4KR7A

Crystal structure of a 4-thiouridine synthetase - rna complex with bound atp
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
386
structure length
386
Chain Sequence
ELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/rna
molecule keywords Probable tRNA sulfurtransferase
total genus 119
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.8.1.4: tRNA uracil 4-sulfurtransferase.
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02568 ThiI Thiamine biosynthesis protein (ThiI)
A PF02926 THUMP THUMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 4kr7A01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kr7A02
1EUYA 1JECA 4MUFA 3CVWA 3KT0A 3TLJA 4HJXA 3LDGA 1QTQA 3FETA 1KP2A 3L93A 1IVSA 3CVVA 1MB2A 5J59A 4YMIA 4DDKA 3TZLA 2D54A 3BL5A 3CLSD 3FHJA 3P0HA 1MAUA 2TS1A 1WZ2A 3ILVA 3CLRC 2A1UA 4NDAA 1NI5A 1GN8A 4DE5A 1QJCA 3AG6A 1YIAA 1HYBA 4MAFA 3FY4A 4I6EA 2CT8A 2E21A 1OD6A 3Q10A 1R6TA 1M8JA 2J07A 1JHDA 1N2OA 4ZT4A 4JXZA 2HZ7A 1ILEA 3MUEA 2QJOA 3ND7A 3AL0C 4ARCA 1O94C 4EGAA 1MAWA 1TFUA 2GKSA 4PBRA 3F3MA 1MJHA 1NYLA 2EL7A 3I05A 1NUPA 2QTNA 3IOCA 4NATA 2CV2A 4MUJA 3VRHA 3P0IA 2E89A 3E27A 3KT3A 4U8HA 1I6MA 4XFDA 3OTWA 2A1TS 4CDMA 2NZ2A 4MW9A 3UOWA 4MWBA 3MLAA 1UFVA 2CSXA 1J1UA 1IH8A 2CV0A 1U0BB 5TEVA 1KAQA 1MB9A 2A84A 3K9WA 5J58A 1M8KA 2RD2A 4R2MA 4ND7A 5EKDA 4ZT7A 3AFHA 1NZJA 4R2LA 1O97C 1D2RA 1ZH0A 1U7DA 3FIUA 2CYCA 3NBAA 3TMAA 1DNPA 3H97A 3LOQA 2NSYA 1KR2A 1KORA 4MW0A 1M83A 3SDBA 1G8HA 3H9BA 1LI7A 3A05A 1B6TA 2AG6A 3IVXA 4MUGA 1JZQA 1OWLA 3IVGA 5BNZA 4EG6A 2DUMA 2ZUFA 1YIDA 3CLRD 4I6JA 2GOYA 3RBAA 1I6KA 2VTBB 4CT0A 2J5BA 1VBKA 2JA2A 4MWEA 3INNA 3ZUGA 2V0CA 3ZGZA 3CLUC 3N8HA 2A4MA 2X3FA 5IJXA 1VBNA 4PBSA 1QRTA 2PFSA 4MLPA 1JIIA 3CLSC 3A04A 1GLNA 3CA8A 3RFFA 3VU8A 4MUKA 1M8GA 2QJTA 1KH3A 1TQ8A 1M8FA 3UK2A 4NX2A 4ZT5A 1VLHA 5DASA 4DDMA 4NAHA 3AG5A 4ZT6A 3VGJA 1KP3A 2HMAA 3AKZA 3TQOA 1H1TA 4MVWA 1S4MA 4RPIA 1IQ0A 1O5TA 3NBKA 3CVXA 3PNBA 3IMEA 3C8ZA 1KQOA 1WJGA 2CYBA 2JANA 1J1ZA 4MUHA 5H7XA 1PFUA 4QBTA 3UMVA 1N2BA 4MUIA 2CFOA 4MW1A 1O0CA 4WNYA 1F7UA 1GZUA 2WB2A 1G8FA 1XNJA 3L92A 3UC5A 1EUQA 1OWNA 2O5RA 4F3RA 3IH5A 3A2KA 3UY4A 1VBMA 3CLTC 1F9AA 3D6UA 4MVXA 4H3SA 1G59A 1IQUA 3KFLA 3P52A 1XNHA 2CV1A 1R6XA 3GMIA 3X1MA 1MC1A 1R6UA 5K0TA 4AQ7A 1QRSA 1QRUA 1MOPA 1NP7A 5K0SA 1O95C 2H2AA 3H05A 3TNJA 3X1KA 2GM3A 3TM4A 1NUUA 4EG5A 3H99A 4EG7A 1BS2A 5LLTA 1TYCA 1EFPB 2QUJA 1X8XA 3COZA 3G59A 4WSOA 4MVCA 3QTBA 2IELA 3PNVA 3PXUA 1YUMA 3ZJTA 3MXTA 3LE8A 1XNGA 4RUKA 2JAXA 3CVYA 2WSIA 4Q16A 1F4LA 4MWCA 3G5AA 4L2IA 1JZSA 1N2JA 4KPUB 3TM5A 3RJZA 2DR2A 1CT9A 3COVA 3HL4A 4EFKA 1T6YA 1Y42X 1N2IA 3IOBA 4A91A 1O0BA 1EJ2A 3Q4GA 4JFAA 5DK4A 1U7XA 3LDUA 4EG8A 3GLVA 2D13A 1H3EA 2OQ2A 3ZIUA 1O96A 1OWMA 3S3TA 4ZCSA 2ZUEA 4YBRA 4MUNA 1KAMA 3N9IA 2O8VA 4I6GA 3SZ3A 1NSYA 1F7VA 4HPWA 3ZXSA 1GTSA 3MMXA 4E1AA 1G8GA 2CYAA 1OBCA 4G5YA 3QE4A 1VL2A 4K03A 2YWCA 4EG1A 4MW2A 1N2HA 1JEDA 2A1TR 1NUTA 1TYBE 4QRDA 4DDHA 3ZJUA 3FDXA 2WQ6A 2PG3A 2E18A 2BYTA 2J08A 4QREA 4X0EA 3LCJA 1EFVA 4L2IB 1LW7A 1JGTA 3CVUA 3TZEA 1QU2A 4UZEA 4EG3A 4OUDB 2XRZA 1T6XA 1EXDA 1ZH6A 2DLCX 1WKBA 1ULHA 4JZYA 4G6ZA 2EJCA 5J5AA 5KHAA 3NV7A 4EF6A 1P7PA 2DPLA 2QTMA 3IMCA 1J20A 4HK4A 3IUEA 3FG9A 2X1LA 3IODA 5TS2A 3ND5A 1KKUA 4DJAA 1J21A 3K32A 1KQNA 1YUNA 2A1UB 5KCMA 1IRXA 1K92A 1N75A 1NUQA 4U7JA 4UZFA 1IFXA 3KT6A 3FI0A 1NURA 1K4KA 2X0KA 3DV2A 3N2YA 3SYTA 1PG0A 4ZCTA 2VXOA 3V8VA 4MQ6A 4MW6A 3FWKA 5DB4A 4MW5A 1TYAE 1N78A 1I2DA 4ZCRA 3DO8A 4KKVA 4Q93A 2PZAA 3RHSA 2E0IA 1QNFA 1WXHA 4PY2A 4U63A 1OWOA 5KWVA 3HV0A 2QUKA 3PNYA 5LM3A 3JXEA 3IUBA 4KR9A 1WY5A 3COWA 3A4IA 4P2BA 3U1VA 2ZP1A 4R0NA 3DPIA 2X1MA 2XRYA 1H3NA 4GRIA 1EFPA 2PIDA 1OWPA 1ZJWA 1N77A 1O97D 2DEUA 1JIJA 4OUDA 1J09A 2VTBA 2QJFA 1XJQA 3HGMA 2A86A 3OP1A 1COZA 4KR6A 1WQ4A 4HJRA 1JMVA 1KH2A 2D5BA 3SP1A 3FOCA 2PZBA 4ARIA 1N2GA 4MUEA 4JXXA 1RQGA 3K0BA 3X1JA 4BWVA 2Z09A 3M5WA 4XSVA 2V0GA 3MLBA 1U3CA 1KQPA 1NUSA 1M1ZA 1WXEA 2H29A 5H16A 5FNZA 5HUJA 3G6KA 5DEOA 3AIIA 3HMQA 5FO1A 1OBHA 2Z3VA 3GUZA 4TS1A 3IOEA 2IP1A 4NZPA 1WXFA 3QTTA 5TEWA 3H9CA 1EE1A 2CUZA 5JBNA 3RK0A 2J4DA 4GU5A 1O94D 1V8FA 4KR7A 1JILA 1O6BA 1Q11A 3P0JA 3TS1A 1K4MA 3CLUD 1Q77A 1YULA 4ZCQA 4F4HA 4AS1A 2I1LA 1WXGA 1T9GR 1V47A 3SEQA 1MBZA 4ZT3A 2J09A 4FZJA 4OJMX 1Q15A 5IHXA 4CDNA 4J76A 2G36A 2DXIA 2QUHA 1N2EA 4MWDA 2A7XA 1I6LA 4K0RA 4ZT2A 3Q12A 5FO0A 1LI5A 1WOYA 1PFWA 2YY5A 3HZRA 2PXHA 1FFYA 1GAXA 1J70A 3D6VA 2QTRA 4ZCPA 3ZXIA 5AHWA 3IMGA 2WQ7A 1O95D 3SEZA 1WQ3A 1PFYA 3N05A 4G5FA 2BTEA 3IVCA 1N1DA 1SURA 4YP5A 2R5WA 1WXIA 4KPUA 4S1OA 4YP6A 2IJGX 5TGTA 3COYA 1IHOA 4MULA 3SZGA 3ELBA 2A88A 2Z08A 2AKEA 4JYZA 4MVYA 1FYDA 3ZJVA 1N3LA 4CQNA 1U3DA 1YI8A 2HGZA 3FH0A 5HG0A 3TQIA 4DNXA 2AZXA 1MRZA 3FNRA 4YP7A 2YXNA 3CLTD 1QU3A 2RE8A 1IQRA 1T9GS 1Q19A 2PZ8A 3RK1A 1KH1A 4MW4A 3KT8A 3V97A 4PBTA 1GTRA 1T6ZA 5HUHA 1X6VA 1PG2A 4DLPA 2B7LA 1GPMA 3IDFA 2QUIA 4NAUA 5F23A 1QQTA 4XFJA 1TYDE 3DLAA 1M8PA 1H3FA 3HFJA 2DETA 1PFVA 2YWBA 1JIKA 1JEEA 4EG4A 4ND6A 1ZUNA 3ND6A 4J75A 1A8HA 3ISJA 4MW7A 5LFAA 2DERA 3PRHA 2OV4A 1TEZA 3CR8A 1EFVB 1O96B 1K97A 2C5SA
chains in the Genus database with same CATH superfamily
3BEOA 5C3MA 4MUFA 2QAGA 2YHSA 3TBHA 1R9MA 2NZXA 3ESCA 3O1HB 4ED9A 1W6UA 1NF2A 4MDHA 4NZMA 4Z3OA 1Q7GA 1Y5IA 5KNLA 2EHJA 3U48A 2Z95A 3QA9A 3ON5A 2FSSA 4QOFA 4B4DA 2PMCA 1PGPA 4QGGA 3UT5B 2H4FA 4GWKA 4UTVA 3P0HA 4NCAA 1W0JA 3ZWWA 3V4ZA 5ARBA 3VO1A 3ZZMA 3GCWA 3M0EA 1C3JA 3W9UA 4P3KA 4G8JA 4BIMA 2NQ2C 2HCBA 5LP6A 3PJGA 5LP6C 1PV2A 4BRUA 1YIAA 4P4TA 5IBPA 1BGWA 1FUEA 1F6DA 2GFHA 2UAGA 2GJAA 2JARA 2WFLB 3GY0A 4I6EA 1XYYA 1HDCA 4MI3A 2Q28A 1DADA 2V7GA 2Y6VA 2BGGA 3Q8XB 3F46A 4OKNA 2VA9A 1R8JA 4YR9A 3ROPA 1WCWA 5GOZA 3DBRA 2AMJA 5ALVA 1NOKA 1W75A 4BNKA 1E92A 2YZNA 3G2HA 4GZMA 2I3GA 1YMVA 2FN7A 4M0CA 2HV8A 3TGWA 1E69A 2CBXA 1TLFA 3K1YA 4GXTA 3NH6A 4WKGA 2QJOA 1E5QA 3U16A 4Z99A 2QQEA 3ZTTA 1M1YA 1HMPA 2Y71A 1HG1A 5LD2B 1ZOLA 4MCAA 5E1OA 3EOAI 4ZVQA 2G9NA 3VVCA 1Z4IA 2DFTA 3GC6A 3GFGA 3IBCA 4UBOA 4GWLA 4D3XA 2ZVPX 1CUWA 3GJSA 3NDPA 5B58T 1G17A 3TEJA 2ERYA 4YJ2B 5KQMA 3SD7A 1WNFA 4QJ5A 1VLVA 3FUCA 4W9RA 1EZ4A 4R1NA 4E3WA 3E27A 3IQXA 2G6TA 2GHQA 1T36B 3OTQA 4QPNA 5CT6A 2ZANA 2X14A 4GZ5A 1W5SA 4YFVA 5GJCA 3DLHA 4AZ0A 4JA0A 4MMZB 4QOIA 1L8OA 1KWGA 1J0DA 2J67A 1M3SA 5FBRB 2JCXA 2Y1LA 1U0BB 2PJRA 1TO1E 2WDPA 1O6GA 4RJKA 3M83A 3GAMA 1CD5A 5IANA 1V8BA 1QTRA 1JLLB 2XMZA 1ORRA 1P45A 4KQFA 2A6PA 4MTLA 5KSYA 2XWPA 3P7MA 1T5LA 2P9ZA 2J0UA 3DONA 4P35A 2OK8A 3DQZA 4FLEA 4O4JB 4AZVA 4XWKA 3NWPA 3HWSA 3G6WA 1IK6A 1KKLA 1WB5A 1N5RA 4RKQA 3UHOA 4A03A 1V95A 3M3PA 2CLLB 4B3RB 2BEWA 1M33A 3A14A 3CZCA 3DDOA 3E7DA 3I6MA 1N5IA 4KR2A 4PNHA 1W5TA 4O2BB 5FBZA 4LX8A 1ESEA 4EG6A 1YIDA 1SCBA 4DUPA 1DWQA 1CZUA 5J2TB 1NGSA 4EABA 1EHCA 4MP6A 4KH1A 1FY2A 3QV2A 3PHBE 3S8EA 1LS1A 3K0AA 4CT0A 3FR8A 3EXFA 5TQ0A 2IBTA 2B94A 3LQ2A 2MINA 1VCOA 1BJKA 1SPXA 1LB1B 5FBVB 2WLTA 2X42A 2BKUA 4MVJP 1CYDA 2BFDA 3KKPA 3R6GA 4UBKA 4AYXA 2PFSA 3KPYA 1B42A 1CJUC 1T0IA 1BEUB 2JD0A 4XOUA 4KXLA 3DLPX 1UEIA 3AX6A 5L9AA 3AEUB 1IHYA 1YVDA 2BH2A 4IGEA 5A3SA 3M5PA 4N4AA 4U2CA 1KBQA 3EQ8A 3RT7A 1BOFA 3I2IA 3ZQJA 2IY8A 4KXUA 3G9QA 3KXIA 2O2YA 5HCIA 2VDMB 1QIEA 2G4CA 1LPBB 2PRJA 2YCBA 4FZRA 1J2UA 4OFWA 3U0VA 3VYSB 1TGYA 4PTLA 3IXLA 1EUCA 2XYVA 4P98A 1Z35A 4KITB 1ZM2A 2HX1A 3I8SA 1MA3A 1LV8A 3E9RA 1OR8A 1FYFA 2FKAA 2Z30A 4ZGGA 1XCJA 2NUPA 2VH2A 4BX8A 3FPGA 3VGPA 2YWRA 5CEFA 3AKZA 5DH9A 1UBLS 3BMQA 3HWWA 4HX5A 1BKYA 4PSDA 5DOZA 4M4SA 3S2IA 4HWTA 4EVIA 2VHZA 2WG2A 3AHGA 2Q0SA 4PTYA 4HWSA 4XDGA 5EERA 4AJLA 1AO0A 5TB5A 4JJFA 2YFYA 4OP2A 3ADCA 1J1ZA 1DXYA 1VJRA 2QU7A 2X15A 2I4IA 3P9RA 4N5DA 1K98A 1N2BA 1RQ2A 2IYTA 4R01A 3I1YA 3L6DA 4GUDA 4ZVPA 3TNFA 5ALUA 4HZUA 5DHQA 1U94A 1X7HA 1BX3A 4FR2A 4ND5A 3KE8A 2PTHA 3V4VB 4KXVA 3FTEA 1SK9A 3T9CA 1QPBA 4KBYA 2HCRA 1ZD8A 3B70A 3FPAA 4LK3A 2WT4A 1Z5NA 2EF1A 3CB2A 3DBHB 2IYZA 3PNOA 2C1ZA 3QFSA 4OATA 4UUMA 4DPMA 1PD0A 3GQVA 4NABA 1IZZA 3AUSA 4WXPA 3SHOA 2SCUA 2AA3A 1VG8A 4KOAA 3MWGA 5BQFA 1Z9BA 3B5IA 2HT1A 3E1KA 3IV6A 4CKEA 4ROTA 1H0HA 2Z2IA 5C1PA 1ADFA 1NMXA 1EVLA 4N5LA 3I01A 3MRSA 4BLPA 4EFLA 1WBDA 3W3AD 4I1IA 4CGYA 2GRJA 1D9XA 1K2VN 1NQOA 4DLUA 1B3BA 1E3QA 1NUUA 3LOUA 4R3NA 3D8NA 1XVAA 3B60A 1T43A 1SCDA 2H52A 3HBNA 4QIHA 5TVGA 2ZJ3A 4FGSA 3D02A 1NBMD 1FNCA 1E8NA 3DOCA 1N4DA 1XAJA 2AHRA 4R8VA 5ISMA 5H3HA 1GTJ1 1Z6YA 3M49A 4LF5B 4AUNA 3QTBA 1SNYA 1J2EA 4I1YA 1S96A 4H4CA 4LJLA 4YO7A 4AIRA 2QAGB 4FYKA 3ANTA 4D99A 4ENRA 1OHHA 2VK8A 2HSEA 2BKXA 5LP1A 5K03A 3IURA 2SKDA 4G1VA 1JLRA 4Q16A 4W7IA 4XLZA 5D3QA 5FLYA 4GECA 5CA0F 3KXLA 1QGYA 5FFNA 4DLVA 5KQPA 4RADA 4URXR 5BR1A 1GRNA 1T9BA 3PC6A 3B7GA 4LJ9A 7MHTA 2DF8A 5YASA 3WOVA 1W4BA 2DR2A 3OOWA 5A1JA 3EXHA 3F7MA 3H9JA 3VR3D 2PCJA 5LB2A 1C8VB 3D4LA 4PZUA 1P81A 1SWWA 4DCNA 3QX7A 4TV8B 4X6YA 1IY8A 1KSGA 1TJ5A 1RKXA 4RF3A 5CLQA 1N7IA 4HH1A 2W2QA 2IYPA 4LHSA 3IEMA 3T5CA 1VIMA 1UKAA 4J1QA 1Q3TA 3GJ0A 4TLCA 3ZI0A 3AEXA 3PF8A 1NY5A 4QO8A 3TLAA 4CL0A 1KARA 4UARA 5E8JA 1DMRA 3R24A 4GI1A 1MX1A 4P0TA 1B8VA 2XLBA 4H0NA 4EH1A 3I5UA 1Q20A 2HTEA 1GL7A 2RKBA 3AZPA 3RYHA 3ZD8A 4EHHA 1FK8A 2HQBA 3WK7A 1X0XA 3S28A 1KF0A 4I6GA 3D59A 2IX3A 1T34A 4J0HA 1FNBA 3D4PA 3SIWA 3SZLA 2PYZA 5LL6P 4L9SA 1RI1A 4J1TA 4KQ1A 1GTSA 3DE5X 2B5VA 3KEMA 5AD1A 2MR6A 4CLRA 1BE6A 4P31A 4MROA 2GVNA 3I42A 1BDBA 3ABZA 2IS4A 5FA5A 4YJ2A 3D81A 2CNWD 2V7BA 3ZN2A 4AF7A 1TTQB 2NO5A 2X1VA 1TJYA 1SUBA 2P9JA 1VPVA 1WD5A 2AOUB 2HXYA 4X1IB 2JI7A 1FTGA 5JAUA 4HN2A 3FROA 1SH7A 1W87A 4X0EA 4ETIA 3M4XA 1QKKA 1GYRA 3A9VA 3QMMA 4JUFA 4UBJA 3ZHUA 1VCMA 2FZWA 1SBCA 5KVAA 2NG1A 4EG3A 4RTKA 1ACMA 2DLCX 3GLFE 4LGCA 4LJAA 1A5ZA 3DULA 3LCCA 4RK7A 5ESWA 5LLSA 1XMVA 4R7TA 5K7SA 3H6GA 5CB4A 4R4JA 3LCMA 1B15A 4QASA 1M5RA 2IEGA 1RTTA 2B4KA 2WNHA 1DWUA 1FOEB 4CIAA 5IF9A 5AVRA 1EP1B 4YJGB 1JBKA 3VAYA 1DEKA 2CUKA 2ID8A 4TS3A 4XWGA 2HU7A 3GJQA 3UT0A 4EPVA 4A8JA 5D5QA 1UDXA 1GCAA 2IH4A 4IIBA 2IOFA 4AJOA 5FCDA 3N87A 4XWTA 1XR3A 2IIBA 2JBHA 3AERA 4GICA 5D3MA 1VHQA 1TTPB 2IDMA 3QVTA 1GYPA 4KO8A 1T15A 1VRVA 2AG1A 4HQRA 4PVDA 3RYFA 1CF2O 4EI9A 2D62A 4BNTA 2FPOA 5BUCA 1U0SY 3VYUB 3IO5A 1NJ2A 2ISSD 3C6XA 2I62A 4KACA 2JK0A 2GTIA 3SYTA 4BO1A 1T1GA 1N6HA 3ERCA 3HJFA 2LKCA 2RBEA 3QEMA 5IAKA 1WDKA 2P2YA 4N1AA 5ED0A 2HGSA 3MINA 1EWRA 1FYVA 3MTGA 1RC8A 2ZE5A 5FQOA 2XODA 1H69A 2X4GA 3IJ5A 4FINA 4BRZA 4W5WA 5AUNB 2YH2A 4KE6A 4HDSB 3NOVA 3A4IA 1RIFA 3FMGA 2ZP1A 2ZR9A 3HKBA 4L3VA 2DUNA 1Z5GA 4UAVA 5H3LA 4CV1A 5E4TA 1IHDA 2R6GA 3SQMA 4B3SB 4JI7B 4AW9A 3HB0A 4D46A 1UK6A 4UATA 2FR0A 4IIXA 1M54A 1JEJA 3CKMA 5EIOA 3R3UA 2GLXA 5ALQA 1M6VB 4MVJM 4Z0TA 3OLYA 1KDPA 4GI5A 1DKUA 1JEAA 1L5WA 2R1ZA 3LVFO 3OIFA 4G2NA 4LGYA 4EO7A 4LJYA 4HJRA 1BKDR 1E4OA 1XHFA 4HF7A 2J0QA 3RS3A 1W5FA 2QN9A 5B2ZA 3SQDA 1B93A 5I7AA 3C4QA 3KALA 4JC5A 3NAQA 4JT4A 2INGX 5K8CA 4TZ6A 1LZLA 3MUOA 2ERXA 2RAUA 5IKPA 3N8NA 5DK6A 2IS1A 4RVHA 1Q16A 3T7AA 3A32A 1TVKB 2G9UA 4D6PA 4JI0B 3EARA 2OV2A 2W5UA 2CLFB 3C8HA 1RE1A 4WINA 5FNZA 4BQPA 4E88A 2OCGA 3DMRA 4C6TB 1Z0ZA 3JQ9A 2HNKA 1HQCA 1LJLA 2AN5A 2Z3VA 5CCDA 3DGEC 2IHYA 4W5NA 3ZDQA 2GBPA 1C7RA 4M7PA 4DBVO 5F9FA 4HZUB 4BLTA 4LMRA 4P36A 3FZEA 4TPKA 2PZKA 4EJ0A 1DKLA 2AW3A 4QXQA 1Z0AA 2YY6A 4DVJA 2GFQA 2J32A 2P8JA 4L0MA 2HBZA 3QHAA 3E22A 3RK0A 1SIBE 2DQZA 1WP9A 5AVJA 3RJ9A 1TIBA 2ZUUA 1FW8A 2A5YB 1RT9A 2QE7A 3BRSA 3DBHA 4M7RA 4C89A 3QQPA 5IZCC 3PEWA 3ETDA 2BGTA 1RAFA 2AUTA 3VO2A 3GPBA 2QE6A 2C2ZA 1ZUHA 4B5LA 2ZWAA 2MT9A 1UXIA 1X8JA 2QPTA 3EAGA 3OPVA 4K05A 5TJ9A 1F1BA 2C5FA 1RWQA 4G1EB 1EYZA 1SC4A 1EJ0A 4TRNA 5D7BA 2D0DA 2VJAA 2FW8A 4EB8A 4B4OA 2EKZA 2J0VA 4OYLA 3KQNA 5FB3A 3AEZA 2QMEA 4P3XA 1GGKA 2NIPA 3QKTA 1XROA 4AJ4A 4H31A 5K8UA 1SEPA 3R44A 1T9GR 2RI1A 3BHJA 5A62A 5JXWA 3BK7A 7ADHA 4OA8A 4ZT3A 3EA4A 1VA5A 2GILA 3DQPA 4J03A 1D3AA 1SXJE 2CDNA 2H6EA 1N6RA 4NOKA 3PR3A 2QUHA 4RY0A 3TE7A 4WZAA 3W5CA 3KR9A 1Q1GA 2RHHA 2X1HA 5JRZA 2PXHA 3VVMA 2NU7B 2QIOA 4AJIA 4L74A 2QTRA 1QFZA 2W42A 3WIDA 4I9FA 2GN4A 3D6AA 5AM4A 2WQ7A 2ZTSA 3OZIA 3AVTA 1YSCA 3KZNA 3L0ZA 3CZMA 3N05A 3PCTA 4L15A 4QFDA 2FJPA 4RCVA 2B69A 3O8QA 1FFEA 4Z8YA 1SCNE 4BVAA 4Q19A 4UM9D 3UMJA 1V8DA 3B3AA 1M0SA 4LYHA 1XRNA 1P6XA 2RGNC 2VA8A 4ALJA 1EXVA 4DLBA 5C5DA 4MULA 2LVBA 2YN0A 2NLOA 2WJ3A 5B3KA 1PV4A 2PX4A 3OCZA 2FPUA 1O8CA 5IJ0B 4MPRA 4LTDA 4PC2A 3B9BA 3EIOA 3UMRA 1HGXA 1O8BA 1R6AA 2J3KA 2YINC 2WHXA 2GJSA 1EM8B 1Z2NX 3H11A 3WIBA 2QD5A 4O29A 1IU9A 2CXQA 1JTEA 2PGLA 1DWOA 3KT8A 2F7SA 1F4PA 1ZKMA 1N6LA 2OO7A 2P8SA 1G4HA 4XEHA 2EJBA 1JG2A 1RLMA 1ORIA 1X6VA 2ECPA 2JF0A 4X9XA 4F85A 3EXFB 2ZPTX 3AF4A 3OPYA 4IV8A 3O7MA 1SY7A 1BROA 3EDOA 4ASUA 3WQRA 1Z0JA 3OEED 1CTQA 1ESNA 4OXIA 3VO9A 2DETA 2EWMA 1J8FA 4HSEA 1TUBB 4RGBA 2R8PA 1U3UA 2C4MA 3AI7A 3DAFA 3IBYA 3DZHA 5CH5A 5AJXA 1U2TA 1CUZA 4BMVA 2ZBGA 3BMCB 5BWLA 1ZM9A 3QEJA 2H1HA 1NQ5A 1X42A 2R8OA 2XMDA 5J3JA 1G291 1D8TA 1PJZA 3A28A 3DTYA 2IY7A 4JBIA 1LLFA 1YB1A 2D4AA 4B31A 2WF7A 4H3KB 1E4EA 5DWDA 1RYMA 1QF6A 4LAFA 3A0RB 3H2IA 2XNSA 4NOMA 5FORA 2V65A 1XRLA 1HDGO 4Z4CA 3IBFA 4IZHA 5LOVA 4ND2A 3C39A 2F55A 3UV7A 3DE4X 3CNHA 5H4GA 2FPKA 2IYNA 1XT6A 3F8TA 1JEQB 2OXEA 3VHRA 4B17A 2AT1A 3FHJA 2PSDA 1O57A 2FFRA 3PP8A 2W2LD 2IBSA 3QPWA 1B43A 5JIBA 2F8TA 3MLEA 4INPA 3ILVA 1AK9A 1KO4A 1PLKA 1XTKA 2IUYA 3ICVA 3LUGA 1U7WA 2QVLA 4RA6B 5FPSA 1FFAA 3JYNA 5EC8A 3EQ9A 3K3PA 1X9GA 3P94A 3L6CA 5AJVB 5B30A 2C8JA 1W94A 1Y9EA 2H9IA 2WM8A 3L7KA 3OM9A 3PCRB 2GF0A 4W8GA 3V7UA 1BMDA 1LX7A 1UKCA 2PS0A 2X2EA 5LQAA 1KI4A 2ESRA 5BV0A 1RXSA 1IY9A 3T1HB 3QM1A 1MA0A 1VPDA 1U5AA 4QATA 2Y0DA 1LLQA 2SCUB 3RABA 4PC1A 4MYSA 2ZWPA 4Q4AB 2JI8A 2ZE8A 1Z8HA 3CEAA 3CU5A 5SZJA 3SQOA 1NBIA 1XQ9A 2XVAA 1M5UA 4CKEB 2C5LA 4KSCA 3ZCVA 1TFUA 3WZ2A 1IEWA 2A8YA 4HSGA 4RZIA 4Q9NA 4RULA 2W7TA 4TYQA 1NUPA 2QVCA 3CBGA 2VSOA 1PT6A 4Q03A 4QUIA 5B4TA 4DUZB 1OIXA 2L42A 3I04A 4H17A 3F5DA 5JAPA 4BQFA 1JHYA 3LY8A 2DKOA 3S2ZA 3ZCXA 4KMMA 5F7XA 4F5EA 3L84A 1DAPA 4Q4LA 1VKHA 1MGOA 3RG2A 1HDOA 2I34A 2CE2X 4RSGA 1M6VA 4XB2A 3ZTWA 2JFPA 4MWBA 4QA9A 1CUDA 3MSCA 2GESA 3U80A 1JB9A 1H5QA 1N7GA 1W8DA 2C3UA 2HEIA 2CXOA 2AKYA 3R0XA 2QTTA 3DAPA 3SOZA 1CUFA 2P40A 3A9SA 1EVYA 5F4ZA 3LIPA 4DOMA 2XGJA 3JSAA 3HGTA 4LI0A 2X6TA 4X7MA 2CSUA 3PGMA 1C3OA 5CM2Z 1V7PC 3SC2B 2AJ8A 4L5YA 3N8KA 2Q5QA 1EUDB 4X20A 4R31A 5AW0A 5TDHA 1ELOA 2AD5A 3FIJA 3RFVA 3TMAA 3LHSA 1WBBA 3Q2KA 3FDZA 4KE8A 5A0TA 4P5DA 2ZJOA 3CNEA 3H9BA 3PFFA 3S29A 4BFWA 2LXNA 5ALTA 4C5BA 4NONA 2N46A 3DJFA 2G1KA 4YWHA 5C31A 1BD3A 4ARZA 1D09A 2ZUFA 2WP0A 5ULLA 3UGTA 3BJMA 2NTEA 4A2QA 3I2GA 1IB0A 2J3QA 4XASA 1GAJA 2CLSA 1YBHA 3F8WA 2IYYA 2QY9A 4Z4FA 4G1FA 2IDZA 3TSAA 4E5MA 5I47A 2QRMA 2Q9CA 3DTVA 3WGUA 2PZMA 3BEDA 1ZUD1 3KEOA 4J0KA 5CB4F 3BERA 3IUYA 5K3FB 2VBCA 5JSZA 3BIOA 2QLBA 2IW3A 1H8HD 3VU3A 4EJ2A 5IW8A 2RH9B 4V39A 3TZCA 4HGNA 2V3CC 3C5CA 4K9MA 4ZVKA 3VZPA 5A5EA 3T7EA 1M2OA 3GPDG 2BGKA 3QX8A 4B74A 1U2QA 3HXMA 3TZKA 5FNVB 2P9HA 2CHUA 1ZIXA 2M6SA 3NJ4A 2JFNA 3GFTA 3JR3A 4H16A 3EGDB 4YRDA 4C0BA 2PVPA 4J94A 2DT8A 1VJ1A 2CE7A 4U3JB 5A6SA 4KXXA 4IW3B 4B73A 1TJ3A 4ZXFA 4PHTA 3DZCA 3S1AA 2HWKA 3PR1A 3VTFA 3ZCTA 2C4NA 2EQAA 3NWOA 4J0GA 1NW4A 1BSVA 1Q1NA 4MVWA 5J2UB 3WK6A 3ZX4A 5AJYA 5D86A 2H2IA 4NYIR 1XLUA 1SIUA 3IA7A 4LUCA 3WJ7A 2GS9A 1H6AA 4I8DA 1DTWB 3BKWA 3KUXA 1XQ1A 3L6UA 4FJ1A 1FQOA 2XUZA 5ALYA 1P73A 1XLWA 3EXIA 3OCYA 4MIYA 1V1MB 1PD1A 4CWAA 2FQWA 4D7AA 2VF4X 4PRLA 2D2IA 3BFPA 3E3AA 2P9FA 3OT1A 4BP1A 1WR8A 5FPHA 1P1KA 1CG6A 1N9ZA 2RKWA 3KCNA 4WNYA 3EGEA 2FPSA 5G4KB 3O93A 1XMOB 2EFEB 3OECA 2VSYA 3NHJA 1YO6A 3LUFA 2PGXA 3LX5A 4NFLA 2JHGA 5LUBA 2QSJA 3QG5A 3SHVA 1L1EA 3CE9A 3UY4A 2AFRA 4IDNA 4FWIB 1EM8A 5CLLA 2CXPA 4F1WA 2GF9A 1OH8A 5JPCA 5CRIA 1J8VA 1ZQ1A 1JU3A 1H2BA 2W8ZA 3GYGA 2CD9A 4OLFA 3W4JA 1SD1A 2R4UA 2J1LA 4DA0A 1SC1A 3FTCA 3QP9A 4I5DA 5IT9A 1Y8QA 4K9PA 2WVHA 3DL0A 5JY6A 4WJLA 2ZIEA 5SZIA 1R6UA 5CVVA 2FYTA 4B44A 4ZKDA 2L17A 5G3YA 4UW9A 4AQ7A 4MZXA 1NP7A 2PD3A 2ORYA 1O95C 2GCGA 3A4TA 5PGMA 4KLNA 3AY0A 1A8UA 4ZVMA 2BZGA 1NF3A 2DPYA 4J91A 4U7GA 3RVNA 4MMXB 4YP0A 3JAWA 1I13A 1KJWA 1YQDA 4TWIA 1OLXB 4YJ2F 1NP6A 4JJ8A 5JO9A 3UHAA 3WQSB 4YV2A 5JXJA 5KZMB 2OCXA 3RYCA 3N2KA 4EEKA 3UCFA 3AFOA 1T35A 5CT5A 4TMFA 4B6QA 2CNNA 3JWHA 4EHDA 2IELA 4FUQA 1W73A 4D0RA 1KXZA 2D4HA 4FFPA 4Q1BA 4EKEA 1FBTA 2VDQB 4LISA 1QIDA 1VMDA 2HRDA 4I9GA 4O2RA 2XB8A 5CIQA 1U2RA 3TXXA 2GXQA 1RYZA 4B3IA 3FCXA 4BFVA 1QORA 2P9TA 2NSHA 2VDOB 2FFJA 4KPUB 4EHNA 1G16A 4OQEA 1YJ5A 2WSMA 1I33A 2BSXA 1N57A 1XPJA 4DM4A 3T1TA 3A9RA 4F72A 2YV4A 2FZ5A 1ZVJA 3KJEA 2GXUA 3LXMA 4YR7A 1N2IA 3BOSA 4RESA 5CVEA 1S7GA 4JOQA 1P9OA 4EKIA 1D2HA 4G1MB 1P9WA 2W90A 4Y3UA 1H4SA 1SVUA 1Q0QA 1XHLA 8AT1A 2XGMA 2VQSA 3OOJA 4J9VA 1R10A 3A3YA 3L8YA 4KQKA 5CXSA 4CF5A 4L9AA 1PZHA 4EW6A 3DPUA 5U1PA 4XDZA 2P5TB 1NQWA 5CYGA 1QGZA 1V39A 3WGKA 3WXMA 1EA7A 2MSNA 3BXGA 5CT8A 3U60B 2CNOA 2C99A 4MLCA 3SJCA 3VZRA 2V54A 4QPCA 2ZS8A 4KJZA 4ITRC 1CIVA 5FULA 3DVLA 4PG7A 3J7AC 2QD3A 3L0DA 4KDRA 1UODA 2PQ2A 3MMXA 2NZUG 4LCBA 3H1AA 2UXBB 3RYIA 1QYRA 221PA 3CZ9A 4PQFA 1DG3A 5JZVA 3BXPA 1PHPA 3TPCA 4X66B 1VL2A 2Z1MA 1MEEA 2ZSHA 3HQ4O 5DNVA 5IT5A 1IONA 3ZWXA 5D1NA 2JIZA 2Z2ZA 1R0ZA 1VGRA 2WICA 4ZAYA 3RWOA 1B0AA 4D9MA 1TCCA 3LQ1A 1K7YA 3MSXA 4Y9TA 1LW7A 4FB4A 2EX4A 5JZ9A 1EK1A 3UK7A 2PMEA 4E5VA 3DOIA 2I7CA 4HLDA 2IZ0A 1JR3D 5K0ZA 1FDSA 1V7ZA 2WILA 3IPCA 2YOFA 4NBTA 4OI0A 1KMHB 3B85A 3Q3JB 2B4RO 1MQSA 1SZDA 4M0UA 2IOQA 5BOSA 1IUKA 3QLUC 3GGDA 1JIUA 1ZU4A 4RPGA 4G1CA 4JYPA 4B4KA 3ZLBA 1NULA 4C29A 5CH3A 3LKDA 4GE3A 1X8LA 3IUEA 3FG9A 5CJ2A 3KWMA 1D2CA 1TCUA 5HR5A 5CU7A 3KKEA 5KTSA 4XQEA 1XPOA 4JQYA 2PT9A 3SR0A 4B0OA 4EELA 4QOGA 4WJKB 3DR3A 3R7NA 4CEJA 2O5CA 4PFKA 1QTNA 1EU1A 1FVOA 3NTLA 4A0QA 1YMUA 3U4QA 4DC0A 1YZYA 1GVNB 4BP8A 4CHGA 1QYIA 1CB0A 1FFXB 3DNPA 4MYTA 5KOIA 3G8CA 4QGHA 4N8SA 4BNNA 2C7GA 1VJCA 3HDVA 2PKQO 3KTAB 3UWSA 4RZQA 3CNNA 1DV1A 3T5GA 2C7RA 1MX9A 2XUDA 4UTPA 1TZMA 4LFBB 1OX4B 2EJVA 3FJ1A 3MAJA 1J22A 5CG2A 2O5EA 3Q1KA 3T3MB 4BPRA 1FUKA 5LM3A 2NN3C 3JXEA 4FD2A 4P2BA 1AV7A 4LWQA 1PVOA 3U39A 2EX1A 2JS7A 3VR3A 1XAHA 1H3NA 2I7TA 5THXA 3U9SA 5KKCA 3LWNA 3PQ4A 4N3CA 4HQNA 5E0OA 2DH6A 2GYVA 1O97D 1RYNA 3F7OA 2VAXA 2I22A 3FNIA 5EFOA 5B7QA 3JQFA 4R9RA 1E3WA 3JRNA 1UP6A 3U7GA 1T36A 4GT1A 2XVXA 3OP1A 2R44A 1G5FA 1RZRA 1TM4E 1WO8A 4UNPA 1MAHA 4WHMA 1GPNA 3R0ZA 1NU6A 1U8ZA 1IM2A 1XQVA 2ZRQA 3JQ7A 3N7AA 4URWR 4X1KB 2VXYA 4ARIA 1YL6A 4BMOB 1DO8A 4JSYA 1NONA 4GQAA 3BJIC 4PRYA 3T5BA 1XYVA 3QNMA 3FTPA 1UKZA 1HQDA 1WVGA 2KBFA 1U3CA 1WUJS 2HIHA 3OE7A 5B57C 5LOVB 4DA4A 1LTHR 2ZRIA 2OG2A 4LRWA 4EKNB 4WTOA 1JEQA 6CHYA 3OEEA 3V1TC 4RPLA 1KA9H 2RIPA 4II3A 3ZWYA 1IBRA 4M9ZA 1YQWA 1ZL0A 2D7CA 2BHNA 3GLFA 3HK2A 3K1JA 2KLBA 4WVLA 4MUMA 1ZVQA 5JAIA 3H9CA 3MWEA 1G60A 2J4DA 1Y3FE 2BEWB 1Z39A 2Z9CA 3B6JA 1LK5A 3FF4A 4CLEA 5I7RA 5LMZA 1D4OA 1N9KA 4YJKA 3AZOA 4Q48A 4KQCA 1ZK2A 4PPGA 4NF2A 3M4JA 2DJIA 1CJVC 3N0VA 3MJHA 2NU6A 2PDAA 4BB5A 3IX7A 1P7ZA 3M70A 1V11A 3PWTA 4W5HA 2QQ0A 2JIRA 4HPXB 1OUMA 1ZS9A 3BRWA 3QF4A 4TYMA 4D57A 4XGKA 3NXSA 2OA0A 4YAKA 2WUWE 1ULUA 4EYGA 1MN6A 1E7QA 4E2YA 3PPYA 1BH2A 4ENVA 5FAKA 3IB3A 1M9NA 4PLZA 1OXMA 2BFPA 2DBZA 5TPWA 2RI0A 5AXBA 5H82A 4J76A 3K7EA 3LUKA 3OPXA 5HYVA 1AU9A 2V9CA 1IHPA 1UOQA 1G6KA 1YDWA 2XIJA 2NM0A 4DYHA 5BN4B 1NLMA 5M5BA 2XHEA 3K2IA 3PFWO 3LUPA 3PT5A 3ZE1B 3OU6A 4P86A 3VU1A 3ZXYA 1GAXA 3D8RA 5L3ZA 2RHTA 2XA1A 4IO1A 4M1KA 3SMVA 1Q3HA 3EBPA 3R5TA 1PW5A 3AI3A 3O2NA 3M9WA 2XYPA 4LXGA 1SBTA 1RM0A 3VKGA 3NIWA 4C6HA 4LX0A 3GZ4A 4R8MA 3ZDBA 2B9VA 4R05A 4J0EA 4KPUA 3FPSA 2KMLA 4H1WA 2WRZA 2GEJA 2QVZX 2BH9A 2JRCA 1ODFA 2IUEA 4RSHA 4AM8A 3OQOA 4BQSA 3L01A 3T4UA 3GRCA 1NV8A 1FUYB 2HRBA 4TMXA 3A26A 5CW1A 5P8WA 3UCXA 3L4JA 2F64A 4FC7A 1GEEA 2ZJ4A 4U2GA 4ZICA 2REXB 5DM2A 3IR6A 3ZW8A 2GJKA 4Q9KA 4DA6A 5KTTA 3ANYB 3OM1A 2XQKA 2ZTUA 2H57A 1V8ZA 5U9CA 1YS1X 4PGHA 5AW9A 2GD6A 1GCIA 4F2HA 1B4DA 3RSQA 1KY2A 1T9GS 2ZATA 2WJVA 3KLOA 1W581 1Z2AA 4GF5A 16PKA 2A35A 1JAZA 4U9HS 2PVCA 3ZBQA 4XPIB 3P2JA 3EQ6A 3R9KA 1TU3A 4ZJUA 2RGRA 1PG2A 1P1BA 3EY4A 4WX2B 1SD2A 2R1VA 3O84A 1XTUA 4MUYA 3VPXA 3ZEAA 3B3QA 3QELB 3DBRB 1AIPA 1G3QA 2GCNA 2JVIA 2Z5FA 3LVRE 3MN1A 4XB6B 3TQQA 3EPLA 1JDPA 1O1YA 2ACKA 3HABA 3MWJA 4TL7A 5L6MB 3U2QA 4KIGA 1XNQB 2DJ5A 3I0NA 5TX7A 4CNBA 5DBIA 2C57A 3UCEA 4GL2A 1QVWA 1AUXA 3HB4X 2BJVA 3T5PA 3GEMA 2F3TA 1YGPA 4G36A 4Y2QA 4AD8A 4G5HA 1OA0A 4YJHA 3HCNA 1N2SA 3I28A 4EI7A 5GIPE 2CKMA 4L16A 3V1NA 4E09A 4WIAA 2UZ4A 4JL6A 4JYBA 4RENA 2RG1A 1JXQA 4RZHA 5T41A 5LJLA 3E15A 3ZX5A 1P61B 3G8BA 2PH3A 4XOIA 2VDVE 2W71A 4J9UE 2LIPA 3KJFA 2VDLB 1KO7A 2BGLA 1RP7A 3GUVA 5AVZA 3TN7A 4TT3D 4QTXA 2H4ZA 3NIFB 1T1EA 2VDPB 3A3PA 4IH4A 2GERA 4NJEA 2V4ZA 1DFIA 5ES3A 2OLKA 1KOLA 5GJBA 5JD4A 1U28C 1NQVA 3RJ5A 3JVVA 4PZYA 3IAHA 5DYGA 1Y34E 2EFYA 2ZTVA 5H59A 3SVZA 1IN8A 3ZV3A 3NWJA 4G41A 4Q3AA 5JS7A 3WGTA 5BPFA 3KTOA 2I7DA 3HUDA 3SQNA 2VOJA 2CWDA 1P0CA 1P9NA 2FOXA 2BMVA 2RAPA 2NPIA 3AHHA 1TIPA 1XRQA 1GN8A 3ANXA 3OOSA 2Z58A 4H7IA 3G9XA 4TM8A 5B58C 1LPSA 5BMVF 1Z4OA 1OB5A 1T3HA 3LWZA 3SR4A 4RZ2A 1AO3A 4H1UA 5HKAA 4ZOQI 4NEHB 5JCZA 1YGYA 3A2LA 1NM5A 2Z6AA 4PG5A 5CNJA 2DUUA 2D8MA 1G8JA 3OO1A 5CAEA 1H2ZA 5HZKA 2ZJ8A 1R8XA 4O2BA 4XJTA 3IB6A 1JHDA 3G2MA 4XCVA 2B2XA 2ZKIA 1ISMA 2GK6A 4ZT4A 1EMDA 2E7ZA 2YDYA 2RAFA 1EZ1A 3A1FA 3GLUA 3I9V1 3L4BA 2A0XA 4ZOEA 2MCFA 2FDRA 2WU4A 4TROA 3BTOA 3TPFA 4ZI5A 4UTRA 2GUWA 4LE1A 3M4YA 1F2DA 3K0AB 3GJ6A 3A6KA 3JX9A 4RQAA 1E5VA 2BBWA 4IG4A 3MCVA 2CL7X 3WLFA 3NI2A 3F3MA 4F8YA 5K2OA 4RACA 1VPWA 3HCEA 4MUJA 4G8DA 2Q5IA 1QRAA 2PRZA 1WZEA 4WDQA 4V0RA 5LCXA 4D79A 1IUNA 5GPBA 3JQRA 4D8VA 4YAOA 4HDNA 2EBWA 3WLAA 4NWIA 5L4NA 5DRTA 5EUCA 4FZ3A 4CDMA 2WW8A 1B73A 3KC2A 4EY4A 1SOWA 1ZJ6A 1XCOA 3BH0A 3KNZA 4N65A 3F73A 1XA0A 3MYYA 4AP9A 3DPSA 3VBCA 1CDEA 4DQVA 1Z83A 5I7HA 1XDWA 2JGLA 2WJPA 3LFUA 4IJKA 2AOVA 2JEYA 3K1TA 1MB9A 1MV5A 3ZIAD 3K8OE 5BNWA 1EFAA 3LYLA 5GJVC 3OIWA 3HDHA 4JSTA 1MFPA 2ZPAA 5FOVA 3PI7A 3T3HA 4RXTA 2VDUE 5BW8A 5F5NA 3CF2A 3WFZA 4EP1A 2CYCA 1W35A 4DIMA 2ZXFA 3EA5A 2PUDA 5IBCA 3ZQKA 1G8HA 4DDVA 4MRVA 1O6ZA 4BLWA 1NA5A 4HBZA 4MJLA 5GONF 3N70A 3DMTC 1AF7A 4H6VA 3DDHA 4KIWA 2C7QA 1LNSA 3KXDA 5HCNA 4UTNA 5ALRA 1RWPA 1ZWLA 1TTHA 3IERA 4RABA 1L5YA 4CKCB 2W58A 5MHTA 1JYFA 2EEPA 4S35A 1LNZA 4EZEA 1I2ZA 3AUKA 4ZCLA 4CRWB 4E12A 3L3BA 4KVFA 2C2KA 1A95A 1VMIA 2PV0A 3IIKA 2J8ZA 2XBUA 3AHCA 5DGXA 1M6HA 1N8SA 3DA8A 2WHQA 3JZFA 4PHCA 4DLYA 3ESYA 4E4TA 3BL6A 4LC0A 2JH3A 4XIJA 4KMSA 3SE7A 1Q50A 2HMUA 1VBNA 5JASA 2AI3A 4WCDA 1DQPA 2RCNA 4GPTA 5F3RA 1IMOA 2D6FA 4L4XA 5LU8A 3ABSB 2MJLA 3D7LA 1PJBA 2CNLA 4RNDB 4RHEA 5IJWA 1KAGA 2BCGY 1X80A 3DVRX 1CUXA 1H2HA 3H5TA 3LUJA 2Q5FA 3VU8A 1D2MA 1TM1E 3IGFA 5BMVB 3M6UA 2H2GA 3ELDA 3L0BA 4ATNA 3IT2A 1KDZA 4D4LA 1N8KA 2Y1OA 4YQFA 2QHXA 3RTCA 4RD1A 2DU8A 1UJ5A 4UASA 3OTGA 5DASA 4RK1A 3IAXA 3O3OB 3MWDB 2GHIA 2QEQA 4JIGA 4CV3A 5F7JA 4ISBA 4EG0A 2Y27A 2WJ4A 4M1EA 5CT9A 1E63A 2VJKA 2PEYA 4W5JA 4IH1A 1DIRA 2ZLBA 3OX2A 3B7PA 5CH8A 1VHTA 2XDQB 4BVEA 4IIYA 2UZ3A 3B53X 3H87A 1GNVA 3DCNA 2C83A 4M9CA 4WA8A 4N9QA 3CVXA 2X4IA 4DR4B 4QGBA 2NMVA 3U7QB 2IODA 4WNAA 4CLHA 2KSQA 3HLYA 1GL3A 3CLRC 2Z04A 3K5PA 4CMIA 3ELYA 4OSEA 1L4BA 2Z2XA 3TRDA 3O9MA 1UBRS 4RBNA 4F45A 3F6SA 6LDHA 3M6MD 2GBLC 1T8YA 1X1RA 2B4TO 3NBMA 3FRJA 1HA3A 3IELA 5KYGA 4BMPB 4CEIB 2DBQA 1F7UA 3NHZA 2O8FA 1XKXA 4UOQA 1E18A 1YR2A 3P71T 3RRYA 2FP3A 2R47A 5C81A 2Q45A 3PUWA 4YYEA 4EX7A 5L45A 4AKTA 1NWCA 4TLAA 4D4GA 1VBMA 2JCYA 5TPZD 3K6RA 3Q7TA 5K6TA 4I7EA 2R85A 1G59A 2HV9A 5IZCA 1DAIA 2FLKA 2W6JA 4ZV7A 4DIOA 3NM6B 1IQUA 3VSDA 3QLJA 2B34A 1G0NA 2G80A 2QRUA 1XYGA 2W2KA 3PL1A 1R6XA 1VIYA 3H5AA 3LLSA 3TLMA 4XYMA 4C2TA 4GMDA 2R1VB 5A0VA 2V0NA 4ACAA 1PZEA 1TF5A 1U6KA 3NTQA 4OB8A 4ZCMA 2FX2A 5C8YB 4HXFB 2QD4A 3G0DA 1VE7A 1Z4MA 2AXPA 2LW7A 4WBSA 4ZAVA 3SKYA 4C08A 2ZBEA 3H05A 2DGDA 4R1MA 2AF4C 5BPHA 4PC6A 2A9JA 5K3CA 3G8AA 3Q2OA 3L46A 2UKDA 3H99A 3K2EA 5J2UF 1ZGHA 1XAGA 2AZ4A 1ZD3A 1CZRA 2G70A 1S8FA 5DULA 5LB4A 1RP1A 1GKLA 1M1YE 2X9QA 3QPCA 4MVCA 5B1HA 3WNQA 5B4UA 4M1WA 3ZE7A 1V5GA 1A98A 4BNWA 3MMZA 3E3LA 1AHHA 2C04A 2W8BB 1E20A 4Q1EA 5KJEA 1W0CA 4PAOA 3M1LA 2C9CA 2P30A 3E7XA 3G5AA 1QRDA 3TL6A 2GWRA 2I7VA 2OBLA 2J87A 2QXUA 1YFKA 2FTKE 1M72A 2BW0A 1Y1LA 4J0JA 5EHZA 1GNSA 4I1UA 4GC9A 2Q0QA 2P7IA 2IYLD 3ESBA 5A0FA 5ITZB 3R7WA 4PW0A 5TVKA 1P4AA 3FTNA 3G5MA 3P19A 2GBLA 1QP0A 3QE2A 1ICIA 3HKDB 1PL7A 3OF2A 2VYQA 2WJ6A 4TTAA 5DNWA 1EVJA 2D1FA 2ETVA 4Z9AA 3VH4A 4D9KA 3OFKA 1OY1A 2ZIGA 4RHXA 4ZEWA 1PZNA 2IPXA 3HB9A 5FPTA 3ZYCA 5GVSA 3ZH2A 2H0RA 1N4AA 3HEBA 2Q3JA 1OFTA 1W0JD 1H9CA 4WY2A 3ASUA 3CJQA 1HE4A 4KDEA 5IJ0A 2C3OA 3DAYA 5AQ1A 3ZIUA 3ZZ0A 2CJYA 4KN8A 4NCIA 5BWMA 2GBGA 3EDMA 4MPDA 3VNSA 1IN5A 4OL0A 5D3MB 1SXJC 3AUFA 2J3JA 2QYSA 2HOQA 1GGHA 4D9IA 3F6CA 1RHRA 1XL0A 3AHJA 4ML3A 3H5WA 4NZ9A 4W4TA 3SNKA 3WYEA 1ZOIA 3RFCA 4PYJA 2QD2A 1NSYA 1QIGA 2X23A 2WTBA 5HRCA 1KJ9A 3TLEA 1LTQA 4FXOA 1G8GA 4HQLA 5J5VA 3P0FA 4W6QA 2Z4TA 1JAXA 1X74A 2PUVA 1JWBB 1D7OA 4K03A 4OBEA 1SKUA 1X2BA 1YDHA 4L85A 4IS3A 4HDNB 3ZCRA 1UAYA 2HWYA 4DDHA 3BMCA 2VUSA 1W1WA 2WQ6A 3BPSA 3OJCA 5TRTA 1SHZA 1RJGA 1RBZA 3WLMA 5ESDA 1FLNA 2PFKA 1Y7TA 2OVBA 3MCZA 4B6PA 4YXWD 5BN4A 2QVBA 2QOEA 3CH7A 1TU4A 2IDKA 3LM8A 1DAGA 2ID9A 2OGUA 4OP3A 2ZIWB 1RPJA 1A96A 3WISA 4RIEA 1Y0BA 1DDGA 1T6XA 2Y4OA 3T0GA 2G07A 3K15A 3FUTA 3DEYX 2RK6A 4ZXPA 4TTIA 1MVLA 2R11A 1X1BA 3O8CA 4KREA 4IJMA 4Y6GB 2Z5LA 5IWAB 1FL9A 4H7FA 5KWSA 1I1NA 3UO8B 1LF5A 3DEZA 3M9LA 5JANA 4W63A 4G9GA 4MCJA 1J20A 1ZLXA 4HLUC 5BO5A 1GT91 5A3VA 4QPJC 1J1IA 1Z28A 1CUVA 4LI3X 5AHKA 3BJEA 3EZ9A 3GU3A 3WLJA 3RAJA 1K75A 4OHYA 1WX1A 4F21A 1JPNA 3N86A 3H6KA 2HT6A 2VTDA 2R1TB 1UPXA 4O59O 1E79A 5CVCA 5KYNA 2YQ5A 4O8ZA 3TIXB 3ANLA 3FI0A 3Q8LA 2P9GA 5ADWA 3ZZ1A 3OEHA 4AROA 3DV2A 3AF0A 3NATA 4LVUA 1FFWA 3ZU6A 5HA5A 4OJKA 3ICCA 1TYAE 4G5SA 1I2DA 5DW0A 3S8YA 2E0IA 1Y63A 3WWPA 4CLOA 1WW8A 1YS6A 4PM4A 2K87A 4V0NA 2VNIA 4Q4AA 4M6WB 5AOBA 5FX2A 3CPSA 2GDJA 3Q85A 1J25A 4E6EA 1DRJA 1NKTA 5IK2D 3HXKA 4X65B 2OXRA 1YS4A 2P6OA 3PQ6A 4XTCS 3V4PB 1JRLA 3KE9A 3Q15C 5IC6A 4RELA 5REQB 5C7IO 4Y2XA 5BN1A 3PC7A 1IXZA 1GD1O 1ZH4A 2QVYX 3V7YA 3PXGA 2Z2JA 1XJQA 1DBWA 3D3KA 4QRIA 3ZDFA 5B3JC 4UUNA 1TIKA 4C7XA 2IS6A 4X00A 1UBSB 2FK8A 2ZU6A 3C6BA 1GQSA 2IUUA 3T7IA 3GROA 2VJBA 7REQA 3DZFA 5FHRA 1MJFA 2HQOA 2I6UA 1QCCA 4DT1B 4KFUA 2WINI 3T3PB 4F2PA 5IN4A 3JYPA 4UVGA 1ISGA 3AL2A 4OB6A 3CRRA 3LNTA 3O4VA 1HFEL 1AKRA 3HJAA 4AJKA 1P17A 4D2IA 2XZTA 2JFYA 3PTAA 4LNHA 2P9CA 1GKUB 2PKYX 4IP0A 1ORWA 4PR3A 3S6JA 3SJAA 2EX0A 3H3FA 4BO8A 4TSKA 1FDUA 5M29A 5A7GA 2OMEA 1EUDA 1W1IA 4X20B 1ES9A 3ZY3A 4BECA 4EYQA 4GKKB 1PWZA 1YRBA 1A5SB 1SQSA 3FCSB 1FF9A 3W5VA 3WIOA 5JOQA 2FUEA 1PNOA 2XI4A 1FU7A 2HF8A 2YX1A 3FFTA 1EFLA 4QBIA 3DEJA 1ML4A 2GN1A 2HIGA 1JHRA 3THRA 2JZNA 1FS6A 2KYRA 2QL9A 1FTYA 3WGJA 2WF9A 1PJ2A 1JILA 2BKLA 1WMBA 4GLJA 3DE1X 5KBYA 4H7JA 2JW5A 4F9EA 5GY7A 3HDJA 3TG2A 4JYCA 4E08A 3EC1A 3HTXA 1DAFA 1W0KA 4TL9A 1MR3F 1BNCA 2VRBA 1IXYA 2ZRFA 2EFJA 1YT5A 4D97A 2JLYA 3W5UA 3TDNA 1J5PA 3BT7A 2H2DA 3PJFA 3GJTA 1PQ4A 2PX2A 2YZMA 1H66A 1Q15A 1SXJA 2QPOA 4RD3A 4A92A 4L73A 3DGFC 2LGJA 2WHYA 3CX4A 4DG8A 4B79A 1M2OB 5E9WA 2PUFA 4JMLA 1TT5A 4PEVA 2A9FA 3OLQA 1WOYA 1GTMA 4G1BA 1H42A 1WF6A 2ZUCA 3PHCA 1QGOA 1IOLA 5G0WA 2AYYA 4C05A 4MGEA 1ZR2A 1ORTA 1XTZA 4FVTA 4LY3A 1ZD4A 3EGDA 2A57A 2QAIA 2CHGA 2H7YA 1O95D 3DL4A 3M2TA 5KEIA 4IDDA 1LRJA 5M34A 4QBKA 1NE2A 3B20A 4DNOA 2PUTA 4BE4A 3IVCA 4L22A 2CJXA 2FEOA 2H7VA 2XF8A 2XXBA 2CN1A 3TEMA 3TJRA 3USCS 3ZQUA 2RK3A 1RCUA 1EKXA 3CS3A 4YAWA 5HFJA 4LDJA 2ISQA 3ZDCA 2JHAA 3CRZA 3RC3A 3COYA 2UUCB 1ZIDA 2VZLA 2YR0A 3SZGA 1KU6A 2JFXA 3DCIA 2PK3A 1V1MA 2IYWA 4RLSA 4BNDB 5AK4A 2AD1A 3VPHA 4D5GA 4EHIA 3ZH9B 4EL0A 4WBNB 2A7QA 1KY5A 1E2GA 1WNTA 4IDQA 3U4CA 5KQLA 1CQJA 5HQJA 2N9UA 2NP6A 3PQ7A 1JLMA 3DHNA 4XR9A 1Y8ZA 3S5UA 3CLTD 4QOHA 4AN1A 4Z7QB 5HIAA 4MJ7A 4A23A 2RE8A 3KUDA 1Q19A 2PZ8A 1ZA2A 1N5KA 1G63A 2V6JA 3EVDA 3IXMA 3T7SA 1K88A 1EWVA 1O54A 3WYDA 2NP7A 3E05A 1ZK4A 5E3JA 3BCUA 1T6ZA 3HXLA 2OPHA 4O8CA 1Y5LA 3B78A 1GDDA 4RFSB 3A1VA 3FCUB 1Z37A 3NHFA 3UJ6A 4DLPA 1H0KA 2B7LA 2ZYHA 3KB8A 5DI9A 3F5SA 1CVIA 1P31A 1ESCA 3TMYA 4FP9A 1BEZA 3OZTA 3DLAA 1M8PA 4DZRA 1I0LA 4ARAA 4I3HA 2QSZA 1PGQA 3ADBA 4FS3A 2I8CA 5EIHA 1N6KA 3E1SA 2JDID 1GVHA 5FR2A 4HP8A 4GE0A 1JJVA 1ZLYA 3T06B 3NVDA 1YMQA 3OWHA 3AB2A 2JJMA 1NN3A 1Z45A 3PBKA 1TEZA 4YAFA 1W59A 2B20A 3PEEA 3MTIA 4BEWA 4N76A 3GT0A 5H81A 1P6UA 1PKEA 3PF9A 1ZVVA 4FN4A 2HJSA 1VL8A 2O14A 1KBZA 2REBA 3QX9A 4TV9F 4BOYA 1PYGA 2IU4A 3BAFA 3HDYA 4WEOA 2JGAA 1L7VC 3PJEA 5AW2A 1RYEA 1USVA 2W6PA 4MZDA 3TH5A 3JWIA 2HFJA 1N2ZA 2XB9A 3GJ5A 4U7FA 3EXHC 3QJGA 1P1JA 1A4RA 3H04A 4N47A 3NBUA 4ZK2A 2IQIA 4ZRNA 2XE4A 1LLDA 1OFGA 3CW8X 4NOLA 1C3OB 2H8KA 4YT5A 1YB7A 2AEEA 3IIMA 1MH1A 4MI1A 1Y1TA 1SHTX 3DOEA 2V7EA 4ZDJA 4WVFA 3R9XA 3AVYA 2N47A 5T3YA 4E1BA 1A88A 1FTSA 1HL3A 1GSIA 2DC1A 3FYHA 2HHJA 1Q7EA 3I64A 1EFKA 2II6A 3GFSA 4HDCA 3WXBA 3LW7A 5JADA 5CLFA 4NE7A 4EITA 2QY6A 1WPQA 4YYZA 5JI2E 3MGBA 1IVNA 3F5MA 4QLAA 4DMGA 3DP9A 3GJYA 1JQAA 3OT5A 4RJIA 5ALZA 3K20A 4D82A 3O8DA 4RVSA 4YRTA 2PS3A 4Y2PA 4ARCA 2R7NA 4MI6A 1Y81A 5BVHA 4EGAA 1E1RA 1ST2A 3KQTA 1XWIA 1CWUA 1Z36A 2ZZKA 4HGYA 2NNWB 4JEIA 3KVYA 4JHLA 1LDEA 3HEAA 1XCMA 3EDYA 4IZ6A 5ALSA 4H08A 5LJIA 1N5LA 3NDRA 1A76A 1L8QA 4QUBA 4WFQA 3TTUA 1E5TA 1B26A 1ONSA 2P5YA 3K96A 4PFJA 1D0SA 2YL2A 1LS6A 3I1IA 5REQA 2UXCB 3AM4A 4I46A 1P7CA 2CNWA 3AB8A 5AT1A 2CL0X 1Q0TA 4HHEA 3WB1A 3OETA 4HRXA 1X3SA 1U7ZA 4LJSA 5ABPA 4KNYA 1CQPA 4YRCA 3MJRA 4XWOA 4YUVA 3SR3A 1W93A 2YBDA 1GEGA 1GWNA 1OIWA 2IVZA 1ZA1A 4IH9A 2RD2A 2NUTA 1JG7A 2FW6A 3ZS8A 1UFOA 4BGVA 1IIBA 2YJ5A 3LPMA 4S1NA 4R2LA 4UM7A 3OHSX 3B6ZA 4C0KA 2ZYSA 3I0MA 2MHCA 1KMHA 2AJTA 3IV9A 3CB4A 4O2AF 4QVIA 2ZBRA 3NAGA 5C3UA 4AS2A 3C0KA 1T24A 1DBPA 2NV2B 3MF4A 3QW4B 3HKDA 2BCEA 2IK8A 1Y33E 3BHIA 1SOMA 4M88A 4W5OA 3FR7A 4DJ5X 2ZSEA 2AEFA 2O06A 1DT3A 5BNZA 1WW2A 1PE0A 3EY9A 4UHBA 1S02A 4Q7KA 2YVKA 1NF8A 2ZPUA 3QVSA 3AM5A 3Q0TA 4C4YA 1RMQA 4HB4A 2Z43A 1I6KA 4G9EA 2QL6A 4TLLB 2ZM6B 5IH7A 1SBNE 5CGQB 2JZOA 4H1VA 4ZHQA 1MC5A 5L53A 1EFHA 1MW9X 3EMDA 4WMLA 2QP3A 3IR7A 1D2AA 4II7A 1WHSA 1EGQA 3EWSA 1Z75A 4IIFA 4M9QA 3T7CA 3TIGA 3P2OA 4QC2A 4HAVA 2O7SA 4QXPA 2PMWB 4EATA 5JMTA 3VSEA 1N6PA 3X1DA 3R23A 5AJHA 4RTQA 3C5WP 1C0IA 1GFSA 1GIAA 2BHSA 3C85A 3PFCA 5K8JB 1NX6A 2MINB 4LG1A 5FUQA 3NG1A 3E2MA 5EQFA 4ECEA 2OKCA 2VDKB 1UEXC 1P3DA 2O1EA 2WJJA 3BIWA 5ECGC 4LZOA 4RMIA 5JH7F 2O2CA 4UD6A 2VJYA 3V7NA 4FGZA 4ENSA 4NAHA 2DFPA 4J2HA 2BFAA 3AG5A 2EOAA 3MJCA 4UEOA 1C7ZA 3KSBC 3NIBA 2BBOA 4UVIA 4UM8B 2AFIB 4Y2JA 4DY4A 1QH9A 1WOMA 3O2SB 1J0EA 4IOMA 3MMSA 2R9VA 1AS2A 3PZBA 1IQ0A 1QS0B 5JSYA 4PLCA 2VUUA 4ZK6A 1DAHA 1EFCA 1U28A 4IZIA 5FDFA 3FNFA 1GPYA 4JLDA 3G1WA 4LHEA 1Z47A 4AAYA 1GAEO 1QH1A 2JANA 3MHTA 2NUPB 3GJXC 1E1KA 1PFUA 3C5HA 3G8DA 2CFOA 5IKEA 4D98A 3NOOA 2XCUA 4M9UA 1Y4DE 5IH3A 1O0CA 3SU8A 2OCAA 4WBNA 5JFTA 1WZIA 1KYXA 2NZVG 3C1UA 3G49A 1ODLA 1G18A 3K94A 3KSDO 3L49A 3NKFA 3A31A 3B3JA 2AQHA 3VFDA 2I55A 4R84A 1XN1A 2XDWA 3CX8A 1I2BA 1RFLA 3HI4A 1RM4A 2PUJA 2ZJ6A 5KPDA 1RU3A 1T2FA 4X90A 4JLUA 4JN6B 1PF7E 5JRDS 1SPBS 3RC9A 2JFQA 1NMZA 1LXCA 1NVXQ 3D2CA 2Z0MA 1GNPA 4JC4A 3E2PA 4LQCA 3RKRA 2AL7A 4B1FA 1YL7A 2I8AA 1L6IA 3KWFA 3M6LA 3G2KA 3WJ2A 2W6ID 1BJRE 4HEJA 5J9FA 4F5YA 5BSHA 1L4HA 6PFKA 1QRUA 1MOPA 5K0SA 4LRYA 1V9CA 1GGVA 2PY6A 2C9OA 4Q4HB 4URUR 5BY2A 3A2MA 4DSZA 4AXXA 4C4PA 4AN0A 4XX1A 2VPZA 1R8SA 4WOJA 1G9SA 1SZJG 1P74A 3O8BA 2Q8NA 2EZ9A 2X4DA 3NFRA 3G1TA 3LHFA 4FGJA 4X6UA 2EG5A 2ZYUX 5LLTA 3WZLA 5TPWB 3P1JA 3L0YA 4TSFD 3RYIB 5IWCA 2XCQA 3HY4A 2NO6A 2C78A 1OI3A 1IVYA 2GH1A 5GV8A 4P4GA 3ZZNA 1G5PA 3AVPA 4QU5A 1GZ5A 2JGKA 1UBMS 2NYVA 4FONA 5IKOA 3T1QA 4IUCS 1LPMA 5BQPA 2IXEA 1LSJA 4OLHA 4AG3A 1Z25A 1E61A 2YWXA 1NUAA 3QYFA 1QHNA 4XVUA 5LYJB 4HLNA 5BSKA 5AW6A 1TO2E 5AKEA 2ZSIA 1COWD 4J8PA 4J49A 2NYUA 1IOVA 2ODAA 3FCEA 4UUAA 3KETA 3LPAA 4IMIB 3Q3GE 3ESZA 3F6YA 1PWYE 5JEEA 2EFHB 3SZUA 1MT0A 2HA7A 3UWKA 1TM7E 3VSCA 2A5JA 2C59A 1A82A 3DFFA 1R8QA 1OZFA 1XPRA 2DTXA 1O0BA 1ZI8A 3Q4GA 2WMDA 3NHMA 5EMJA 2C9BA 1T3LA 4KYTA 1S9DA 2WWRA 2ZI3A 3UJ8A 2V3VA 4YUAA 5EIEA 2C4WA 1X14A 3O3NB 1TNDA 2GX6A 4RVFA 4B76A 4TV8A 4AKIA 2ORED 4N0EA 3A2KA 4MMYB 4PICA 5EUQB 1LPOA 5ADUS 2VKQA 5LYJF 1E2IA 4LRSB 2J6BA 2R66A 4L4YA 3U4QB 3JD1A 2B8NA 3RIHA 2OCYC 1E5LA 3FMVA 5HQ3A 2JIDA 1P8AA 1J8YF 2QN3A 1JQ3A 4GSKA 5AI8A 1Q91A 4DM3A 3I72A 3UEOA 1N92A 4Q66C 3WHKA 3B5EA 3B6IA 3BCHA 2B8TA 4EW3A 5DM1A 2YWDA 2OG1A 3IS3A 1C30A 2FI1A 3HPRA 3NEJA 2OP0A 4FR5A 4E5PA 3EXG1 4EG1A 5HKKD 4R9VA 3TTXA 3NRJA 5COBA 4D74A 5A3QA 1SXJB 2YYSA 1Y80A 3FDXA 4FSDA 4ABYA 2WYWA 4YA6A 3TKLA 2HJRA 2Q7DA 1KOJA 2G06A 2NVUA 1Z08A 2KLHA 3TD2A 5FUMA 1DHRA 1T4DA 2VYVA 4CN9A 1R37A 3CW2A 2F48A 4I4LA 3SSNA 2WA2A 4RKYA 1Z68A 1DBSA 1LZKA 4XSHA 4BNXA 1ZCBA 2A9RA 1SIWA 2UYHA 1QU2A 5LQJA 1JVBA 3MWYW 4UM5A 3RUHA 1Z6TA 2AOUA 4JZYA 4O5OA 5GVRA 3MOSA 1TJNA 1BX1A 2OEPA 1R2QA 4G63A 4O2BF 1QO0A 2JKVA 5A3JA 5IAAA 3E9EA 3P9ZA 5AI5A 1D7AA 1BXKA 1OYVA 5DM0A 3JATB 3N2GA 3RTDA 4TXLA 1Q0SA 2QTMA 2WI8A 3DQQA 1YD7A 3I34X 2FG6C 4HK4A 3TRJA 2X5NA 3WLIA 4RZXA 5HM8A 1RRPA 4URFA 4V0MA 1CDZA 2BM9A 3D9QX 3ZY2A 3KJQA 2RI6A 3AIKA 3P9XA 1RI3A 5EWLA 1YF3A 1DQRA 4UAUA 5B12A 1LPAB 1YVEI 1YUNA 2MSLA 3V1UA 5F2EA 1R0CA 1SQ6A 4PAMA 1J39A 4ALMA 3GFFA 4UZFA 1HT0A 3QEOA 3N0WA 3KYJB 2BEKA 2H51A 5KVCA 3NYWA 1D1PA 5IAGA 3AETA 1CUSA 3GYBA 1PG0A 5E7MA 4AWXA 4FOSA 4DSTA 4MGIR 5HVNA 3A6JA 4BJ3A 4Z0NA 2GM4A 4QUDA 4L0DA 3RYFB 1II9A 3D4IA 2HSGA 4RFSA 2OV1A 4WKCA 2FMTA 4IDEA 1IBCA 3EGIA 1WDLA 2WKQA 2FUG6 3AESB 1JALA 2MR5A 3COWA 3H8WA 4K9KA 2B30A 5D84A 2X1MA 4IQFA 2JFZA 2B37A 1OWPA 3O95A 2CXTA 2IF0A 5C2JB 4I50F 1C1DA 4GIBA 1FIUA 2DEUA 2DKNA 1RADA 3AEYA 4L6CA 1E0AA 2O1XA 1P5RA 1J09A 4LJ5A 2HIAA 2UZ0A 4LXHA 4R2WA 4WADA 4HDSA 2PNJA 4DLTA 2J3EA 1GZ7A 4ANFA 4FCWA 1BWSA 1M2HA 4LF8B 4WOPA 4MPTA 5CMLA 3N53A 3VR4H 1MTZA 4G5OA 3QPUA 4E5SA 3IPRA 1LQUA 4ICIA 4P93A 4XW2A 4KSBA 2DRIA 5CHEA 1KIAA 1XSEA 3K9HA 5KYWA 2P35A 3BD9A 4FEEA 3KJNA 1H9BA 5A9RA 5IXJA 1NNI1 1P0IA 2W0MA 2ZYVX 2C7VA 3OLWA 3O8OA 3P27A 1SQFA 2VP9A 3QYPA 4N01A 3KM0A 2O8CB 1BYIA 3PCXA 4PLVA 1E1CB 4PZDA 1U3FA 4MVJD 2I2WA 3EYAA 4PAGA 5EHQA 1IE3A 4INAA 2NT3A 1E8DA 2ZR8A 2X6RA 2VPWA 4K88A 2NTJA 2XCLA 3X43A 2PD4A 1P4RA 4JYMA 3X44A 3P96A 2DCMA 3RHZA 4M60A 4D42A 1RQNA 2ZYDA 2YRFA 4OREX 1JS1X 1CCWA 4C3OB 1IZ0A 5K6RA 1V8FA 1P2TA 1ZR4A 4DW8A 1VIVA 4KR7A 3LMKA 5GM1A 4YGXB 2CHEA 3VNAA 4QVGA 3V32A 4A0HA 4P33A 1QR2A 1TTTA 3HA5A 1LSUA 1NVVQ 2ONCA 3DD1A 3P8ZA 5ALXA 1K4MA 4DMFA 5C7OO 4WFJA 1AZTA 4LGVA 1GYQA 1KMMA 4H7EA 2BGRA 2IRWA 3A6EA 4UMEA 4F60A 4F4HA 3ENQA 2ZTMA 3QY9A 1JQJC 3CH5A 4GGPA 4WJZA 2I1LA 5G0UA 2XCOA 3S2GA 3NWEA 1QAMA 4Q02A 3T9AA 5A4JA 4OQNA 1OXUA 3G02A 3K92A 3SQLA 2OHXA 5KOHB 4D0GA 3QELA 1TJ4A 3Q6NA 2CXRA 1A27A 2QZ9A 2WHEA 2Q2NA 3C8DA 4OJMX 4JMPA 3TGPA 2WJWA 2BFEB 5ALIA 4YWJA 1QYCA 3BXZA 2ZRKA 4C4AA 3KPWA 1ADCA 4WZZA 4I5IA 2VYVD 2QRJA 5EQDA 4CMHA 3HZRA 1WD7A 3C87A 1NFQA 3GFBA 3NW9A 4LRUA 4P9NA 2DYKA 2AG8A 3PNQA 3C7DB 3RANA 1FMFA 4Z53A 3IYLW 4IKOA 4LV6A 1RXWA 1PG5A 2CFTA 3TZ6A 2WWXA 1HNXB 1PJLA 5JMPA 2PS1A 3VXKA 3NB0A 1FP7A 1Z6ZA 3HCAA 3IILA 2OT3B 3W3AH 4OX9B 4IGFA 2IJGX 4ND3A 4JELA 1PUIA 2GRAA 5I7SA 5JRJA 4E4YA 5KNDH 2VK1A 3LK6A 3MTAA 2AC2A 2GPTA 2KQUA 3QLVA 4PPNA 5AKXA 3T0IA 4RMHA 4XWWA 5DW3A 1FYDA 4CMIB 2X5XA 3GVIA 1J00A 3C6KA 4UD2A 4UVHA 3RTAA 4Y6SA 3RADC 1UBOS 1TXGA 1UXKA 4AKEA 4L08A 3ND9A 3DFUA 1EGMB 4LS3A 3VDRA 4B7AA 5IDXA 2W6MA 2ZJ7A 1P9RA 1M66A 2FZVA 2ZB3A 1IQRA 4IOJA 3FDFA 3M7IA 3RVLA 4CKZA 4DDUA 4BWYA 4F84A 2H63A 4YI3A 4WXYB 4GXRA 2QM0A 4RWEA 4CM7A 3KZCA 1DELA 3PQ3A 4AMYA 3G9ZA 4QQ8A 4BB9A 4XYEA 2OORC 5DBHX 3FYTA 3AKDA 3O90A 1FMJA 1TT7A 4BFUA 2W2KB 2JJ8A 3AVWA 2ZEJA 2IHZA 3HVHA 1SBZA 2ZUTA 2CCKA 3JAMA 3W34A 1C0PA 4NV3A 1HH4A 3FVWA 2O2DA 2ZREA 4IFTA 5F2KA 3T15A 4DKJA 4FNOA 4RGYA 2G5GX 1WKVA 4DWVA 5ITVA 5LFAA 3FAKA 4DLSA 2Y67A 2XT0A 4K6FA 1C9EA 3DP7A 4A2CA 4HNAB 4JOBA 3BCSA 4M36A 1W2HA 4P92A 5AIBA 3FYUA 1HEYA 1L7QA 3GR6A 4BJ6A 1RHKA 1YJ8A 1I7PA 3I8XA 1E5XA 4JVMA 5K0NA 1WV1A 4A3SA 3MBOA 4BBJA 5LOVF 3KZVA 1U9JA 4ASUD 3K2QA 4FYYA 2IE8A 1SUAA 3KJZA 4YT8A 1NIJA 3ASVA 3TW0A 3QLEA 5P21A 3PE3A 1HV8A 2ET6A 3PKIA 4P22A 5ALWA 3TNLA 2HMVA 4XA8A 2GZAA 4QDJA 1G64A 3I1JA 5IVDA 4K2HA 4AK9A 4L5AA 2BSQA 1PJTA 5E95A 4U39A 4O2AA 2BUCA 3HBJA 5DHPA 5EVJA 2OHJA 3OM8A 2FMKA 1QGUB 2AV6A 4RF5A 4AJ2A 1NJSA 1NXVA 3PU6A 4FWBA 1GT6A 4LRXA 1GRQA 3UTCA 4PTZA 1NI5A 2FUCA 4B46A 3IIEA 3I9JA 1GZ3A 1CHDA 3NAMA 3UAZA 1MFZA 5KVQA 4KQIA 2PWYA 1DFHA 1FQJA 2D0IA 4I4NA 1P62B 3OCJA 4E51A 4AY6A 3AJRA 2GETA 2WMOB 3ORFA 4UCFA 2VBGA 4B09A 4E70A 1XZJA 3KUUA 1BO6A 3KP1A 1P1RA 3V5NA 2PIAA 1Y5RA 5AM3A 1CUBA 4GM4A 4CG2A 2YQ4A 1K5GA 1UQUA 4LVOA 5DNDA 2ZSDA 2GYUA 4P3NA 2QBYA 3WQQA 4WNCA 5E7QA 3I45A 3A4YA 5EP2A 1X70A 5D85A 1T5TA 3DMTA 1VSVA 3P9PA 1U3VA 1MAWA 3GAAA 3BM5A 4TRJA 3V2GA 5EINA 4OL9A 5FBLB 1MJHA 4MXDA 2P65A 3IOCA 1CULC 3HY6A 4W7HA 3WGGA 1VI2A 4CETA 4RAQA 1H85A 2D1SA 4D8TA 3L9XA 1XVVA 2IY9A 2E89A 2QZ4A 3IEIA 3JQQA 3N2EA 3N2ZB 3OBBA 3QQ5A 4FDVA 4IIHA 3WWYA 5BR4A 2ZVQX 2A30A 4M9SA 4KGDA 3D0OA 4RK5A 2BLLA 4I1PA 1F2UA 3RRXA 4C22A 3VJRA 4JIMA 3GEPA 1J8DA 2DUWA 3RTBA 1SU6A 1LDMA 1ETHA 1QH0A 1JHXA 3IIIA 5KYKA 4HCJA 2CV0A 2XZLA 4YCCA 4TMYA 3OKAA 2COEA 3DTNA 1RZVA 1S2LA 4YONB 1M8KA 4C4SA 1OXXK 1V26A 3BMNA 1J24A 4DCTA 3TUJC 1OX6A 3R3JA 7MDHA 1HLGA 1OFUA 1O6FA 3HKCB 3NTVA 1Z74A 4O4IA 5KB3A 1RLOA 2ZYGA 4FMCF 3MRTA 2VI5A 3IQHX 2VOEA 2JHFA 1G19A 4MW0A 4CLXA 1Z88A 3HYRA 2O05A 9ABPA 4FUTA 3A05A 1HNWB 1HT3A 3FHLA 1N36B 4YMWA 2VBIA 1V37A 2BP7A 1IUOA 2ZJFA 5DYNA 1AKUA 5JAHA 1P19A 1YOVB 3WNZA 3AONB 4OHBA 4J29A 5LLDA 2YXLA 1IOWA 2BTQA 4TS4A 3U7JA 4B9AA 4BFZA 3RU3A 2XD4A 2OLJA 1HOTA 3I0ZA 5HX7A 1ABBA 1NR1A 1TPYA 2CGEA 2H7CA 4PZZA 3T3GA 4C20A 4IX9A 1QQAA 1IHXA 4PYMA 2CD7A 5DBGA 1PS0A 3QEBZ 2VT6A 3O31A 5LP6B 1J2RA 4WUTA 4I2NA 3K70C 1YKFA 2PBLA 2XLCA 4MVJH 2Q27A 5EHNA 2I1WA 2BM0A 1A97A 4G84A 2WFLA 4RJTA 3IQDB 4MQ5A 1CEQA 1ZUNB 1A50B 2MYNA 4IEFB 2Q5OA 3IDSA 4KK3A 5E6SB 1T5DX 5IP5A 4BRWA 4G4JA 4P32A 2VQEB 2YW9A 3RFFA 1IN4A 1KTVA 3IT0A 4Z1MA 2G28A 4BEVA 1DQSA 3GNSA 4J07A 2F4VB 2WAXA 5FJJA 1NPYA 4BGDA 3E03A 4E14A 2R86A 2KW5A 4C7VA 1MG0A 2QN1A 4EJSC 1T9KA 4CBVA 2IYVA 3P97A 1YNSA 1EWKA 3DKPA 1JPUA 2WP8J 3ADPA 3H1BA 4G85A 4O1HA 4R1LA 5DF1A 3Q40A 1XU4A 4ZJZA 5A03A 1N6OA 1C8BA 2Q46A 2TMGA 1T8UA 3O94A 4RPIA 3TW4A 4UDXX 5EJ8A 2W8BA 1BQEA 4QE3A 1HWYA 5JD3A 3LRPA 4N3BA 2EWWA 4U2KA 1C4WA 4PXAA 3L0PA 4U3JA 4QQRA 4UFNA 5A6SB 3WYBA 1NXPA 3WSTA 3TI7A 5TV2A 3WLEA 3OJLA 2X41A 3FB1A 1PL6A 2HU8A 4GM1A 3N0RA 3ZLTA 2O57A 2XVYA 3KVNA 2QDKA 2FUKA 3KKMA 4UVEA 3VO8A 1OWNA 3GZTB 1JLLA 1MUUA 5L3SA 1EJBA 1KHHA 2VAPA 3OD5A 1USGA 1UK9A 5A05A 3MMPA 5JV5A 3OCUA 1QP8A 3RHTA 1F8UA 3NNSA 4L51A 4RXMA 1YQTA 4WNIA 4S3MA 5TT0A 3HJRA 2IVFA 3TDKA 1CUIA 1NVWQ 1AUVA 3PE4A 3Q9NA 1VECA 5G4KA 3WV5A 3EEYA 4F2DA 1EXNA 5C4MA 1TI7A 4FYMA 1QVRA 1QVZA 5EGSA 3ZOZA 2B4YA 2PX8A 4X1OA 5DHUA 3BD6A 3EFEA 3N6VA 1V5EA 1JSLA 4FN5A 2ZROA 4DANA 4AG6A 1R4ZA 3EMBA 3FM9A 1KEWA 1CY7A 1T4BA 4FE3A 3RT1A 3JYOA 3TM4A 4JP2A 2YZ7A 3P9SA 1Y8QB 2ZXUA 3W2HA 3I4LA 5TQ0B 3EC2A 2PU5A 4Y98A 3OZBA 4HVLA 3AFIA 3HCPA 2HMWA 3AOEA 4DLRA 3B51X 2V7QA 2ZWVA 4Q12A 2V55B 3WOHA 4MQMA 1WM1A 1RNLA 1JDVA 2ECOA 2CDBA 3QHQA 4LJKA 5HF5A 1OLXA 1NJ1A 2FOLA 3KLBA 1O87A 2R87A 4IHJF 5C51B 4TMTA 2GZHA 5A9SB 3HVRA 2H85A 2WG1A 4H6WA 4JJ6A 4HMPA 3QBJA 3QUTA 3UM9A 3UMMA 5BSMA 4E03A 5DCYA 3KS9A 1THGA 1YZQA 2I6XA 4KFRA 1VRWA 2AHOA 1U0EA 2BMDA 3F71A 3O8OB 5E1MA 3GFQA 1X39A 5HTKA 5TIIA 3NLLA 1VB5A 4MV1A 5LMNB 3A06A 4CKXA 4A91A 2B21A 4PPYA 5DXFA 5T5QA 3VAAA 5FOWA 5AWFC 4G89A 1A72A 4OPMA 1X1DA 3S7ZA 4KXYA 1WIWA 2H06A 4YCJA 1QIHA 2QL7A 1B3RA 3I2YX 5DI3A 1UPBA 1G8YA 3KQPA 4DYVA 5C80A 2W4QA 1GILA 5E2IA 5AXAA 2WTUA 4R8RA 3FOFC 3MC1A 4MR7B 1Q21A 5IFLA 2G25A 5TF0A 1OWMA 1S2IA 2E4AA 2DT5A 4ZEVA 1L7AA 3S40A 4JLSA 3JQFC 2JGJA 3OOEA 4G81A 4YS6A 1BS1A 5CDFA 1YR1A 4R5MA 1QQ6A 3K71B 3R0IA 3SZ3A 2PQ6A 3E0XA 4H6PA 2BISA 3GIDA 3DXXA 3WK4A 2CYAA 3CMCO 1OBCA 2ZE6A 4M99A 4MQFB 1CJBA 1SVSA 4DQLA 1ZW6A 3QFTA 2D2EA 5ALJA 5THQA 4YJFA 2X9NA 3CV3A 3LFHA 4C7BA 4HLUA 1E1DA 1I3LA 3D6NB 2FR1A 3ES9A 2OV3A 2QTHA 1FP1D 4B82A 3TSCA 4DR6B 3ENVA 1EFTA 4QREA 4BB6A 2MSKA 3H17A 1Y7HA 5A5DA 2OM2A 1NVAA 4FOPA 3PQCA 4KRYA 2VZ8A 4HNHA 3VVBA 3ADDA 1HURA 3ZK8A 3EZNA 3V6MA 2VQ3A 4RPCA 2B0JA 4J6FA 2UDPA 1GGEA 4Y6RA 4DC1A 4Y2VA 4A1OA 5HE8A 1YASA 4PZLA 4LZZA 1NU8A 2A5GA 1WHTB 1FRFS 2V6MA 3VC1A 5AKKA 4EGQA 4KPYA 2IHTA 1OC2A 2DPLA 2HU5A 4NMXB 1C1XB 3DT9A 4HAYA 4QTYA 3L05A 4KQGA 5LIRA 1PT9A 2R97A 2ZSAA 4IXDA 2HBYA 3QSGA 3MBIA 5FRDA 3CO0S 3R9XB 4CU2A 4H4EA 2OYCA 5I3ZA 2BTQB 3DM5A 3HCBA 3FZYA 1W52X 1JWAB 3L0OA 1PCXA 3QUCA 1XCBA 1UDWA 2X0JA 4J3NA 1J9ZA 1IFXA 3A3KA 5HKLA 3OQPA 4GPD1 1Y3CE 3OTIA 1Y7IA 2HDHA 3L6EA 3R3WA 3WV4A 2QMOA 2UZAA 3GBPA 2PWPA