 2VQEB 2V3CC 4CKEA 5E1BA 2HMFA 4YONB 5D6OA 4IIUA 1RTKA 3HGTA 3N8IA 2VQ3A 3R3VA 1EZ1A 2RBKA 4BNMA 5C8XA 2H57A 3LDAA 4OI4A 1CTQA 4CW7A 3QA3E 5AUQA 4GVXA 1QONA 1JQAA 1OFUA 2CFOA 2AFHE 2J46A 2WF6A 1I6LA 3QELB 5BUSA 3SICE 3BWEA 3EDQA 3ID6C 4RQTA 3F1LA 1GRVA 4OXNA 3AY3A 1PUJA 3ILXA 5KVQA 5J4HA 3H65A 3Q2KA 4OI1A 3VKWA 3ANLA 3AR9A 3PTZA 1MAHA 3AVQA 2WD7B 1P2TA 4I1OA 5CRIA 3C98A 1CQZA 3WL4A 1U3GA 5IEBA 1BGXT 4Z0PA 1F5NA 2R65A 1IIRA 1TI7A 3ZE1B 2OGUA 4DDKA 3QVXA 3NCTA 4TQAA 3HJTA 2FZGA 3LOUA 4RLQA 1J0EA 5BVHB 1V1MA 4MVXA 2HUPA 4ZWNA 2Q4BA 1TC1A 2Z1DA 3U4MA 1Y4DE 1WZEA 1FFDA 1GDTA 1EI9A 1JHPA 2CXTA 3FG9A 1J2YA 3D2CA 3FOWA 2F8TA 4IIHA 2RIPA 4KYIB 2B35A 2X41A 4F6CA 3RBAA 2HF9A 4P5PA 3FXAA 4Q4AA 1V8PA 2O3JA 5FUVA 3O8BA 3HDVA 3ACCA 4E12A 4UOZA 3I6BA 4CM3A 2QBYA 1F9AA 1PTKA 4X62B 1YU9A 1YE3A 4QLBA 5B64A 2DKOA 4LZAA 1NNI1 4B17A 1YXMA 4IIJB 4IWNA 1GPKA 2HOQA 4FU0A 2YW2A 3UF0A 4BASA 3QV2A 5JARA 3AFIA 1XVUA 1SD2A 4RETA 3ESYA 1U1IA 1U9YA 4AJ2A 2JH8A 1NVEA 1UPXA 1ND5A 3CF2A 5JSHA 3FVQA 1LTKA 4XJSA 4G8JA 4OEHA 2EERA 2FDRA 1ZD8A 2BV3A 4YRKA 4MW1A 5DXFA 5KSYA 3MLEA 5IARA 2EQBA 2ZYSA 4LYYA 1JHYA 5HCIA 1D2GA 1U31A 3ZY2A 1T1JA 1WUJS 4IR7A 1CQPA 5CYFA 2ZIZA 2DEUA 1KY3A 1C3EA 5K4GA 3S81A 4YRRA 2MSNA 4HH3C 3D54D 1LEHA 2BR5A 2VAPA 1FLNA 1PZXA 1XP5A 2AW3A 2WMYA 3MM4A 2IJGX 2DMRA 3NP7A 4QVGA 4I1IA 2IH2A 2AK3A 1X7WA 3FMOB 3RUCA 4RHXA 1CUHA 3PG5A 4Q15A 1OHHD 3T34A 5KTPA 1MTOA 5FOUA 4P34A 2QI9F 3ADOA 4OUDA 3CHYA 4BV3A 2SECE 1EFAA 5CGZA 1DAOA 2Z4SA 1ZVPA 2PZLA 4PCUA 4UNQA 4DQ0A 2C92A 1Y3IA 1E92A 2C1ZA 4TV8B 2HNAA 4IW3B 1MOPA 1ZMXA 1FRQA 1QKIA 3PXXA 4INAA 4PYLA 3ZX5A 4DA6A 2G36A 4BUCA 4R1TA 1JAZA 1NL3A 3FN4A 1GLVA 4C0WA 4UD2A 3SZGA 3RF6A 1WKVA 3ZHRA 1ODFA 3P1JA 4OBWA 3GRPA 2O2SA 1MV5A 4LVNA 5EMJA 3REFA 4L76A 1MPTA 3UHJA 1T5BA 2DWOA 2WNIA 1Q1NA 2JI9A 3IP5A 1G1MA 1KI7A 4LYJA 4ALJA 2CXUA 2XYQA 4UNNA 1J9EA 5CW2A 2ZJFA 1QMGA 2C2GA 4UJ5A 3EVZA 1AMUA 5T5QA 4KZPA 2XE7A 3FKJA 4WLOA 2DFVA 5L3QA 5IZCC 3MN1A 3TX2A 3T5AA 3TG8A 4YDQA 2ORED 4RCYA 3ZV5A 3ZVLA 1UKYA 5DYNA 4F1WA 4ENWA 4Z53A 3CY6A 4MUYA 1GGFA 4B3GA 1X1RA 1TQ8A 1KYZA 2FPIB 3WBKA 4F5WA 1DC3A 3KJZA 2PMDA 1VG8A 3Q12A 1IH8A 5EXTA 5C3UA 4G89A 1WEHA 4LHZA 3U4AA 1SB9A 3HEAA 4BTLA 5C31A 1A1VA 3ICVA 1QJ4A 5IMSA 5PNTA 4DILA 2IHNA 2GRJA 1SG0A 2BR4A 3CLKA 4PBSA 5E6UA 4LCEA 4BMVA 4DW8A 2ROQA 1NLFA 4X66B 4WA8A 4NYIR 1CUBA 1B3BA 1MT3A 4ZOCA 3OY2A 5K0NA 3V7UA 1KJ8A 5HBGA 1K8ZB 1Z36A 3DOCA 1I2CA 1T0IA 1W0KD 2EZ8A 2FOLA 2X14A 3T7JA 1I3LA 4XCVA 3H5AA 3AUXA 3KLNA 4AJ1A 4C4ZA 3N9IA 2DLDA 3WLQA 1B76A 5ECGC 2XKKA 4U3JB 3J81A 4DLKA 2WOOA 4COKA 5C81A 4BLTA 3E2PA 5CB4A 1ULBA 3C3DA 4WBNA 3KT3A 2PIAA 1QYIA 2R6GA 3AY7A 3WMXA 2R8XA 2XA1A 4BRWA 3FCSB 3FOCA 4FN5A 4KACA 2IUEA 2VZLA 3KOXA 4ISCA 3RRJA 3D6JA 1OMOA 2WWTA 5BQPA 2NP7A 5BR7A 1H0SA 4RD0A 1DWUA 1RLOA 2B2CA 2GYVA 2Q3JA 5DJ5A 4B46A 1XRLA 3A1CA 3Q5GA 1HFKA 3SHOA 2ADFA 1E3DA 1HYBA 3A6DA 2OO3A 3O82A 1P2GA 3N74A 5E95A 3SN6A 4JL6A 5CJPA 3ZUGA 3EQ7A 5CA1F 2RAPA 1OBCA 1SZJG 1V37A 1VYUA 1P33A 3UICA 3N2KA 4HWSA 2A0XA 2F43A 2UKDA 4DJAA 3V80A 5HKAA 3REQA 3WAGA 2ILTA 4TTAA 2QMHA 4MYRA 2QW1A 4WL0A 1YCFA 3UKDA 2CXRA 3PPIA 4RVOA 2WPDD 5KJEA 1Q77A 5KC8A 3PT9A 3NW9A 3HRIA 3AW8A 3BXHA 1K92A 4HWTA 5FYDA 4DKJA 2FU5C 4HGOA 4HWRA 4BO9A 5A6VA 4AZ0A 2XXAA 5AH0A 3VPSA 1UH5A 5AKGA 1EM8B 1ZAKA 4ABYA 3TNJA 1R27A 4PPFA 2PT7A 3EOAI 5LR6A 4LHEA 2QUZA 4O3FA 3CUSA 2XXJA 3P0RA 2OZPA 1RBYA 4UMVA 4DPLA 1AHPA 1VLZA 4KQ9A 2DQZA 3A3OA 3CKLA 1NDUA 3FLMA 3UJAA 4I1UA 5JZMA 2H9AA 3U5TA 1MKYA 5FH9A 4OK5A 2IDKA 1MEOA 2WYWA 3HKCA 5IAOA 1G3UA 2ZBEA 4L5IA 4MNTA 1HR0B 3P2KA 2EWVA 5T4EA 3PXEA 3BKXA 3TRIA 3VXKA 1Z56C 1OU4A 2QR5A 3KSDO 5A5DA 2GETA 1MJHA 2EJVA 3LNCA 1NI5A 3Q7RA 1UKEA 4MWEA 2QMQA 3PLRA 4IUBS 4YRNA 5KNDH 3IHTA 2HLHA 5TARA 1J90A 3AHDA 3MIZA 4ZZ3A 3I8XA 2ZRHA 5JCOA 1VZ2A 1JN0A 4A8JC 4DC1A 1AQJA 1M2NA 5FOWA 3G0GA 3FF4A 3C8HA 1C0KA 4B31A 2GJ8A 3E18A 3ZLBA 4LHYA 3GCZA 4EMBA 4WCDA 5LIPA 5FHRA 3T3MB 1JR6A 1GFWA 5DHFA 2Q8PA 2I4RA 5HK8A 5BVGA 2E4YA 2AIRA 3PITA 2MMCA 1C9NA 1GPYA 2JA1A 2W6OA 5IDVA 1J49A 1MVLA 2YVUA 1BCRB 4F9FA 4EG4A 1IOLA 1YBAA 4R2WA 1DQSA 1SPXA 2R4UA 1KYTA 4JGIA 4RVGA 3SP1A 5ERYA 2XZOA 3HK2A 4LOHA 1CUZA 2JVIA 3PQ8A 3VR4H 4O4HB 1HFJA 1SG9A 1RADA 2FMFA 1LFAA 2IF2A 3I0MA 3OKFA 5GMOA 4KR6A 1ECLA 4BMPB 4FNGA 4C01A 4HG2A 5HF8A 4KLAA 4PZZA 4L8VA 2OV2A 2I6QA 3B53X 4IX9A 1NU8A 2Q4OA 3N0RA 4TLAA 5LL6P 2HWXA 1UXIA 3FCCA 4K7JA 1PR9A 4WVLA 1TRHA 2EGUA 4DXHA 2G82A 3J80A 1Q0PA 2ZRAA 3G7NA 5ALRA 3G8DA 3EG5A 2Z6QA 4AWBA 1ETUA 2V74B 1SXHA 2YUIA 3BGWA 4FFBA 4Z1MA 3VHLB 1IPFA 1N1MA 5CW1A 5DI3B 4DLWA 3RK0A 3HJFA 1DBIA 3GW8A 3DVRX 3RFTA 1L5FA 3EEBA 4N8DA 3SLGA 4BEVA 2OBFA 3I5XA 1PSDA 1HLGA 3AB7A 2JGKA 3BULA 5DYYA 4CV3A 1TJ4A 3WKEA 5DO9A 4YRLA 1OPRA 2ZSIA 4PRYA 4OLFA 4WFJA 3VOSA 1DT3A 1VI6A 1TJ3A 1N4AA 4BVLA 4YJGA 3UW3A 4AS3A 4E70A 2Y77A 5FUXA 3UUFA 5F7ZA 2ZBFA 4XDZA 3GYBA 2O0HA 2WB4A 3E2MA 4IS2A 5BN5A 4P7GA 1UBCA 2XQVA 5EZQA 3LT1A 5IJ0A 3G2QA 3UTDA 3MHTA 1T2EA 1Z62A 1SQ0A 4RBNA 4EL5A 4P7KA 4LXTA 3LZ6A 1GVHA 3PXBA 4R1MA 4RY0A 2WRZA 3MRXA 1ND6A 4BX0A 3K5WA 2O5CA 5HW0A 1TLLA 1LH0A 4WW0A 1NKTA 4Y6RA 2XQFA 1SXJC 4DNFA 1T5LA 1WVIA 1ZC4A 2JGJA 2UVQA 2X19A 3ET5A 3BOSA 1SKUA 2YXEA 3AIOA 4IOKA 4MZDA 3HO6A 4TL8A 1Z3CA 3W6PA 5FTKA 1AKNA 3SHFA 1G20E 3HCNA 2H52A 1JWBB 2P2DA 3Q6NA 2WYVA 1BXRB 3PUXA 5AVYA 5C34B 3B2QA 4Y9TA 4M0FA 3TTVA 3I37X 3SZOA 1W85B 1QP8A 3NFYA 1FNMA 4MWCA 4LOIA 4C87A 4Q4CA 2OKCA 1BU8A 4D0LB 3FOAA 3TEMA 3NHAA 3S8MA 5BW8A 1AUOA 5JYCA 4JLSA 4CETA 5C7LO 4CKWA 2BFNA 2VF4X 4ZOBA 1SUBA 5DX0A 1Z08A 3ZU5A 1P7CA 1CRWG 3GP3A 3ZLJA 1Y7TA 4MKFA 4NRDA 5EPEA 4LYGA 4ZCLA 4AMYA 4DMMA 3BUSA 3D1LA 4Y2HA 1L1RA 2WIKA 2XF8A 5GJCA 4WZZA 1UMCA 3AF0A 4X20B 1UPTA 2OK8A 1KJJA 3EF3A 3IILA 1NY6A 3M82A 2ZBGA 5E1DA 4D5EA 1EGAA 3G85A 5LXTA 2XNKA 1T3HA 1B15A 1YZFA 3VH2A 5KSWB 2OQ2A 4MS4B 4DYDA 4JXXA 2WABA 2DWCA 2DKFA 4CUJA 2Y1XA 4F2GA 4QPJC 4RPCA 3TOVA 3BBLA 2C7VA 2AJTA 4MV6A 1PQ4A 5IJ0B 3WKAA 1EFLA 1LQ2A 3IH5A 4W82A 1IBMB 1AJEA 1AB5A 1NNSA 1F6DA 3G5UA 4RIEA 4B6JA 3ZXXA 5IKXA 3NHJA 3TL3A 4HNVA 1T24A 3ZY3A 3MG9A 4RNDB 5E3IA 4FYJA 2OGZA 1MH1A 2VLIA 1NF2A 4GDMA 3V4ZA 3AVTA 2QXYA 3DE6X 2XDWA 4R71A 3JSXA 1OC4A 3KZMA 5HRUA 1YFLA 1NXQA 4ZIRB 3TQTA 1E8NA 1YE5A 3SNHA 4IXDA 3L2OB 1R15A 1KOFA 1NMEA 4FFSA 1KVTA 4J3FA 1EMDA 3ZW8A 4Q3LA 3U7GA 4QQNA 1XWWA 2BEUA 2Q21A 2WBLC 4EA9A 1TT7A 4V0QA 1HDRA 4BX3A 3F4KA 3JXEA 3KELA 2DETA 3MZ0A 3WLNA 2ODEA 1WD7A 4YXFA 4ES6A 2LIVA 5JTTA 1JUDA 1H4SA 4Y8VA 5G3ZA 4RTSA 2YC2C 3DBLB 2VA8A 4MKRA 4IIGA 1RKQA 5ADVA 4FEAA 2IRWA 3EW9A 4P86A 2ZBQA 3WLPA 2EBWA 4CKCB 3AF3A 3K7EA 4JQSA 2R9VA 1WCIB 3WVNA 3E8SA 1TZ2A 1ZYUA 3R7LA 5ER6A 1I8TA 2X13A 4NR0A 5FLXA 3RLIA 1P31A 1DKQA 1DS6A 1P2SA 1R4MB 3CCBA 3EUEA 3RFFA 3H9CA 3RWOA 4E1VA 2RSLA 4QXOA 4ZRMA 3VQTA 1OX5A 3LHDA 1IPHA 3W9UA 1ST2A 4DE5A 4MJ3A 2EHDA 3MA0A 3CG4A 1YB4A 4JSRA 1JKJB 1YRBA 1G5PA 4LYAA 1Z4JA 3BFJA 4LMBA 2FMHA 3HV0A 2R0QC 2GPAA 1YZKA 3FWYA 2OD7A 3MCAA 3JALB 3DBRB 4KUGA 1JLMA 2NVWA 3BCSA 4OHKA 2AEMA 2OK7A 4LQ4A 5WRFA 2C82A 5BNIA 5JS1A 1U1FA 1GNQA 3CZRA 1K8RA 3N8KA 1YI1A 1I10A 2LP4Y 1SO8A 1C3XA 3KFXA 3GX1A 1F2VA 3R3JA 5AICA 4OX9Y 3ANYB 1QR2A 4JOQA 4R3UC 1LBIA 1H8HD 3GVHA 3PHHA 4L7VA 1AQUA 4NBWA 5FNVB 1E3WA 3RSSA 3GJ3A 1QZ3A 4ALMA 1EK1A 3H2GA 1DKOA 3TUJC 4XVUA 5SICE 4KSYA 4GKJB 2JLXA 3UTCA 3V3TA 4G0OA 1Z6ZA 4FONA 4OAOA 4KR2A 4I4CA 4B4KA 1RMYA 1NAIA 1IN7A 3HR8A 3O7WA 3Q85A 3UMCA 1F1JA 1W19A 3QU5A 2H7CA 2GERA 5DN9A 1AZLA 4DL9A 1XRPA 3I5UA 1VB3A 3R75A 1T3ZA 1EVQA 1GKLA 1LLQA 1G8MA 3UV7A 4Y98A 2Y0CA 3ICQB 1CDEA 2QKYA 5ALGA 1LDNA 1R3DA 2HXYA 4Q9KA 1QRUA 4KR3A 1DAFA 1DBSA 1UL1X 1OI2A 1NVGA 4ASUD 1C8KA 4C3OB 3IMCA 4MUMA 2PWYA 1GA6A 3U6KA 4LRXA 1JALA 2ZFUA 3V7NA 1DB3A 2Z2KA 1FFAA 3PUIA 4LDNA 1U0SY 2WWYA 2ZUUA 5CLHA 2DR2A 4QUKA 3BJEA 3V8RA 1R88A 4G5FA 5AVJA 4LXIA 3K73O 3H2BA 4IGEA 3CTMA 4PX3A 4UW9A 5AW3A 2JL1A 2WYHA 3DT6A 1Y4ZA 4YROA 3AY0A 4EB6B 5IVPA 3B60A 5IRCD 2C29D 2GUGA 5FWAA 1YJ8A 4WKCA 5P8WA 1A5BB 4Q01A 4Y2SA 5MHTA 3MWEA 1UK9A 1CR2A 2WJ6A 3HXPA 3D8BA 3HVJA 3WC4A 3ZWWA 2PKRA 3DONA 2JCGA 2BEVB 4BFUA 4YIHA 1AV7A 1QZUA 4BVAA 2OV1A 4PQEA 1Z6PA 2I7TA 2BE9A 2QORA 5FHQA 4QFDA 3HWSA 4PYOA 5KTNA 5CA0A 4HB3A 2BEVA 2VNIA 2QI9C 3MGBA 3T7IA 1UPFA 4G1BA 1QS0B 3BMQB 5DK4A 3NGMA 4RXUA 1GYRA 4CKBA 4EMTA 3RT7A 5F4ZA 4ZEOA 1HE3A 1NXPA 2YBEA 4NIMA 5IMBA 1ZWKA 3AQ4A 1N9KA 3IAEA 1MORA 2ZI9A 3JARA 1YMQA 2ECFA 3C16C 1TZJA 4FDLA 2ERYA 1B43A 3Q3HA 1BDMA 3WSTA 3O1JC 3V48A 1XKQA 1EWQA 1DEKA 1XTRA 1YDEA 1T2VA 1UOQA 1M1NB 1ZWLA 5CT6A 4LRQA 4QBFA 3G5AA 4PSVA 5DM0A 1EESA 1DIOB 2V6JA 4Q1EA 4V0KA 3FB1A 3S8EA 5HCUA 2ODTX 2X4IA 2DT8A 3QFCA 4KKVA 4MPDA 3TG2A 4IEIA 3HB4X 2IPAB 4B6OA 3GPLA 2C9CA 1Z25A 1LF5A 2NTJA 3G2MA 1E1CA 4C7BA 1HPLA 4ZYWA 2DBQA 1Z37A 4PNPA 2HRZA 2OXRA 2IHUA 3B6ZA 1G2IA 3QEBZ 1JQ3A 5IHPA 3K9HA 3JQGB 1MO2A 2YVLA 4L8WB 1FDRA 3R6GA 5FPSA 4MKHA 2Q8NA 3JVEA 4AG5A 4UNIA 5K8LA 1YQWA 2QSUA 3GMDA 3HUTA 4G81A 4NENB 4RNCA 2V6MA 2WWVD 5BUQA 1T6ZA 4MW9A 2PT5A 3RDPA 4KR7A 1BMTA 2VJPA 1A0OA 2YVQA 1IRXA 4QLOA 1KDYA 4LCJA 5CB0A 5ALHA 4LUCA 4L9WA 2W2OA 1SKQA 2AEJA 1CULC 2QE7A 3P20A 3EA4A 2XCLA 3HSYA 1V39A 2A2ZA 2WA1A 3K5IA 3L41A 1TTHA 4EAAA 4YRBA 4B3DA 1GTL1 5GONB 4YHHB 1DKLA 1L5WA 1BX1A 3DZ8A 3PE6A 1P4HA 4FS3A 2EP7A 4JNKA 4LJAA 1DAPA 3MTJA 3Q3EA 1MNQA 4P6VF 5SZJA 1E8MA 5AVQA 1N0UA 1RBMA 2G1PA 2WUVA 1B23P 1GPAA 1HQYE 4PANA 2GVDC 5ESRA 3F9IA 4FYVA 2BFPA 4IFTA 4XSHA 3REOA 1HNZB 4I6EA 1QH8A 1Q6ZA 3MRTA 4OGFA 4YRAA 2Z04A 4FLMA 3VSEA 3AAWA 1ODTC 1XMJA 2FRVA 2Y6VA 3VC1A 3UK2A 3X1DA 3MJTA 5IWCA 2CT8A 3BXEA 4MULA 3AP2A 4W7IA 3C6KA 4BO6A 2FXIA 1KEUA 2Q5JA 3OCWA 1TA0A 4ZTUB 4N3GA 3KVOA 4FE4A 3GJ0A 2EYUA 4ZCPA 1QR6A 2JCSA 4ND7A 3VPFA 5B2FA 4B3CA 5F3WB 3B89A 4N7BA 4QO8A 3HU2A 4D3XA 1O94D 5EYPB 1E7MA 1A9SA 4ZVUA 4J0DA 1J2JA 1DIAA 3KQWA 4L4UA 4MVWA 5BT9A 3AEKB 2CJWA 3V4SA 4ZZIA 5K8CA 3Q41A 2H3HA 1ZVKA 2D7JA 1MJGA 1NVBA 2BC9A 1YAJA 3MAGA 3U56A 3N2YA 1QHEA 8ABPA 2X8WA 1NBEA 3M1IA 4WIAA 5DNAA 5FA6A 5KC9A 2R44A 1QYDA 3MJEA 3E9YA 4LOAA 1J1UA 1X1EA 2ZQZA 2O8CB 2HQ1A 1EXNA 3PEEA 1OT5A 2FVXA 4KYUA 1FLDA 3AIMA 4DWVA 1OB5A 1H0RA 3ASZA 3DVSX 3RSHA 1ZXBA 5C5DA 5CFPA 2R7KA 4YI3A 1A4UA 2EG5A 1FRNA 2FFQA 3Q9UA 4NECA 2I3BA 3QE9Y 3DMYA 3URMA 1E7RA 4Q0MA 3IDZA 1JPNA 1Y63A 2FSFA 4TWZA 5DASA 5TMBA 3RFUA 3SZLA 3O5AA 5AUPB 3PCXA 1IDN1 2O8EA 2GK6A 3QRWA 2W6NA 3AILA 3W34A 2GO7A 3CVVA 2FQQA 4HRYA 2PWZA 4RV9A 3FPGA 2E0IA 3DM9B 3WWCA 1JEQB 3OQ6A 3HUEA 4RK0A 1VP3A 4Y6PA 3L0CA 4KUEA 3ZIAD 4ENVA 3KQTA 1GUDA 1GFIA 1K6MA 1JLLB 3QE2A 4MRAA 3F6BX 1E7QA 4FYWA 3DOIA 1A8SA 4HZIA 4OXQA 3RRZA 1EP1B 4CIXA 1SU6A 3BIJA 4E08A 3H13A 2Q29A 3KYCA 2PS0A 2HA3A 4IDNA 1UM8A 1MO6A 4F5ZA 1S2DA 5F1YA 1K86A 3CUEF 1U7PA 2WHYA 4BQQA 3OJOA 2QUIA 2RB4A 3PTAA 3EDCA 1OYYA 3DE5X 5HBRA 4G1UC 3TL6A 3F4BA 2D0DA 1Y34E 4TRNA 3THXB 5B4VA 1CQIA 1RNLA 1I1NA 2Z5GA 2F48A 4NU5A 1VZ3A 1V25A 4H7FA 4BLPA 1GCGA 4LISA 3JWJA 3EVNA 4KI0A 4AG3A 4D74A 3OBIA 3AHFA 4RADA 4RZQA 4H16A 4DCJA 1AXRA 2PUHA 4KHZA 5BWOA 4MPPA 1T8SA 1YZLA 2EF1A 3QLEA 3KVRA 3BMCA 1CF2O 3CRMA 1XDSA 1VMIA 4CCYA 4X5OA 4KSCA 1Z0UA 4FHDA 3RYTC 1JHAA 3PHCA 4GXNA 1TCVA 3P0JA 4XRGA 1Q12A 3FPBA 1ODCA 3P2JA 3F78A 4RIHA 5KQMA 721PA 3IP1A 4P2GA 4JI3B 1L7DA 4QUEA 4C20A 1JU4A 2QNRA 1WLSA 3FUVA 2BD0A 1Z2EA 1NJ6A 5IANA 2DJ5A 3A4YA 3U37A 3T54A 4C4PA 1CJMA 5C8VA 2VDRB 5IT0A 3LC2O 3GNQA 1KAQA 1IHPA 1T9CA 1EX6A 3GRCA 3UFXB 4MOWA 3FVVA 2QUAA 4KQIA 4AWXA 4IGKA 3EDMA 4PV7A 4FI3C 2F4VB 2E48A 2EKBA 1C0IA 2FP4A 4PAMA 3B38A 4DUGD 3PKJA 3HCOA 3I6MA 3IRUA 3GU3A 5JXIA 4B9AA 4XSGA 1D8TA 1W8DA 4DA7A 3G59A 5JQGB 4JA2A 2BP7B 5DFAA 3V1LA 3HXMA 1CEYA 3T7RA 1VG1A 1W4LA 3RGGA 3O2QB 1ZICA 2XB2A 1W94A 4MQEB 1HTTA 1DEXA 1Q15A 2GEUA 1HEIA 1XD2B 2M98A 3OOEA 4AD8A 4AJJA 2D1YA 3KG2A 5LLSA 4BQFA 1TTTA 5ER9A 4IDQA 3OZ7A 5BVHA 1EX7A 4TXMA 3NVAA 3EXEB 3ETNA 1NQTA 2YICA 4RHEA 3EOBI 4KQFA 4PS1A 5CR9A 1DJMA 4ZQGA 2Y1KA 3I6ZA 1DOZA 1EUCA 3NEPX 1R37A 1LQTA 4JEIA 1J8MF 1EP3B 5CIQA 5DM1A 1F38A 5B1SA 3S3TA 3GMTA 2GN8A 3LYHA 1I2ZA 3UJHA 5GGXA 4UPEA 1B93A 5LQDA 4R2IA 1P4RA 2C4MA 3MPOA 3R3SA 3L9XA 2CCKA 3VR3D 1XJ5A 1WW2A 3DHNA 1O6GA 5COBA 3P4XA 5LA6A 4XX0B 2XWQA 3WMGA 1K7EB 2VK8A 3GJ7A 3HN2A 3QYAA 3R5XA 1S5PA 4XWGA 1YKFA 1LB1B 2UDPA 4RE6A 3ZGOA 5A62A 1F8YA 3JCZA 2PUEA 4MK4A 3BEOA 1G8PA 1BHSA 3DZKA 3PEVA 1CDDA 2ONCA 2Q5CA 5IBCA 4YMTA 5B7NA 3INTA 1E0SA 2GCEA 2M6RA 1OFVA 3EHEA 5ELXA 3AVOA 3GLTA 4GBJA 5IZ4A 1Z07A 3D6UA 5AVOA 4HAVA 1PJTA 1V26A 1MXHA 1KQNA 3SS7X 4AM8A 3KHUA 4NVRA 4MWTA 1JVNA 1QGAA 1CIPA 4RZ3A 5DLEA 2OAP1 4AURA 1XRNA 2FJ0A 4Q82A 5CP8A 1JG6A 4N3CA 1I4OA 3MUFA 4Y2VA 10MHA 1O5TA 2WPNA 3ZD9A 5CAEB 2GB4A 2WSMA 2ZBPA 3LW7A 5BMOA 3BMOA 3IP6A 2HJHA 3GGDA 3QOFA 5U4XA 4BYGA 1XF1A 1H4TA 3LFUA 3HWWA 1U28A 3GGOA 3K3PA 3QG1A 3IOYA 3PPYA 4HUJA 3A6PC 5TPZD 3T8YA 5ENZA 5TQ2A 1HUQA 1WCV1 1JNXX 4GPD1 1I3NA 1T6XA 3LDFA 3QTBA 2EFCB 3UGTA 5JD4A 2FLWA 1ZSNA 4MZXA 1NUUA 2NU9B 1FX0B 1G4UR 1N7GA 1U7OA 4P8RA 3SG0A 1J00A 1P5FA 1M73E 1VGVA 3B8EA 3GG2A 4EKGA 5DCLA 1QP7A 1WQ4A 3GHHA 4ARAA 2JLCA 4LMRA 4LW8A 3AWIA 1FSGA 4XVHA 2XB4A 2ZUCA 4KG7A 3RRFA 1D5CA 1T4GA 1T9KA 4KXFB 4MROA 3PB3A 3H1AA 3AM1A 1PR2A 4LVCA 5LZ5A 2Q1WA 4ME6A 4V2UA 4M8KA 3RYIA 4AJ4A 3NMUF 1GQQA 2DBYA 4JN6B 3PWSA 4HEJA 3SZRA 2EIXA 2GWRA 4N5LA 1LWOA 2LGJA 3HCCA 4AJ9A 1VJTA 3A36A 2F55A 4P3OA 1PWEA 1R8SA 4DQDA 3GJTA 3KB8A 4FC6A 3B1KA 1ZCJA 3Q0TA 3A6GA 4J8PA 4NMMA 1L1FA 2FRDC 3SU8A 4AO8A 5AHRA 1FQJA 5I8ZA 4ZYXA 4C6TB 2Y05A 5FPKA 4E5KA 1RHKA 4NK4A 3MMZA 3QVLA 4MMYB 5EXPA 3R9WA 2R5WA 2HA5A 4G5RA 1PNVA 3H3JA 4ZAVA 1XLUA 2HCJB 2P6PA 2EFYA 1UC8A 2B4KA 4L1KA 4UAUA 4ZI5A 2VNHA 4DYVA 2VS1A 3PTLA 1FFXB 4U0JA 4Y30A 5CXSA 4NE9A 4B3FX 4RHCA 2GZ2A 4ZN6A 1RQPA 5J4YA 3UAVA 2XVZA 2IY7A 1AN9A 4EI7A 4OHVA 3RNOA 5DF1A 3EXIA 1KEKA 4GWLA 2PCJA 1SEPA 3KBBA 3L4KA 1VPWA 3NUZA 2B98A 1U9IA 3WQBA 3ZWOA 1BAPA 5JAOA 1N1EA 4FGUA 4FB4A 1O5IA 1QOPB 1QXSA 3HA7A 5LP6A 3JVDA 3BGSA 2WB2A 2YOFA 4EI9A 1EWYA 2JFBA 3OTIA 4DSNA 1ORRA 1AQLA 2V98A 3EGOA 2AOTA 1U9JA 4JP2A 3ABSB 3D8HA 3DXYA 2E2WA 5L7WA 3TSYA 3W9BA 1F7VA 1HETA 3MXTA 4CM4A 3R3ZA 5IT9A 1U2DA 2H59A 3NC1C 4RD2A 3U5ZB 1M5TA 1SBTA 3AXTA 5E1MA 3I01A 2JJQA 1QB7A 1GIAA 1R10A 1XG5A 4HH1A 3V1TC 2VP0A 1PEYA 4K2AA 1DLIA 5BW6B 2E1RA 5TY0A 1DOAA 3S5UA 1NV8A 1Y1LA 3BXFA 5G1OA 5MDHA 3VPHA 2IDMA 3SEQA 2HTFA 2PZEA 2Z98A 3P45A 3T1OA 3NC4A 3DEZA 121PA 3LP8A 5BOVA 3NHPA 1CW2B 3JQAD 2G5PA 4TWBA 3HJCA 5A4KA 3SJ7A 1N0VC 2AZDA 3DMNA 3TSAA 3ZHSA 4EB8A 2ZJ0A 2GHIA 3MELA 3F74A 4MTCA 3OP1A 5CX1B 5JFOA 1XTSA 3CR7A 1XXHB 5F3DA 1TK3A 3H2IA 4II3A 5I9SA 3P9SA 3IOMA 2B8WA 2IHKA 4FWIB 4NCBA 3J7AC 2QAJA 3EDYA 3WWEA 5HS4A 821PA 1TL7C 3HGMA 1E3LA 3D9QX 3I04M 3LUHA 3AFMA 4MCIA 3ZJYA 4CF5A 4XDGA 3G0HA 3NDRA 3SAJA 2QGNA 4CMKA 3DOOA 4U2BA 1IHDA 1TU0A 3PUJA 4O4JA 2CDAA 4S2UA 4B8YA 1ENOA 4BVEA 1Q91A 1TO6A 3H3FA 3OJCA 3H6GA 5ULLA 4BVKA 3GLIA 2DYKA 1SA0B 2XUKA 2ASVA 5EP4A 5HGJA 5T6MA 1SUPA 1FYWA 2RHMA 4EJ6A 2H1FA 4MA4A 4ZMBA 2NO6A 3VU9A 5JH7B 5F5NA 1I0ZA 3NEAA 1JAYA 3ONNA 1XZKA 3DD1A 3ROQA 3ZY6A 2C88A 4LX0A 3E3LA 3A6EA 5FT9A 4BO8A 4F6RA 1JZSA 4ADSG 1UF9A 1UXHA 1WQ3A 1KMCA 3GEBA 1ISJA 1LBTA 1XA0A 3LUJA 3QJYA 4J0IA 4KPFC 4JFAA 1EFVB 3TSOA 3U31A 3GOQA 2C8VA 3D7MA 1FCJA 1L9KA 2JC3A 3N2ZB 4HDOB 2VHWA 2V0CA 3GNTA 4NMXB 1K7SN 2FV8A 5SY6A 3UMFA 1RC0A 3K8QA 4O08A 1XYVA 1OBVA 1JL3A 3WIBA 4BFVA 5DOVA 2D1QA 4ZHQA 3H5OA 3O9VA 1U3TA 3F1KA 4TUYA 3NJ8A 1JNYA 2WT8A 3LQYA 4COOA 3L02A 1IWPB 1QCYA 1LZLA 1HA3A 1E89A 3EGDB 4Q12A 2ZITA 2VXYA 3T3GA 4AAYA 1YRWA 4MS3A 3E9MA 2ISSD 4HP8A 1JLRA 1P0QA 4JVMA 4J0GA 3FSEA 4DARA 3N8HA 1JU3A 4N6NA 1E9CA 2ZIXB 4KZKA 1NNLA 3HADA 4K6KA 4UHJA 3TLZA 3CEPB 1TU4A 1RQRA 1D2AA 4L75A 1V1RB 1O5OA 2B5OA 2L17A 4UUNA 3Q10A 3HB0A 4EQ6A 5EJMA 1VLHA 2C4NA 1LVHA 4JX8A 5CXQA 2CUKA 3HVUA 3EZXA 4QOSA 4W6QA 2TECE 1GCOA 4LZNA 4W5JA 2B25A 4BHTA 1Y9AA 5KBYA 1VKZA 3GCXA 5EA2A 2OORC 2BLLA 3RASA 1DQYA 2QX8A 1YRYE 1C4OA 3TLXA 4BNDA 2BUCA 1Q1AA 1NDHA 2R84A 1J2RA 3FNQA 1WBBA 2BBSA 1KPHA 1PD0A 3IQEA 3KL2A 3L7JA 5HTOA 2X76A 1L5YA 1I4DD 4QFMA 4L4ZA 2AH5A 5KX5F 3H11A 5A4DA 4TMVA 4BU1A 5EZ6B 2HCTA 2RHBA 1V8DA 4I55F 5D7BA 5BSEA 3SS9X 1ADJA 4MQLA 2KLBA 2G8LA 2XNHA 3DBHA 1NQWA 4NC9A 1HT0A 3AZPA 5M7EA 1D1QA 3DYVA 3CZ4A 4G37A 1WWKA 2JIPA 1JI3A 4HTFA 2FMIA 5HOQA 2HN9A 5T67A 1P80A 2A5YB 4L15A 4FHEA 1QWOA 3VR5D 5LMZA 4MLCA 4EUFA 4QDUA 5LD2C 3DLBA 1UOPA 5IFLA 4FX2A 1IB6A 4M1ZA 2I7DA 4J9VA 5GP1A 4C7JA 3SR4A 1WY7A 2BELA 2OBBA 2CXHA 3ANSA 3X1JA 4W63A 4UCWA 1E9FA 4BB5A 4YMUA 4JUAA 2IL1A 3VI4B 4F45A 4HNGA 3LC7O 5DWVA 3G2JA 1Y3HA 4QDZA 5HJ7A 1QHHA 3U7QB 1PL0A 4H60A 5AVZA 3DZDA 3EVAA 2F59A 2ORWA 4Z9AA 1NF9A 3VC7A 1PJ8A 3KJEA 4JJ4A 5DI3A 3S4YA 5JNUA 4Y9RA 1S3FA 3TIFA 5I7FA 1VKJA 3O75A 2D1SA 4JLPA 5DT2A 7MDHA 2GK4A 2ZR7A 4NCJA 4MVCA 4AW9A 4OLBA 1GDDA 2XZPA 2HRCA 4XH9B 3HFRA 3GH1A 2SHKA 4RANA 1SC1A 2I1LA 2P75A 2B94A 2Q1TA 1BROA 3M4JA 1A7AA 4ZCRA 3L7OA 4GOND 4F04A 3GZ4A 3LCCA 5M3BA 1TM4E 3N0WA 4I5EA 4ZARA 3AL0C 4Y1FA 2ZVQX 1MIHA 4JBYA 3FWKA 3QNWA 5H3HA 1Z5WA 1XRMA 2IXBA 2ZYIA 1H8ED 4RQUA 1DTSA 1RMTA 3LBNA 1JJ7A 3W3AA 1XCOA 3AM3A 3NFRA 3E5MA 1SCDA 5DLDA 1T25A 4IUYA 3TOCA 1H6AA 1PRYA 2ASEA 2GRAA 4RORA 3N6RA 3K1AB 3OQ1A 4NABA 3VO1A 2IE0A 2VH5R 2JKZA 4Z9BA 3WLJA 4YCLA 3I2YX 4A3SA 5I7VA 4ZT3A 4NQZA 2BCJQ 4JLMA 5ITZB 2H4WA 2FUEA 3ZG6A 5E7JA 2C84A 1M6VA 1WJGA 4OIFA 1JEAA 3O47A 4Y18A 1KGSA 5JRZA 3F7OA 1RWOA 3AQIA 4M46A 4ZVSA 1Y98A 3RQIA 2D5CA 3ZKWB 2RIRA 4YRIA 4D3YA 2PWPA 4FUQA 2LRHA 2P9FA 2OYCA 1MX3A 1OASA 1KQFA 3IPCA 1TKAA 3HXQA 4OQLA 1G98A 4PYNA 4IHKA 2PUGA 2IZ1A 2ZR8A 4E2YA 1DIGA 5DHRA 2XCUA 4R69A 4CM8A 2BEKA 4DMRA 3OIUA 4KE6A 1WXFA 5BN3A 2HQOA 4BFZA 1HH4A 1NRJB 2APJA 2F3QA 4QM7A 1VRWA 1JB1A 4B7AA 5D3KA 4YYZA 5EJ4A 2OPBA 4FR2A 4EHNA 4PGHA 1J7KA 2XUPA 1T0PA 4QTUB 1Y8AA 4Z9YA 4RHUA 3DG9A 3C4QA 3I52A 1FYVA 1A50B 1UBNA 1QQ5A 3LBHA 5J1TB 5YASA 5B58C 4JJ7A 1T4CA 2Y0PA 1GARA 2WUWE 3MGGA 3P4UA 4L73A 4AZ3B 5BSGA 3GO4A 1U8YA 2FEWB 2QVBA 2R60A 5F9MA 4CM6A 5CBPB 3D59A 1WHSA 1WE2A 3WOVA 1JBEA 2ST1A 4N0EA 3WV4A 3LCUA 3EVTA 3O2JA 2XQKA 3LAWA 2QY9A 1SVKA 5DOZA 5KWVA 1KDZA 1N8NA 1L5QA 3ETLA 3I2FA 5DRYA 2UZ1B 4PX2A 2JCBA 1EPUA 4KDCA 1WRBA 5JE8A 3AG5A 2ZVDA 1LSOA 4FT2A 2ACEA 3RIXA 3ZE0B 4DKXA 1NBOA 2YWDA 3LOPA 4MQUA 2AFHA 1P0CA 3IMKA 3ROFA 2MSCB 4L72A 3OZVA 5AHWA 1IOWA 4PRZA 4DA8A 4CKCA 2W11A 5DN6D 1ID1A 1JTEA 5BV0A 3UJNA 4Z54A 2IS2A 2REXB 2O3RA 3H5NA 1HE2A 1KH3A 2IYTA 1IHYA 1NSFA 3B7GA 3NWBA 5JROA 3BEDA 2JG3A 2IZOA 3OX3A 3IALA 1HMPA 4US0R 1VLJA 2YN0A 3WQHA 4YJFB 2HDHA 4WI1A 3RW9A 4EFLA 4GX2A 2DHQA 3I6IA 1XCBA 2AG5A 3ON5A 1G3MA 3G9QA 2ODAA 3SZMA 4X1KB 4EZIA 2O0KA 4P35A 3F7NA 5EMNA 1JKJA 5DNDA 3OQPA 4DGQA 5KNCA 1MA3A 3AINA 2HIAA 1R0BA 1SVNA 3AERB 3FDXA 3EGXB 3GJ4A 4NH4A 5CLIA 1IG3A 4W5QA 4YQFA 1PSZA 3QYJA 3NJ4A 1IWOA 4IIBA 1WETA 2HHHB 2P65A 1KMHB 5DULA 2ORVA 1VECA 3T0FA 3ZZUA 1FFSA 2JFYA 3AEUA 1BE0A 4KDRA 2QBYB 1NBAA 2JI6A 2XUZA 1OWOA 3QU7A 2M2IA 2O0JA 3M4ZA 4MI9A 3QUCA 1ULTA 1IVSA 4WKPA 1YE8A 3NAQA 2IS6A 2JFZA 2YMLA 2QN8A 3UJCA 5DNCA 3JSAA 2QM8A 2FMTA 3ERCA 3WO0A 3E22B 4PYQA 4QXAA 3THWA 3EW7A 4OQNA 1BXKA 3PWKA 1JAIA 1YQEA 2A58A 5ALYA 1IJKA 1GSOA 2J3IA 1AGRA 3GAMA 1YR8A 3KAPA 4FYHA 4I1RA 5AYVA 3E22A 1YMVA 3HJBA 621PA 1LNZA 3B1VA 1NN1A 3UMJA 1N7IA 4AY5A 1SCUB 5IBRA 2E21A 2J5QA 3EB9A 4MDHA 1F60A 1RTTA 1WPGA 3SYTA 3UPDA 3WGZA 2KX7A 2WHQA 2V5VA 1FDWA 3GGGA 2D13A 4HWGA 5CGQB 4LFCB 6YASA 3VAAA 1N6IA 3MQ4A 4BVGA 3CVYA 3W8FA 1Z4PX 1OI4A 1K6JA 1KI6A 3GARA 2CEKA 4HZUB 5T4BA 5IKPA 1X7HA 3P9NA 4B6EA 5MN5A 1EBBA 2AVNA 3C14C 5HFNA 5IUKC 1C0EA 3IHKA 3ZH9B 1UKBA 4EHDA 2XVYA 4H7HA 2DTEA 1X1BA 1XZLA 2DSNA 2IYRA 2OFOA 2WTXA 3B20A 4JUCA 4URYR 1PT5A 5K4AA 4UTRA 2DWQA 2FPWA 5L51A 1CB7A 3DXXA 2G88A 2PLFA 4RF5A 4KGXA 3S1AB 7GPBA 2A7QA 4XLLA 1YDGA 4DR4B 2ICAA 5U9CA 4CLHA 3QLUA 4H4DA 5G4LA 3O2NA 1CJTC 1G0NA 1HLPA 3BSYA 4J1TC 2QD3A 3CNNA 5H4HA 2C58A 2L69A 2C3YA 3V8QA 3KYDB 2I1VB 2EFGA 2W37A 1ZK2A 3A1FA 2CNWD 1G21E 1SQ6A 3PEUA 4MQBA 3RVSA 4B4WA 1TMGE 3G6KA 2IDZA 5AO9A 3A9RA 3I9LA 1U1DA 4D81A 3M4YA 1NW4A 1DKMA 2LBPA 4XQCA 2P1RA 2J3JA 5TVGA 4AECA 4EPYA 5EESA 1GKIA 4ZQBA 1NN3A 3PPXA 3WY9A 3MWYW 3ETHA 2WTAA 4KKXB 1YDHA 1GZ6A 2JNWA 1UBEA 3R5SA 4F6LA 1ARZA 4AO6A 5LOVB 2I62A 1Z34A 4E3WA 1SIWA 3NTVA 4AY2A 1KDTA 3AR4A 2XOXA 3NIWA 4J0KA 4TVOA 4XI9A 4O29A 3T7CA 4KLCA 1XB2A 1XRRA 3FIJA 4AX8A 1IQRA 4ZGWA 1SU7A 1XRSB 1SUWA 2OHOA 3PIIA 2R3SA 4NPHA 2VDPB 1U2TA 2ZK7A 4OJMX 4MYDA 4FZJA 3FYCA 3KJQA 4EY5A 1R9MA 1AGNA 5GZ3A 3N3BC 2HMWA 2YW9A 5CEFA 1Q1EA 3ZH2A 4D4JA 2AN1A 1M2OB 3KC2A 2K4MA 3A2LA 4R1QA 3R9IA 2HNBA 1A04A 4AYWA 2QJFA 1YZQA 2R1VA 5EUQB 1TM7E 3VNQA 2Q1YA 5JD6A 1IY2A 1GOTA 2GT1A 3OHSX 2YYYA 4JAVC 4IOMA 3F3YA 2K7FA 1JWLA 2ZJ7A 1M6HA 1EDZA 5A1JA 1EUQA 4RMGA 3SQOA 2G0TA 1N2CE 3HFSA 3IMEA 4OA8A 1TMYA 4KIJA 1KK3A 2YY6A 3O8QB 3ESAA 1KKMA 1QFSA 5CT4A 1T1RA 3K6RA 3MMPA 5GPBA 1J1ZA 1ZA2A 3WHLA 4WCFC 1U8ZA 4W9NA 4G1EB 5BMVF 3ADDA 1LGYA 2O8EB 2FVYA 1B3RA 2MDTA 2GBCA 3OOYA 4YJ2A 5B6PA 2F8MA 1OXBB 1RLMA 2A1TR 3HZOA 3L43A 1Y9EA 4P3YA 1HDYA 1OYVA 1W5FA 2MIIA 4PXYA 4B4OA 1OXTA 2JGRA 2IT1A 3MMXA 4ZV9A 3WK7A 3TQSA 5GONA 1JLLA 2XHEA 3IPLA 1DP4A 4RZ2A 3RKSA 1P2UA 2X8BA 5CJ2A 4YT5A 4TTRA 4QUHA 5HMLA 5IASA 1GFZA 4P32A 1ZKDA 4XKJA 2PH1A 1FBNA 2VC2B 4GPBA 4C78A 3H0CA 2AOWA 1SVMA 6GPBA 3U80A 2LCFA 5FPQA 1N2SA 3EWSA 1SXIA 1Y7HA 2BYTA 1QH8B 4TXLA 1ODIA 1GCAA 3FNHA 1QFXA 2KM1A 5BSUA 3IT0A 2OPHA 3QTTA 1SOWA 1JQ5A 3NBUA 3KZCA 1RXWA 1L1EA 1I0LA 2W2NA 1O58A 4CQLA 3BERA 2XXBA 1HOTA 5FLKA 3UN1A 4FFOA 5FUQA 2X9QA 4RK4A 2HCBA 4IZ6A 4BCBA 2I0FA 2J1LA 3B13B 1V95A 3N6VA 2QUJA 4EJMA 4NPCA 3RROA 3T99A 3B2EA 5EE3A 4KGVA 4NSNA 3TXAA 1W2WB 3BAZA 2X40A 1GAWA 2PBFA 1T3TA 2TMKA 5E6SA 4CCSA 5L4NA 5GINE 3AM4A 2F8SA 2WTNA 1MUUA 3G82C 4F9EA 3DTVB 3GNLA 3NV9A 1GT6A 2AG1A 4MI1A 4RA9B 3RKRA 1AA6A 4LSGA 4LRWA 4ENQA 1GP2A 3H87A 4F9TA 2GCOB 1P9WA 2IXTA 1Y8RB 4LWQA 1Z7EA 2I03A 4AYXA 3MJDA 1V3QE 2NXJA 4NZPA 2BLNA 2RGDA 2Q6TA 3AKEA 1YOVA 4O2AA 1DWOA 3Q15C 2HBYA 4AUMA 1GPJA 4LHVA 1FTGA 4FOTA 1E2NA 3ZE2B 2NV0A 1ZOPA 3O8DA 2OCYC 4AROA 5JANA 4XUDA 3ER9A 4H7EA 4B73A 3QVSA 1Q3TA 2VNKA 2C4KA 2WU8A 4IQ0A 4XIIA 5IW8A 3IP9A 3TLAA 5EJAA 1S1MA 3G5LA 4YGYA 3FLAA 1KK2A 4NJEA 3RIHA 4J7CA 1K6IA 2QRJA 3SJUA 2FW6A 4ED9A 2P4HX 3QM1A 4NOMA 3RSCA 1RWKA 2C2HA 3C43A 1GU0A 4XUGB 4QC2A 5G0TA 4WJLA 4J0EA 5B1EA 3C6MA 3R0JA 3WLEA 4AXBA 4FBMA 5EUMA 4BB9A 4LNUA 2QRPA 2I3AA 4ZOLB 3S7ZA 2EP8A 1KK0A 1PD1A 3EVEA 2PD4A 4LA4A 1FFCA 5H02A 3OFSA 5B4TA 1MX1A 5BNWA 3OE5A 4WXRA 2H2FA 2CWDA 4HZGA 1ZONA 1VRCA 3HPRA 3HU3A 4LNUB 4I50A 1YONA 1NXVA 3IQGX 4UE6A 3QPBA 4ZQCB 5EZYA 1TQ2A 1C1XB 5HJ2A 3ZX4A 4CR8A 3UBTA 3AEQA 1BE1A 4G5HA 5FD8A 1GV1A 1NTRA 5FORA 2O3TA 4AJNA 2RGCA 4BJ6A 1RACA 2MINB 2PGIA 2PZBA 3IIIA 3KKOA 3OQIB 1CRZA 221PA 2CWWA 3QP9A 3ZWBA 1IWBB 4G1MB 1XYGA 5DGIA 4KAXA 2VT6A 5KREA 1E1QD 1RI4A 3HO8A 1XEWY 2WNSA 1W5TA 3A1UA 4KTTE 4ZD6A 5IC4A 3EWAA 2W2TA 4XQGA 3QVMA 4OQEA 1SCBA 2ZJYA 2WM8A 5DCWA 1DHRA 3ESRA 1FVXA 3O6VA 4MA0A 5B30A 1OT3A 2FEOA 4BNDB 4DLTA 2CUNA 5K0SA 5LU8A 2CLLB 4U9IS 3HKEB 3A58B 3PIDA 2ZIAA 1L6IA 2EXXA 3EEIA 2ZUFA 3ZZ1A 2DP4E 3MS2A 1XQYA 2GJ9A 4B33A 2NGRA 1NXSA 2BH9A 2HRQA 2PS3A 1JFRA 3IUPA 4KVZA 4TTVA 3Q3GE 4Q48A 3VJKA 4ZOEA 4GOLD 4MVJG 3ZDFA 4HVAA 3ROTA 4KQCA 3C8UA 5BUZA 3IP3A 1MX9A 1SVWA 2AXQA 5IVKA 2VF7A 3DBHB 1GV0A 2XR1A 3STWA 1E79D 1QAOA 4RH0A 4HTAA 1CE8A 5JVDA 1O6FA 2D62A 4JZYA 1VHWA 3BWYA 2XTAA 2E7ZA 3DAOA 4IXTA 3GLGB 4FQ8A 1E6LA 2WSSA 3CUWA 4YREA 4DR6B 3RS5A 4MR8A 5H81A 4TLDA 3VHXA 1J0AA 3QUTA 2ZYGA 4BIMA 1C81A 1GTJ1 1NFFA 1YFKA 2Z8YM 3CWCA 5EC8A 2CLOB 2G1UA 1I9CA 3QXGA 4B81A 2X4DA 2QTWB 3BZUA 3C1NA 1KI3A 3HPQA 4JI0B 1TM2A 3TE6A 1NVVR 1JH8A 5AI8A 3OU7A 2OHJA 2PV0A 2PVCA 3VTAA 3EFBA 4YCJA 5KQLA 3EZYA 1TIPA 3HVKA 3L82B 4JHXA 3KR2A 1LPOA 1Z83A 1TTQB 1GNRA 1QO0D 5E7MA 2IU0A 3WK6A 4LF6B 5HJ5A 3WB1A 1P4JA 4DM4A 1U5AA 1EP9A 4M6WA 1BQ4A 1ZVMA 3IR7A 2XBMA 2OD2A 1A5SB 2HDNB 1M9NA 2OHVA 1T15A 3E4DA 4Y9DA 2UYCA 3I9OA 3RU2A 2FQ1A 3I2JA 3FOFC 4Y2RA 4NE7A 2PJUA 3EZ2A 4M2LA 3IA7A 3AFHA 4LTMA 1DG3A 1PJ3A 1M76A 1BFDA 3ELDA 1F9EA 4G5XA 3W1VA 1XPUA 2H07A 2QJTA 4JQOA 3A6LA 2B3TA 2P3OA 4IVNA 5CU7A 3U40A 5K99A 3HKDA 3ABOB 5TE9A 5D51S 3JQ7B 1VRVA 1F8UA 3EIUA 5A71A 1ESDA 2NNLD 3AHCA 5AKZA 1NQ5A 3LVFO 3ZUPA 3ZXYA 3RAPR 3B82A 3EMBA 3LK7A 5KQGA 5F35A 4XD2A 4BNZA 4CM5A 1BDBA 2HF2A 2ZR0A 3UXYA 1E3MA 3RAFC 3T1HB 1TAUA 2PZKA 1A4IA 3AHJA 1DQZA 4E22A 2FCAA 5G41A 3Q6MA 3DNPA 3GROA 1TA9A 3JQFA 4V1CI 1NY5A 4HMPA 1IVNA 3G2NA 3IC5A 3MILA 5EKTA 2J3HA 4YXWA 3PHGA 2I6XA 4QO7A 3EXHA 4DY4A 5B3AA 1MJFA 2I5PO 1EFCA 1MU0A 2BEJA 2M6SA 4C04A 2RGNA 4DEXA 4OFXA 2CW5A 1X7ZB 1BJKA 2AN9A 3ENVA 4LZWA 1P0PA 2AHOA 3F7MA 3OF5A 3W4JA 3FTPA 5T7BA 4OB6A 2XCIA 3EXHB 5DHPA 2PJZA 5ECWA 4Y7CA 4A8JA 4D56A 2HXGA 4WJKB 5GADl 1ZY2A 1WL8A 4LV5B 4QQFA 4D02A 3VV2A 3RVDA 4L5JA 1RYNA 1E3EA 5FBWB 2XODA 2P2LA 5C2JB 3VYVA 3QUAA 3U44B 2RGAA 1JWAB 3V4RA 2EJCA 1ISRA 3K15A 4L0MA 1IL0A 1TO1E 2DTXA 1B1AA 4OD0A 1YZGA 4L78A 3WJ1A 1ORDA 5K3FB 3URKA 2HREA 4KWIA 4DCMA 4OQYA 1Z63A 3Q87B 4MV7A 2QRVB 3L92A 4MR9B 4F2DA 3KT8A 5EIWA 3DZBA 1FDOA 2PSSA 2BHRA 1J5PA 1FVFA 3HDYA 4R2MA 4BTEA 2VVTA 2Q3MA 3FYTA 5FL7D 4BECA 3D2BA 4H3SA 2YHUA 2IYSA 5K0FA 3DH0A 2ES4A 3T7KA 3PFGA 4ZPJA 4MV0A 3W0LB 1ZH8A 1B8PA 4KFSA 4OG2A 1N8SA 4DJFC 3KSBC 4F1JA 2FWNA 1UWVA 4JCCA 4R83A 3STHA 1ZM3A 1US8B 1U99A 2JATA 6LDHA 4JD5A 5JSZB 2ID8A 1QX4A 4EY7A 1WCWA 2VP9A 1P19A 5JS2A 2AWOA 4PLGA 3TQIA 1Y5RA 3KJXA 2XX3A 4YBRA 2EG9A 4FGKA 2JFHA 5ITVA 1GPLA 4CWAA 2B8EA 1KAEA 3PQ5A 3IPYA 3GUVA 3VZSA 4CJXA 3ZYZA 4ARZB 3KM0A 2YC4C 4OQMA 3HY4A 4B6PA 3K9WA 1W29A 4AS2A 3GNSA 1GCIA 2J59A 4DRXB 4EENA 1N0IA 4DLZA 3RC8A 1XZDA 3INRA 5KVSA 3ZBUA 1CV2A 3FE2A 3ETGA 2NYUA 1NW5A 4MS1B 2D4HA 4H6WA 2X42A 1ZVQA 2XWPA 3LY7A 2NSHA 4FCTA 5HIJA 3RABA 5JI3E 4DJEC 3IJRA 2WIAA 3N86A 1IJFA 4YN3A 3OWHA 5F73A 5B2EA 3O9ZA 2FR0A 1PP4A 1GNLA 1YZNA 3TVIA 1MAAA 1QK3A 1D4ZA 1XZGA 2FF5A 2GXUA 3CUKA 4MA5A 4X7PA 5C8ZA 4XCQA 1XZPA 1P73A 3DDUA 1C3OA 3M5DA 3BS4A 1P39A 4F4IA 2XCQA 4TTPA 3RE1A 1NQUA 1Z75A 1KYIA 3EAGA 3NONA 2QZJA 2Z6UA 3IYLW 2XD9A 3K4QA 1QK5A 2H5IA 4KLZA 2RD2A 4DAOA 4LGCA 1A9RA 2Y1WA 4LDQA 1D09A 4KQXA 2B1JA 3ZNNA 2J9FB 2XGMA 2ENWA 4UBKA 1GKUB 3MGAA 5DTQA 3FMIA 2NYAA 1WB5A 2O06A 3M6VA 3DP7A 4N8SA 2WWHA 3TPZA 3WRYA 4JYMA 4KRGA 4DMCA 3FH0A 1U2GC 1WZUA 4QT0A 1XTUA 4G26A 5HK9A 2I3DA 1I6WA 1YHZA 3DOEA 4TTIA 7YASA 1MRNA 3BXZA 1QIHA 3OHMA 4QA9A 5BXQC 2QD2A 3TFQA 2ZOSA 5EJ5A 1AKRA 4ZJUA 3CNBA 2C7QA 3K20A 4LY6A 4DF3A 3N05A 4BS9A 2CV0A 2Z6AA 1FYXA 1GT91 1VKRA 3FCOA 3IP8A 1E9SA 3GEMA 1JIUA 2CE7A 1GVNB 1RKVA 1OV4A 2COUA 5L3VA 4WXEA 3NT5A 2HW8A 2GJAA 4C0LA 4GI2A 3A9UA 3FF1A 1KETA 3I9V1 5CVVA 2GYUA 1TK9A 2AG0A 1SCIA 1P17A 2A84A 4D9HA 1O0BA 5LU9A 1RXIA 2P5TB 1JIQA 3GXOA 3L8FA 5IVIA 4UU8A 3DM5A 5HQ3B 3SX0A 1X14A 2YZ7A 1QLWA 1SGWA 2VJNA 2W93A 3CYFA 1O9HA 4M1KA 5FOQA 2D06A 1E5DA 2YFHA 4KLNA 4IQGA 3A0RB 3BE6A 9LDBA 1RKUA 2PM8A 1TZMA 1X94A 1RR6A 1S2IA 2XYRA 3BMQA 1TUEA 3EZ6A 3GLHA 1MQSA 2I8LA 2Q2QA 4YS6A 2OFPA 2ZE8A 2IHZA 3DE1X 8AT1A 2J32A 3OFJA 2O1WA 3M49A 4L3OA 4AJPA 5NULA 3NKFA 1SH7A 1NVFA 3DUFB 5I4CA 4LVUA 1M6EX 2GFIA 4UBOA 5I9TA 2R86A 2ZROA 5M29A 3SQXA 3SSAA 3DJYA 3IMGA 2JK1A 1KTVA 3QWAA 1E1MA 3KPYA 4H0CA 2OV4A 3QNMA 5BSVA 1C3JA 2O4UX 4FS8A 3FYSA 3IBCA 4OGLA 3R6TA 4QXPA 1C9KA 1RLTA 4H6VA 1JYSA 2XITA 4PX9A 1RQ7A 3T4XA 1SULA 4E33A 5FX2A 3C1TA 4B3JA 5ALLA 3IKLA 4YP5A 1N8TA 2QMEA 4QJIA 3OLQA 1R16A 4NL4H 4PO9A 3JX9A 3VZRA 1Z6XA 3IUYA 2Q3LA 1RVDA 1XZIA 4RQBA 4ALIA 5K8TA 2AF4C 2X6QA 4AKEA 5LMCA 3D6NB 5JISA 3WR5A 1F2TA 4DBLE 4U2CA 1P5HA 2DG2A 2VCHA 4AG6A 2I6SA 2VJAA 4QNMA 2OCPA 1ZJZA 4G4SP 1Z6AA 4GF5A 4YUAA 2VP4A 4ZYUA 4G41A 2XRMA 5B3LA 3WGJA 5F9FA 1KOJA 1Y5IA 4E46A 3FHOA 2QTBA 1XL1A 1Q22A 1QFYA 1THGA 3ECSA 2RH5A 2X77A 2WA2A 3JY6A 1E2HA 3NO4A 4HXEB 4Q9AA 4R8KA 5ILOA 2R8BA 1QHHB 1K3TA 1YNOA 4LG1A 1H8HA 3VC3A 5A4JA 1OILA 1YZTA 5D2CA 1LLDA 5GM1A 1LW6E 4MRSA 4EQZA 4L6AA 2HNKA 3HCAA 3LUGA 2PHZA 2I3ZA 2YIVX 4RZHA 4RKRA 5I7SA 3RS4A 2OHFA 1ZHOA 2AW5A 3C4JA 2DUMA 3PD7A 4QXMA 1RWMA 2WT9A 5FUMA 1GWNA 1L3BA 1DWPA 2C4VA 1KSHA 3HRKA 2VYCA 5JAPA 3IUJA 4O4LF 2RBEA 4H7DA 2NPFA 1ZHHA 4IKOA 3Q3CA 1KDRA 2Q46A 1GN8A 2DQKA 4CQMA 1RHJA 3AUFA 3HU1A 5H3LA 2D54A 1MGOA 3I5YA 1QP4A 3Q7SA 1DUVG 9LDTA 3GT4A 3KZKA 2O50A 3ECCA 5IXYA 1QTNA 1YS9A 3KETA 3PHLA 5B3JA 4DWWA 3OIWA 4XW2A 4REOA 1XQXA 5JRJA 2NACA 2W6ID 4O02B 5K03A 2B30A 2CC2A 5I51A 1D2EA 3F4LA 1XTTA 3I1JA 3QXHA 1BXRA 4PSKA 4ZI2A 3EVBA 1NP6A 2EJWA 1LPMA 4PE5B 1GQRA 1WPQA 2CUTA 1PDWA 3C6ZA 2A9FA 3DXFA 4X60A 3SC4A 4AF8A 4AL4A 5KDLA 3W78A 3ENWA 2BRUA 4DV6B 3CCCA 4G4JA 3HZZA 2A9KA 2Q45A 4IO1A 2RHTA 4J2OA 1QHXA 1S01A 2ENUA 4M21A 5DHUA 2V3VA 4X61A 2E5WA 4BBZA 2X0JA 5IBQA 3N2GB 1ZJ4A 2ARKA 4EUSA 3C1UA 3EVFA 2F9FA 3U13A 4ZZ0A 2QM3A 4EY8A 3WE7A 4ZO7A 3BQ9A 1W1IA 3H1EA 4PPNA 4TL6A 4WKBA 4Y1EA 2F64A 3PNQA 5KYUB 3A04A 1UMDA 4WQMA 2GKGA 1V71A 3E84A 2Y2UA 4EYKA 2MSDB 1U9ZA 4XB6B 2JI8A 3IAHA 3R4VA 3R6LA 5AI9A 4ABTA 1W2HA 1TD9A 3AL3A 5HE8A 3NP9A 3P9IA 2XMCA 4J1SA 2CL7X 3KSAC 3GD7A 2Y0EA 2Q62A 4MUAA 4RAOA 2VH1A 2V45A 3T15A 4EEXA 1S0UA 2BF4A 3BB1A 2C98A 3T9FA 2NPIA 4NX2A 5K5EA 1GTMA 5MF6A 3UWDA 4LBYA 4AF6A 1QNFA 4B48A 3BIOA 3FKSD 4C7XA 2J3QA 1OGJA 1NM5C 3USES 1RI3A 5DNVA 1PZNA 3G89A 4GOOD 3LY8A 4OXYA 4QREA 4EDFA 4ER6A 2UXBB 4Q39A 1I80A 1MJNA 1XWIA 2R79A 1PLKA 4JJEA 5C1IA 4C4RA 2BTEA 3EXHC 1WLYA 3L6UA 1MW9X 3HFGA 4GI3A 3L6CA 1X7XB 3LNTA 4A0FA 4AB1A 4U7WA 2ZZMA 2J4CA 2DRIA 2NADA 2IOHA 2YV2A 4TWRA 5DLYA 5F33A 1OXXK 4L5CA 1XK7A 1N3IA 4LYDA 4MB6A 4NFSA 3T7EA 1AKMA 3LLCA 1P5RA 3OFVA 2C3PA 5CJJA 3FOEC 4JIGA 1OLXA 1OIWA 1TZCA 1N3LA 2H11A 3RREA 3CLSC 3UNXA 4E51A 2GLUA 2ZVPX 4PWYA 2RHCA 2Z0MA 1A98A 3WYAA 4Z9FA 4FC7A 4K40A 3ILVA 1JHZA 1QIKA 1ZI9A 2F00A 3IQHX 4E31A 5KNDD 4ZVRA 1RAAA 3OCVA 5D85A 2C4HA 2O59A 2AFHB 3UQZA 4EZEA 4WBXC 3OTOB 5FR1A 3RG8A 3RAEC 3QKSB 4HWKA 5JTUA 2YY5A 1VMEA 2I67A 5KNLA 4KCGA 4TLLB 3NTUA 3CR3C 2QENA 3HCDA 1U7UA 5I4KA 3BHIA 1CRPA 2D4AA 3PICA 1AUQA 1NRXA 1Q84A 5J2TF 3QX8A 4UPDA 5C8YB 3BA1A 2XT0A 2VYND 1NUSA 4BKQA 5KTRA 4KODA 3W6OA 3H5VA 2JIZD 3D4PA 4NAVA 2NSYA 1KDOA 2C2XA 1I2AA 3QE3A 3SC2B 4JYAB 2ZJZA 4OHMA 1KZ7B 2H08A 3R0ZA 1CC1S 4J49A 4JCOA 3D8NA 3NEYA 2VEDA 4JC4A 3EXIB 3O92A 5K0LA 2KW5A 3W4KA 3O4HA 3ED5A 4AKTA 4LSZA 3ISVA 3ORQA 5KCMA 5LLTA 4M53A 4B3IA 1UBFA 1K4KA 1YZHA 2PRJA 3CC8A 1C9YA 1VBMA 3OZXA 3B9BA 4I66A 2WQ6A 4LJYA 3E48A 3B6JA 5I8WA 4REQB 4L08A 2DGDA 1DQPA 3BCHA 3D31A 4TRRA 3T94A 4TUYF 3DKRA 1LPAB 1DWQA 2WUEA 4URFA 5K09A 3KP1A 3C3JA 3KJGA 4P7BA 3HBNA 3SFVA 1MX5A 3VVLA 4AUNA 5LQRA 1YHYA 1OLSB 2ZRKA 3C6BA 3NIDB 3PRKE 4X3CA 1OFGA 2MSWA 4GLLA 3S2GA 3TR0A 2ZXFA 3TW4A 3UB4A 3TN7A 1R0CA 2GWHA 2BVNA 4HATA 4DBVO 1XTZA 3TW8B 3W5IA 3GR6A 4QOIA 1OQAA 5IJ9A 1SC4A 1AQ6A 2RJOA 3M3HA 2PBZA 5JSYA 4QPCA 3VVMA 5REQB 4DV2B 3T1YB 4I9NA 4E5NA 4QPPA 1EWVA 2QF7A 5JH7F 3WX0A 5EHZA 3UGQA 1ENYA 1K08A 4D6YA 4G5QA 4E5DA 1DTWB 3KOZA 3O91A 4PAOA 4O4JF 2I22A 1U28C 2OZLB 4M0KA 5HKLA 3QU2A 4N82A 1VJ5A 4DV3B 3L46A 3LECA 4BFXA 1N77A 2FWIA 4LJRA 4BVHA 3DWFA 3PL1A 1TADA 5BR8B 4LPKA 1E1KA 4ER5A 5FPYA 1KMIY 4OL0A 1NSTA 4XYMA 1MOQA 2GUWA 3RUEA 1ZK1A 2H17A 5CMLA 3U4GA 2GPTA 2MYPA 3PKZA 4JBIA 3F90A 4QDOA 4RAQA 4ENRA 1GLGA 3TQRA 2CB0A 2VDKB 5T3YA 4M0CA 3UCEA 3W7VA 4URXR 3M9XA 5IS2A 1C4KA 1RHMA 2BFDB 4E7OA 4UCXA 3TTTA 3GJRA 5TJHA 3BKWA 3UOWA 3VTZA 5JCPA 3O4GA 4ILKA 3BF7A 3D2AA 1NKSA 3PRJA 3LPNA 5TT0A 1SVOA 5BO5A 3V32A 3C1OA 4WLEA 5EJ7A 3QQ5A 4C4YA 4RV5A 1KJQA 3R3WA 1WZIA 1INLA 3CLUD 4JJZA 3TGPA 3C5WP 3CF4G 2ZYVX 3CLTC 4WOPA 1TEZA 1G8SA 1T36B 1IYZA 2MWMA 2OV3A 5KHAA 5JBNA 4RV4A 5JRDS 3COJA 2GILA 1F0KA 2C5LA 2YQ5A 3DC2A 3G88A 1QVZA 4L3WA 4NJMA 5E3JA 2O2CA 3G68A 4DM7A 3H0EA 5JLJA 3Q88A 1W0KA 2CD9A 2QU7A 2OLKA 4MEAA 2RG1A 2VNSA 3E1KA 5ADUS 1ZD2P 2IU3A 3I1FA 2IWRA 2PBRA 3KUCA 1MAVA 2A0WA 1CUYA 1OROA 3B8HA 3IQFA 3KR1A 4KQJA 1KP2A 4XTRA 4LEIA 2H1VA 5EOVA 1EFPB 2H1SA 1UMBA 5T8KA 2CMDA 3V6LA 3NWJA 2C0PA 1XHFA 2PMFA 3A31A 4W5OA 3AF4A 1BH2A 4H77A 4RSMA 1Y1QA 3DC7A 1E5QA 4FLEA 4LZZA 4YFVA 5C5CA 5LP1A 2GX6A 4CIWA 1XPOA 2MSLA 3BXGA 1QG2A 2YS7A 3NORA 4R40A 1BWRA 1FLVA 4PPQA 5TGZA 4LXHA 3O9MA 1QHNA 4RD1A 1QIDA 1B4DA 1EVKA 2AE1A 3BRSA 4I5DA 4ZALA 4IL5A 1DIHA 2YJ3A 4KHPB 2ZATA 4QWWA 5FEMA 2EWWA 2RHDA 1IATA 3AESA 3ORYA 4XFJA 5JZ9A 1O6CA 1ZD3A 3AVYA 3DPSA 2Z2XA 5KNBH 1ZM4A 1T2UA 2IV3A 3WZLA 3VU0A 2HADA 4WKOA 7AT1A 1YBHA 1KQ3A 4NOJA 2DLNA 2JZOA 4JBNA 1BS9A 2CLSA 3TLYA 2H63A 4EK9A 4WERA 1P8JA 2PNJA 1RMQA 4GPIB 5GAJA 1Z0IA 1WMSA 2SKEA 3ER6A 3W5HA 3WLKX 1IRIA 3H2YA 4CMHA 4J94A 1G63A 3RIGA 1OH5A 4HEHA 2B9EA 4PVCA 5KDOA 2W6QA 5FLEX 1GAJA 4DDHA 1K4MA 1ZGAA 5E7QA 3U7RA 1SBQA 4OSPA 4A5OA 5M2QA 2B36A 1P2VA 1PZEA 3DYBA 2V7TA 3H16A 2H2IA 1Q0HA 1U2SA 1B42A 4S1PA 1ACLA 1ORHA 3PLNA 4XD7A 1L5HB 1GPUA 1ODKA 3OG9A 3PXAA 5GOZA 3LFTA 4HRVA 5IBPA 5AW2A 3MT7A 4D45A 4TYQA 4BKPA 4II2A 3ZGVA 4XLTA 1JJIA 4GBED 5IXSA 2IX3A 1KRXA 2R7MA 4WN9A 4ERXA 4CEIB 4JYBA 1LPNA 4P1ZA 3DAFA 3T52A 1T3SA 3VHRA 4KFRA 1SKYB 1XZJA 5DVZA 2VWPA 1JJBA 5EXSA 5JCZA 1EIZA 1URPA 2P41A 4XA8A 3G2IA 5FAKA 1VLMA 3LX5A 1XNQB 2C9BA 3LY9A 4UM9D 5BSKA 1CQWA 2EHJA 2V7BA 2WR8A 3TUZC 2VJKA 3FZYA 1EE2A 2B8NA 2VXOA 2FZLA 2WD8A 3FX2A 4ND8B 4YDHB 1LDMA 4HB0A 4BO7A 4QOHA 5B36A 3PDJA 3Q9NA 1UBSB 2GHTA 1QBKC 2XQIA 4QPZA 4EX7A 5JJCA 5E2IA 4L74A 3ADBA 1OXVA 4O2RA 3O3NB 4RL6A 2COEA 4TM8A 1RJFA 4PCVA 2Q6KA 3W79A 1W85A 3WL5A 2Q28A 1VL8A 4CM9D 5I5EA 5MFPA 1YTLA 4X00A 1XMPA 3HDQA 1UAYA 4MO2A 4MI3A 1ULAA 5BN1A 3UMYA 1JH9A 1WZ2A 1MIOA 2A67A 5THXA 4EH1A 3HI6A 1JILA 3EA0A 4KNVA 2CVFA 1FZTA 3NIBA 1NM5A 2AMVA 2CLDX 2CNLA 3ADKA 3MIIA 1JT9A 4PTLA 3WK8A 4B6FA 1TEXA 1O7JA 1CHNA 2C96A 2YXBA 4LYFA 1NIJA 4ZT7A 1IOZA 3LIPA 4V02A 3TDMA 1PGQA 1JIVA 1UDAA 2NTVA 2LNDA 2I3GA 1W5EA 1U7TA 6Q21A 3JYOA 5DHTA 2YL2A 2W4MA 3EX7C 1Q19A 3BIXA 2H7XA 3F2VA 3QX3A 2IBSA 4DXAA 2JFNA 5HM6A 3FNEA 1R50A 2J4DA 1UFOA 3N8NA 2I4LA 1F4PA 1B6TA 2QQEA 5EZYF 1THMA 1ZL2A 2RI1A 4HEQA 4Y0VA 3UHOA 2VL7A 1LDYA 2C54A 2V65A 3ESZA 3H5LA 1Q16A 4CIVA 3L0OA 3AUAA 3ESQA 3NWEA 1HI9A 4ESEA 1NF3A 3G1TA 1OPXA 4IGFA 3JPWA 2RONA 3RSGA 1UKZA 1M5RA 3IPXA 1R6VA 5A7GA 5JJBA 1ISMA 4MJXA 5BSMA 1O6ZA 1KO4A 2QM0A 3AYXB 1N36B 2GXSA 3OMWA 2WIJA 1D1SA 1CJKC 2G76A 2NW6A 3UK6A 3F5FA 4YLGA 3RYHA 4DJ5X 2JJ2D 2YWCA 3HDGA 4RFSB 2HGZA 3ZZNA 2FSVA 3OT1A 1W7AA 4JI6B 3DZCA 3ZWYA 3HBAA 1C7ZA 4RKWA 4JLJA 2B0CA 3SR3A 3AV0B 1V6SA 1U9IC 2JCVA 3QFFA 3JQ7A 4OH1A 4F2PA 3EPLA 2PEYA 1XZAA 2IXEA 1KVQA 2VYVD 4N5DA 1C1XA 3QLVA 1GL9B 1G6Q1 3OKAA 3TOXA 3NM6B 4W8GA 4B7CA 3OZCA 4DAEA 4Z4IA 2VK4A 2YVKA 2BGRA 1FPQA 2BFBA 1B41A 2BI8A 1F4VA 1HDXA 1ZH2A 2G3YA 2UZ4A 2I9KA 3NHLA 1SKBA 1PJRA 4J07A 1U0TA 3AF6A 3BCUA 1TNDA 5FUYA 1Q0UA 2FW7A 4P7JA 2GA9A 2P4EA 2WYUA 1PEDA 3WA7A 1YA8A 3PE3A 4JK3A 4N5MA 1OAOC 1IJEA 3L7YA 3P2EA 1DO0A 3GN1A 2P8JA 1F6BA 3NPAA 4QHTA 4Q9DA 4PFSA 3TR6A 5KYNA 1G20A 4I5GA 4KE7A 5CVCA 4N3BA 3B9PA 3KQMA 5JFGA 2HA2A 3N7UA 1SJ9A 2IZ6A 2GD2A 4O1IA 4LJ5A 4A2PA 4MQ6A 2C00A 1DL5A 2X7HA 4X1YB 1X19A 2GZSA 4KFUA 5DCYA 3FVRA 1E3IA 1W75A 4ZT2A 4WEQA 1VYVA 2Y1OA 2ZU6A 2QTFA 4YACA 1DADA 3HNPA 4ZAYA 1UWCA 4G6ZA 1BGWA 1SQ5A 2BF7A 4L3VA 4GE3A 4UDNA 1A95A 3PFBA 2XMDA 1RAFA 1R4ZA 4I2VA 1T5OA 4UBLA 4P0TA 1XEXA 4IDCA 4YMVA 2H2GA 5ERXA 1LS1A 1OAOA 4I4TF 1GU7A 4LKRA 4BNGA 5IABA 3HN6A 3DAHA 5TLSA 3EC2A 3UAZA 3ZDCA 4OGWA 3DZJA 2HAEA 3BT7A 1DLJA 4MGEA 4R01A 1U1EA 1NVTA 4Q4HA 3GWZA 4Y0NA 1QZTA 5DSTA 2KB0A 4U5QA 4XDHA 2QZZA 3VR2D 2JLRA 1SCQA 4DLNA 5B58T 1QLJA 5JXWA 2C3OA 3FYUA 2C57A 1A2OA 4LI0A 3LF2A 5H4GA 1PZMA 1RRFA 3HFJA 5GONF 3VX3A 4Y6OA 4DZTA 2AQ8A 2AN5A 5I6DA 3Q5EA 1HG0A 1R00A 4OHXA 4H35A 2Y8EA 1FP4B 1IEWA 1Q6YA 4H18A 3VU8A 3C7KA 4CMJA 3V1UA 3UGJA 1RSZA 2NP6A