4KR7A

Crystal structure of a 4-thiouridine synthetase - rna complex with bound atp
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
386
structure length
386
Chain Sequence
ELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Probable tRNA sulfurtransferase
publication title Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 119
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.8.1.4: tRNA uracil 4-sulfurtransferase.
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02568 ThiI Thiamine biosynthesis protein (ThiI)
A PF02926 THUMP THUMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 4kr7A01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kr7A02
3CLUD 4RUKA 1ZUNA 1OBCA 1I6LA 4L2IB 1GPMA 1O96A 2PG3A 4WSOA 1KKUA 5FO0A 4DDKA 4U7JA 1X8XA 4CT0A 2C5SA 1U0BB 3COYA 4UZEA 4K0RA 4MUHA 4NZPA 1GTSA 3CVWA 4EG8A 4NATA 2IELA 2YWCA 1NURA 4DLPA 4MW2A 2D13A 3P52A 3TM5A 3FNRA 3ZJUA 1VL2A 1KAQA 3X1JA 4DDHA 1COZA 1PG2A 4X0EA 4ZT5A 1VBKA 2XRZA 4CQNA 1N2GA 1M8GA 1EFVA 2V0CA 2HMAA 1TYDE 3IMEA 1X6VA 3FIUA 2A84A 2A1UA 3IMCA 2QJOA 1N78A 4GRIA 4JXZA 1O97D 3Q12A 1K97A 3DLAA 2ZUEA 1EE1A 1H3NA 1MAWA 4ZT6A 4XSVA 3SZ3A 3ZXSA 4ND7A 1KR2A 2DERA 3TZLA 4EG3A 3L92A 3U1VA 2EL7A 2YWBA 1O97C 3FETA 4XFJA 5FO1A 1XNHA 5HG0A 1MB9A 2CV1A 2PXHA 4L2IA 1SURA 3QE4A 3FDXA 5KHAA 1O94D 2Z09A 3V8VA 1WZ2A 3NBAA 4MQ6A 1M1ZA 4JFAA 3AG6A 3TQOA 1M8KA 4CDMA 1PG0A 4YP5A 1U7XA 1U3CA 1O94C 1VBMA 2A1TS 1NSYA 3OP1A 4MWCA 3ND6A 4EF6A 1WQ4A 2OQ2A 1EJ2A 1IH8A 1N3LA 2GM3A 2GKSA 1DNPA 3DV2A 3FY4A 4HPWA 4R2MA 3SP1A 4MW1A 2VTBB 2CV2A 3M5WA 1OD6A 3FH0A 3IOBA 1KQNA 2WSIA 4DJAA 4BWVA 3GLVA 1PFYA 2DPLA 3RJZA 1MRZA 3S3TA 4MVYA 1G8HA 5EKDA 4MUIA 4U8HA 2CYCA 1EFPB 1M83A 3COZA 4DNXA 1O5TA 1N2IA 2DUMA 4PBTA 3SEZA 1I6MA 3CA8A 3PNYA 1KH3A 1QQTA 2QTMA 2QTNA 1J70A 3CLRC 4MAFA 1JHDA 1XJQA 5TGTA 3RK1A 5H16A 2J4DA 2HGZA 4UZFA 1J1ZA 3ILVA 3SZGA 3QTBA 2O5RA 5J5AA 1GZUA 1GLNA 4K03A 1U3DA 1O0BA 2A1TR 3N2YA 1IQ0A 1OWOA 1O95C 3TM4A 3NV7A 1IFXA 3L93A 4MWBA 4ZCPA 1XNJA 3ND5A 3IH5A 4MLPA 3ZGZA 3AKZA 1LW7A 3IUEA 2A7XA 4EFKA 5F23A 2Z08A 1OWPA 4AQ7A 3ZXIA 5IHXA 5HUJA 3KT3A 1ZJWA 2A88A 4Q16A 4U63A 4ZT4A 3IOCA 1QJCA 4MWEA 2VTBA 1QU2A 1MAUA 1TYCA 3RBAA 1WXHA 4MULA 1G8FA 2DLCX 3CLUC 2A86A 1F9AA 1MB2A 1WXIA 1JIKA 4EG7A 3VRHA 2YXNA 1NP7A 2WB2A 2J07A 1PFUA 1I2DA 1KORA 1XNGA 3TNJA 1N2JA 5TS2A 4QREA 3HFJA 3GMIA 3P0JA 4TS1A 1Q15A 4HJXA 3TQIA 5LM3A 1NUPA 1R6TA 3JXEA 1N77A 1QRSA 1KQPA 1M8FA 4E1AA 4MW4A 3H9BA 4ZT2A 3KFLA 1OWNA 1EUQA 3D6UA 2PZ8A 3MXTA 4ZT7A 4HK4A 3CLTD 1QTQA 3IOEA 1KAMA 4MUNA 4AS1A 1KH2A 4WNYA 4MVWA 2JA2A 3ELBA 3IODA 4EG1A 1YIDA 1T6ZA 4YBRA 3FI0A 4MW0A 4MW5A 3PXUA 1U7DA 1YUMA 2RD2A 2E89A 3MMXA 5AHWA 3RHSA 1LI7A 5DASA 1KQOA 3HMQA 1N2HA 1NZJA 1TYAE 2PZBA 2CUZA 1JECA 1Q77A 2QJFA 4NX2A 5K0SA 2ZUFA 1JEDA 3G59A 1MOPA 4MWDA 1JIJA 4JXXA 4MW9A 3TMAA 1T9GS 3G6KA 3H97A 1O0CA 1YULA 2JAXA 4S1OA 3F3MA 1CT9A 1H1TA 1FYDA 3H99A 3A04A 3NBKA 2EJCA 1IHOA 1J21A 4QRDA 1KP3A 4J75A 1OBHA 2NSYA 3LCJA 2TS1A 1TYBE 3KT8A 5FNZA 4MUEA 1QU3A 3COWA 1QRTA 3CLSD 4KR9A 1MJHA 4MW6A 3VU8A 1OWMA 1EUYA 3A2KA 1IRXA 2XRYA 2BYTA 1WXGA 2H29A 4P2BA 4I6JA 1QNFA 3AG5A 3LDGA 2BTEA 3Q10A 2CT8A 1D2RA 4DE5A 3CLSC 3H05A 3AIIA 3QTTA 3UMVA 1KH1A 3SYTA 3UOWA 3IVXA 4G5YA 4PBRA 2J5BA 2X1LA 1O96B 1YUNA 3LOQA 5BNZA 1F7UA 1GTRA 2PFSA 1F4LA 1T9GR 2DR2A 3FWKA 2E0IA 1NUQA 2RE8A 2X3FA 4G5FA 2CV0A 3A4IA 4CDNA 3H9CA 1PFVA 1TFUA 2NZ2A 4R2LA 3CVVA 1YI8A 1IQRA 4YMIA 5TEVA 1T6YA 3G5AA 2HZ7A 4PY2A 3UK2A 1N1DA 1JZQA 2D54A 2V0GA 1I6KA 2J08A 3I05A 1H3EA 4QBTA 1GN8A 2QUIA 2Z3VA 4JYZA 2QUKA 1A8HA 3HV0A 3FG9A 2X0KA 4FZJA 4NAHA 1N2EA 4OUDB 2AKEA 3LDUA 1EFVB 2PIDA 3IVGA 3P0IA 4YP6A 3ZUGA 3K32A 4MUGA 3TLJA 1R6XA 2AG6A 2CFOA 2QJTA 2CSXA 3P0HA 2A1UB 4MVCA 3PNBA 1WY5A 5DK4A 2WQ7A 3VGJA 3IUBA 1K92A 1K4MA 4ZCSA 4EG6A 1Q11A 1EFPA 5J59A 4I6EA 1G59A 3GUZA 3CVYA 3HGMA 1N2OA 5JBNA 3AL0C 2E18A 4EGAA 4OJMX 3INNA 3X1MA 1PFWA 4RPIA 1WXFA 4EG4A 4MVXA 3MUEA 1NUSA 2J09A 1OWLA 4XFDA 2QTRA 3SDBA 1J09A 3D6VA 2CYAA 2E21A 4F4HA 1HYBA 1NI5A 3AFHA 2R5WA 3FHJA 2DXIA 4MW7A 3KT6A 2VXOA 3ISJA 1GAXA 1H3FA 4A91A 3CLTC 1F7VA 4ND6A 4F3RA 3TZEA 1JMVA 1WXEA 4KPUB 3OTWA 1IQUA 1NUTA 1V47A 1G8GA 4OUDA 2QUHA 1MC1A 3DPIA 1YIAA 1VBNA 5K0TA 4G6ZA 3N8HA 4ZCQA 1N2BA 2D5BA 3IVCA 3BL5A 4PBSA 1ZH0A 3ZJVA 3RK0A 3FOCA 1MBZA 1M8JA 1ZH6A 2I1LA 5KCMA 1P7PA 4MUFA 5DB4A 1JEEA 1ILEA 5HUHA 3MLAA 1J1UA 2CYBA 2GOYA 3IDFA 3A05A 2ZP1A 1BS2A 4Q93A 3UY4A 4ZT3A 1RQGA 3ZJTA 1O6BA 3Q4GA 5DEOA 3CVUA 4ZCRA 3E27A 1VLHA 2DEUA 1T6XA 3K9WA 4JZYA 3HL4A 1JGTA 2OV4A 4H3SA 4EG5A 2A4MA 4MUJA 3N05A 3K0BA 1WKBA 3C8ZA 3LE8A 4KR7A 1TQ8A 1ULHA 5LLTA 4ARIA 2AZXA 5LFAA 4R0NA 4KR6A 2G36A 4NAUA 4YP7A 1UFVA 2X1MA 4NDAA 5TEWA 3X1KA 1TEZA 2QUJA 1B6TA 4KPUA 1JZSA 1WJGA 3CR8A 1N75A 3CVXA 1S4MA 1NYLA 2WQ6A 1KP2A 3TS1A 1K4KA 1EXDA 4MUKA 1WOYA 3RFFA 3PNVA 1LI5A 2YY5A 1WQ3A 1V8FA 3CLRD 3PRHA 3ZIUA 2PZAA 3V97A 1JIIA 3KT0A 3MLBA 5H7XA 1IVSA 1Q19A 1R6UA 4ARCA 1M8PA 2IJGX 3DO8A 4HJRA 3N9IA 1QRUA 2DETA 1O95D 1FFYA 4KKVA 4ZCTA 3ND7A 1NUUA 5KWVA 2B7LA 3SEQA 1J20A 2JANA 5IJXA 4J76A 3UC5A 4DDMA 4GU5A 3COVA 2H2AA 4I6GA 3IMGA 1JILA 1Y42X 5J58A 3HZRA 2IP1A 2O8VA
chains in the Genus database with same CATH superfamily
2Q3BA 2B4AA 5KTKA 1L5GB 3GT3A 4YJGB 4PEVA 2ECKA 2BI7A 3O4FA 2PMBA 1A5SB 3JD0A 3QV2A 4URWR 4B6GA 1O6CA 1U28A 5FR2A 3S28A 4D56A 5REQB 3WLSA 5EGSA 3HZZA 2E4AA 4IF4A 4KYIB 2FPIB 3WNCA 3EXIA 5KYWA 3QJGA 4IYJA 3RF7A 1GTSA 2FMXA 1FP4B 2K7ZA 3IT1A 1KYYA 3NFYA 3NW9A 2YNMA 2LIPA 2HDWA 2JJQA 4BU1A 1AIPA 1GVHA 1T8YA 3K2BA 4URHA 1TM4E 1BC5A 4CMAA 2R44A 4ENRA 3PA8A 1DRUA 3EPJA 2VDMB 3U19A 4MKGA 3MGCA 5P21A 5J2UB 4HF7A 1NXOA 2Z9DA 1COZA 4PZPA 3VR4H 3IIIA 2BUAA 3NDIA 5EJGA 3QEAZ 4CQNA 4BVBA 2O50A 2GAOA 4TRRA 5LDHA 3H5VA 3E2PA 2HMAA 1AS0A 3AL2A 5I7SA 1FSGA 2CHVA 1L5HB 2Y1LA 1SBIA 2IEGA 4DR5B 4DADA 3U44A 1K1EA 3QKIA 2V4MA 4PZCA 2DTEA 5EI5A 4UPEA 3SBEA 5KX5F 3EY9A 4OQNA 1IAVA 2IODA 4GKKB 2C29D 2ZT7A 1T36B 4R05A 3T3DA 3PE4A 4R9NA 1QCYA 4NECA 4ZALA 5L3VA 1XP5A 1J97A 4IMIB 3TLMA 4QJBA 4YJFA 3C6KA 5J1TB 4CF6A 3D6MA 3L77A 1KZ1A 3HBFA 1K7FB 1ACMA 3DNFA 3GDOA 1KQGA 1ZN8A 2IPOA 1RAIA 3NBXX 3K05A 3WAJA 3HRHA 3V8QA 1XQ6A 1GQRA 2BEWA 4ABYA 2JHGA 4ARAA 2ZBPA 4K1XA 3GOQA 3AGQA 3FDZB 3TUJC 2GEDA 2GNAA 1PAUA 5T67A 3NAMA 2OYCA 2EW1A 1D7AA 3UJ3X 2D2XA 2YRWA 4TVSA 2BLNA 3MTBA 3IPXA 5AI6A 3RYCB 2YVLA 4HKTA 3PFFA 4Q9DA 4XWYA 2YFKA 3AB7A 4H31A 1MAHA 4Y9UA 1Z6YA 2PX5A 4B76A 3AP2A 4FJ2A 3C7AA 4M9SA 4N18A 4EHDA 2BFFB 2EU8A 3OP1A 5G0SA 5C37A 3ANNA 1PTKA 2YWHA 2BZ1A 3HXTA 3KSZO 3QELB 4PG7A 5EPEA 4MW1A 1EIZA 2DUNA 1R0SA 4E30A 5DM1A 3ZHQA 3B5JA 1XL0A 3O4RA 4KJZA 5A71A 2PX8A 2VFAA 1ORWA 2ONCA 3IEIA 3PFNA 3QLVA 4EKGA 5B2FA 4XCVA 1FMCA 3FTCA 2Y05A 3EGEA 2XPCA 1BMTA 1AKUA 1FDUA 1CIPA 2BMVA 4X6LA 1CUJA 1U8YA 3WB0A 3QEOA 2OXRA 2QVXX 3DMFA 1AC5A 3IIMA 5FFNA 1O4VA 1LDEA 2R7LA 1HE1C 4AMGA 1BWPA 1VRCA 4RKRA 1PQPA 3KEMA 1OLSA 1XDWA 3IA2A 3OT1A 4MCIA 3AYZB 1M33A 4KR2A 5LU9A 1MHPA 1URPA 2VZ8A 3KXDA 3QMVA 1RCTE 3IEUA 4INOA 1V2HE 1IPFA 4E5MA 3PGLA 1EQAA 2H4WA 4B85A 3QQPA 3EFOA 1XU7A 1TQ4A 3QQ5A 4CKCA 3TZ6A 3TDMA 3RC9A 4CM9D 5LP1A 3H75A 1DRKA 1Y5IA 3ILVA 3LT1A 4FSXA 3TVTA 3EXHB 2FP4A 3EQ2A 5C4MA 1LS1A 1PWXA 2P41A 1YZHA 2V4ZA 3S1AA 1O95C 2PS1A 5SYAA 1W85A 3DHWC 4RV4A 1Q1AA 3HE3A 1BEEA 1RR6A 3DQQA 4MYRA 1GLGA 3L18A 1EHYA 3VTZA 3CNNA 1LF0A 4KXWA 2Z30A 2J4FA 3OCZA 4F3CA 5KWIA 5A1TA 3JPWA 5F23A 4URXR 3S0JA 4DA8A 1DBVO 3DH0A 4IYRA 1T29A 1VTKA 1DQPA 1MKYA 2IXAA 1RXSA 3TMYA 3DWFA 5CURA 3AOGA 4YCBA 2M1XA 2HHCA 3ZU4A 1VGVA 4XVQA 2XI4A 1ATIA 3NDBB 3VPHA 1ISPA 3C3KA 3TSCA 2O5CA 1GU1A 3I9FA 2P3SA 1D0SA 2JH8A 1G8FA 3KKEA 3ZBUA 3F7NA 1YCFA 1YL6A 5TGDA 2A86A 3MWLA 3VR5D 4EX6A 2L17A 3M3HA 2OHXA 4AO8A 3GDFA 3K30A 4FHEA 1V35A 1RYHA 3DQZA 4I1RA 2II6A 3PI6A 1JKMA 1NNI1 1T91A 2A9RA 4INZA 4OP2A 5J63A 4C1NA 1GYQA 4GOLD 3C3CA 4LRQA 4NOMA 3U4QB 3GT7A 5C51B 3QBTA 5EC8A 4P58A 1HE5A 1SY7A 3LP5A 3OEEA 2OBFA 3GEPA 4BE9A 1R74A 1OIXA 3RUHA 4DUZB 1W7AA 4H08A 1Y9ZA 1U8AA 2RHOA 2YBDA 5JAMA 2TMDA 1GA6A 3VU0A 3MTAA 3RS8A 1H2FA 2JG3A 3AV3A 3M4JA 4QUJA 2XTMA 1ZK0A 3GWGA 1G4UR 1VKRA 3K20A 3MFQA 4OBBA 4OHRA 5FRDA 4L5YA 5IT0A 4OCZA 4OMDA 3UMCA 2V1UA 2BY4A 2B2NA 4XRGA 2ZQYA 3DVAB 4XOIA 1VPWA 2IS4A 4M0MA 1KTVA 1K7XB 2P77A 2Q4TA 3UT0A 2CJYA 1BMFA 2GHTA 2BRUC 2C03A 1YZYA 2R66A 3A1CA 3OU2A 3ETCA 1E2QA 1UK7A 4IL5A 4W9NC 4EY7A 3I83A 2C96A 1FYEA 2UU9B 4B3HA 1CQJB 1C5KA 3JVUA 4KVFA 1RJEA 3L02A 4TWAA 5LQMA 4Y6QA 2VZ9A 2AIRA 3U5TA 3RT9A 1GL9B 4Y3UA 4Z3DA 2OM6A 4MW0A 5CEEA 1LSOA 3W5HA 1OFVA 3NONA 4K9PA 4WADA 4JI8B 1ZC4A 1NVWQ 1SKQA 3K9NA 4CVNA 3QE9Y 1VLMA 3E0XA 5HEKA 2YY7A 1CJTC 1U1GA 3MELA 3VZQA 3IEKA 2VNKA 5LBIA 4Z7NB 4ZN6A 4GDFA 3OOJA 4IDCA 2PH7A 4CLRB 4DGSA 4CKEB 3R9WA 1VKZA 2WDZA 1HDIA 1Y63A 2W2NA 2WJYA 4HAWA 4NU0A 4LRTB 4TZKA 1C1XB 4WRRA 3CUYA 1VKOA 1ECFA 3ZNOA 3PFBA 2JLAA 3CN7A 4DFDA 1SQGA 5LZ4A 2I22A 5C52B 4KX5A 2PEZA 2CY0A 2YXDA 4HAYA 3KZMA 2BMAA 2JGEA 4JCCA 1A5ZA 2O8BA 2WD8A 1KIMA 4WGFA 1J2YA 3FYUA 1FRQA 3QKSB 2RIPA 4Q1CA 1SQSA 4QG7A 3AFMA 4PC2A 3ZCQA 1U0RA 3EX7C 4K1LA 4K6HA 5EE1A 4R9SA 4YT2A 1KSFX 4GEKA 2DTXA 3OOEA 1Z74A 1FUUA 1OQAA 2AJTA 5JDIA 1REQB 1CUBA 3IE0A 4MGEA 4MRPA 3B38A 3OZIA 1VSQA 1SCJA 4C7KA 4DSNA 2ZJBA 3WQBA 1JU3A 2FFAA 5I4IA 5F51A 4GOKA 2PA3A 2IYLD 1RWXA 3WRYC 2ECOA 1Z16A 3A3YA 3C7CB 3QSYA 1H69A 2JFXA 4JT8A 2VPXA 3LFTA 4D92A 4K3UA 4XCXA 2FPGB 2EGHA 3HU1A 5ALNA 5KDLA 3G8AA 4UVDA 3WIUA 5B30A 2WIGA 1CULC 3LUKA 3ZD6A 1CUFA 2B6HA 3E9RA 1U11A 2Q0HA 4QO8A 4KB5A 1ZHVA 1Z2CA 3O8OB 2CVHA 5IM5A 4EOGA 2P68A 4CIYA 1EUDB 3EHDA 1RJGA 3ZWXA 2Q6LA 1LV7A 1TECE 2X3FA 2WJVA 4M6WA 5C0OE 2YX1A 2WF5A 2QQ5A 2OCDA 2NPOA 3W5CA 4P34A 2VNHA 1CQWA 1C0EA 1HURA 3R3UA 3E8SA 1LV8A 2PGOA 4JVMA 3WNDA 5HNKA 2B8JA 4DYVA 1WDMA 3TSZA 1NVMB 3EJ6A 5TPWA 2PX3A 1IJKA 2WWWA 3EAFA 3GRFA 1KYWA 4GS5A 2I6SA 1RCFA 2VP2A 4XDGA 1HFJA 3PRJA 3BGOS 3WAGA 3NTVA 1BD3A 3ESYA 1ZG3A 3C1AA 3OQIB 2BGIA 3OZEA 1J1UA 4RMNA 5TQ0B 3LZ6A 4GBGA 3ETHA 4ZMRA 4ZIRB 2IXFA 3KYDA 5AH0A 3TR0A 1WZIA 4FGWA 4B6FA 2GK3A 1X2EA 5ILOA 4ZODA 4PG8A 3LRXA 5FX2A 2CFOA 2IXDA 2PFKA 3KPYA 3P9PA 4W5WA 3IHTA 1OREA 3CZQA 1S9DA 4D25A 2HA7A 1CUAA 1SR8A 3UK1A 1JHPA 1UMBB 2CXSA 2HDHA 2QM8A 3ABZA 1PDWA 3E15A 5LD2C 1CWUA 2FDRA 2GH1A 2W2PA 3GUYA 5AXAA 1UINA 4TQUS 1FSZA 1YGYA 2XRFA 4I2VA 3OZ7A 4FKMA 1KDZA 1UZNA 1EDEA 4GP7A 5MN4A 4CM5A 4UD6A 1NXSA 3KHKA 3O2NA 5AW1A 1VJTA 1GG8A 2E6KA 2IRWA 1JAXA 2ZAOA 5IAJA 1JA1A 1WVIA 2QTZA 1B0UA 2W6ID 3CRMA 4KFUA 1IEVA 1XKTA 3IVMA 2WZBA 4IGIA 5T3UA 3IAS1 2HEGA 5DN9A 3RSSA 3I53A 4CJXA 1WW3A 1T2FA 1DCKA 1F12A 4GP6A 3G5MA 4DCNA 4ILEA 2AUMA 1J0EA 1T3LA 3MINB 4JUIA 4UDOA 1AZLA 4TZ0A 4XFDA 3HCPA 2W2KA 3NYQA 4JJ7A 4C4RA 1DAGA 1C7EA 1NX6A 1WW8A 3L43A 4I4TF 2Q1SA 4ZVPA 2CYAA 2WWYA 3L0SA 4F2WA 1GTG1 1CLEA 3ZDCA 2NNLD 3ODPA 3Q7IA 5HZGA 1A76A 4HSEA 3V2GA 3FROA 4LEIA 4QEKA 2FSPA 2G4VA 2LD4A 1BMQA 4MUBA 4Y9SA 5H3CA 2Q4EA 2F43A 1VHLA 3ISJA 3PFGA 3KLPX 1TM5E 3F90A 2R87A 4K6KA 4X91A 2V3WA 5BN3A 3IO5A 5KYYA 1SKAA 1XZDA 4J2HA 1ZQ9A 2A94A 3QWIA 3QWBA 2HPZA 1QHHB 3HSSA 4W8GA 1NP6A 3M81A 2Y93A 4A6DA 3N2NA 4PLCA 1J00A 1UDCA 3DPIA 4B5KA 5FHQA 1VBNA 2PS9A 3OCCA 2I7XA 1NN5A 2P0EA 2W6QA 2O1XA 3JQFC 3K0EA 5FPSA 3EPKA 3N8HA 3O8LA 1YOBA 3KELA 1BU5A 1ZNQO 2I54A 1ZH0A 4HLUA 2C59A 2G28A 1RPJA 2QNRA 1JEJA 4V0LA 3LUDA 1P5RA 2XDYA 4KHZA 3ZDZB 3D3WA 1Q1BA 1LZKA 1T8TA 1P7WA 5BUSA 4NEQA 4YEDA 4QDZA 4MDFA 3T3HA 5AI9A 4G8JA 4K88A 4DIMA 4UHBA 1FVFA 1ICEA 2AI1A 3HMKA 4XA8A 5IEBA 4MB2A 1ECBA 1N7GA 4GWKA 2B78A 2RHMA 1BS2A 3MAJA 3TJMA 3TNLA 4HNTA 2GD0A 1V1RA 3GJ8A 4H18A 1I7QB 4Q34A 2JHPA 2HMVA 2GDJA 2QROA 2Q4RA 3LM8A 4AZTA 5JNWA 3W05A 4K9OA 4DCSA 1O7JA 2BT4A 3KR2A 4K3VA 3Q5GA 4FFMA 3E7XA 3MIIA 1ORHA 3SSNA 2R85A 2G1KA 3D3KA 1DZIA 4O6VA 1P17A 1DGQA 1GCOA 2XHEA 3CJQA 4QPZA 3VOAA 3P9QA 3HXLA 1KJNA 1YNOA 3GYGA 2RH5A 3TW0A 2JFWA 5LLTA 1K63A 5JNSA 1M1XB 1UBJS 3WMEA 2G36A 1YZQA 1ADYA 2X1MA 5E7QA 5ED0A 4UATA 1LD3A 1GZSA 4YGXB 4ZU1X 4D3DA 3WIOA 4KN9S 4AF8A 4BJ5A 3ZI4A 4FUTA 1RHRA 4UNPA 2GZ1A 4DQXA 1YS9A 1JH9A 5SICE 7MDHA 4UHJA 2QY6A 1OSNA 5GVSA 5JYCA 1KP2A 1RXWA 1KDYA 1Z28A 1RJWA 1E89A 2D7JA 4NR0A 5IAGA 1ZK1A 3RFTA 4L8GA 4JN6B 4HFMA 3RIHA 4E4YA 1I13A 1YS6A 5BXQC 4GR5A 2PUVA 3LPDA 3O8QA 3OLXA 1RWOA 5K51A 3PX3A 4C22A 1GSHA 2B3TA 3VR3D 5JD5A 4YDQA 2Y77A 3GA5A 1SZDA 1M8PA 1X7WB 2ZSBA 4JLDA 4QHYA 4PRKA 1VJ1A 5I8PA 3ADCA 4K8RB 2X8LA 4LHXA 2Y1KA 1CUUA 1ZD1A 3DWIA 4MSUA 3BGSA 4EVIA 3WGJA 3ZU5A 4DIOA 1FLDA 2BM0A 4M1SA 3R44A 3WQHA 1L7BA 2FJUA 2FW9A 1Q21A 4YUXA 3BA1A 5AJHA 4DCVA 3T3MB 4WZ6A 3BXZA 1NMYA 3WO0A 2XR1A 5JCPA 3C70A 4GL2A 2H2AA 3F47A 3IEXA 4V3BA 2CJFA 1JILA 4PCLA 4F45A 3W6PA 3OE5A 4KMMA 1SA0B 3FNHA 1KY5A 2OCLA 3IP5A 2E5WA 4TLAA 1GSAA 1LPNA 2ZRPA 4DAEA 3QA9A 5U4XA 5JVDB 1N5KA 2ZRFA 3N2IA 4WIAA 1KY3A 1DKNA 5EWMB 1E79A 4K6MA 3WNVA 4C0QC 4YUYA 4JI2B 1U7HA 1GFSA 1O96A 3HKEA 1RZRA 1OE0A 4X60A 2QENA 4QU8A 4E31A 5A02A 4C6TB 4KE9A 1BGXT 1U2GA 4DDTA 1HSOA 4QUEA 4CT0A 4IRUB 2Q3CA 1U7UA 2ZK7A 3T3PB 1DPGA 1GZDA 3H1AA 5CDSA 3HWX1 4WXMA 1IHYA 4EY5A 4PYOA 1PJZA 1BXRA 2I0FA 4NZPA 2JIDA 2HWWA 2W43A 3NHLA 2C83A 4AWXA 4BZWA 1VL5A 1IY1A 1RQ2A 2AXNA 3GDGA 3K4QA 3PG5A 4I3FA 1VDMA 5TQ2A 3VAZA 2DFDA 2I87A 3VU1A 3T6KA 4CBVA 1DTWB 5HTOA 2WM8A 2D13A 1PIWA 4UUMA 4WBNF 1P8JA 1WG8A 4D6PA 2WG0A 2Z4RA 1VL2A 3KZNA 2AFIA 3AR5A 1R5JA 3NVMB 5GM2A 3WYGA 4DDHA 1Z88A 2V7XA 4OLAA 4A0RA 5JC8A 1AGXA 2XRZA 2IPNA 3EPPA 2JVKA 3TUIC 4HUTA 4KTVE 4QXQA 1QS0A 2BBSA 2YJTD 2V0CA 4NZZA 7MHTA 3A9VA 1L4MA 5D2CA 4JI0B 4D3YA 2B4YA 4HB4A 4RHEA 3RBVA 4J6EA 3IAS6 3UICA 1GPBA 1B15A 5JMOA 5JDCC 2EFJA 5C1PA 2ZUEA 2VR1A 1CE8B 1E9DA 1ELOA 1KR2A 3HB1A 3JQ9A 4B8WA 3R3XA 4NBNA 4ZQBA 1U3UA 4MMYB 3PV0A 2XYRA 4GKBA 3WZLA 1OFIA 4IZOA 1CR0A 2RK3A 3ZD9A 1Y6RA 1EFUA 1YDMA 4INAA 1W49A 3IPLA 1K68A 3E4DA 1IJEA 2SCUB 2O2ZA 2OBNA 4Q48A 3LL4A 3NTXA 4WFJA 2IS6A 3GY0A 4MEJA 2VWHA 4OXKA 3C14C 4ZVTA 2C95A 4KG7A 2OGSA 1H2AS 4H1HA 4BN0A 5KC9A 1T9ZA 4RHFA 1K5DA 2DHQA 3R5KA 4A23A 1GO2A 4C5AA 4AJJA 3DO5A 1BW9B 4GHWA 1TZCA 1E4VA 4IDBA 4K05A 3FNBA 4YVFA 5FOUA 4BAZA 2IBSA 2JPDA 4FW9A 4B09A 4OAPA 4QYIB 3OMXA 4YO8A 5A4KA 3B5IA 4JFAA 2GASA 2FPIA 3T4UA 3AHIA 3D54D 2TSYB 1NZDA 1YC2A 3CO5A 2FMUA 3FHOA 3OQPA 1CIVA 4PS1A 4WINA 5DLEA 1YR6A 2PUAA 3VZRA 1HSZA 3VZBA 4YJDA 1SK8A 2VS1A 4RIGA 2G5CA 3KOOA 4KWTA 1JQAA 4ENUA 4YRNA 3OJLA 3FPHA 4ZJPA 5FL7D 2GJ8A 1E7RA 2HBYA 2QMOA 4INPA 2OSBA 2XWBF 4RGBA 4E2XA 2F1JA 1ZRNA 1W75A 2NYRA 2DPLA 5LQUA 4LJAA 2WUWE 1DJLA 2RH9B 2ZR9A 5IAAA 1L7AA 3ZH9B 4TYWA 5CR9A 1XYGA 5AWFC 2OXCA 3HL0A 2GPYA 4RFSB 5JZBA 5FL3A 2D3WA 2XTZA 4IV8A 5KOYA 4ALMA 1NDHA 2FX2A 2X7HA 3D8RA 3SM3A 1HY3A 3BXEA 3T4EA 4O1HA 1OVGA 3DE3X 2EJWA 4U7WA 1NRIA 2QLJA 2JLVA 3WGYA 4RJIA 4XR4A 5ALPA 2VKTA 2XCIA 3JRWA 4EI7A 1YQ9A 3GEBA 3DNPA 3RRNA 3N5CA 4XVUA 1GT91 2GNPA 2PZLA 3E2MA 4JWKA 5BVGA 2BGWA 5ALTA 1HA3A 2FSHA 2R6CA 1GZUA 5J5AA 4G86A 2IEIA 1A7JA 1E6KA 2CVPA 1BKDR 1JE1A 4KPEC 4Y0AA 1AVTA 1F4PA 2ZRBA 3ZEAA 2PUJA 4F2PA 2BKEA 2QU7A 3EEBA 3GJSA 5CEJA 5HRUA 3OSZA 3L93A 4CV2A 3RYCA 1NBOA 1YU6A 2OO7A 3D0KA 4MV4A 4PPFA 4U0JA 4PXYA 1NPDA 4QTYA 2QORA 4CI0B 3FA2A 3O90A 3CF4A 1X70A 2CW5A 1ABBA 4YRMA 3AJEA 2BFFA 2C1XA 4KDEA 2E4VA 3RJTA 3VDRA 3SIRA 3G82C 5EHIA 3KYCB 1VYHA 3NWPA 4TUYA 5HUJA 1T4CB 4U63A 5IUKC 3H42B 1E4EB 3R4CA 4GM4A 4MHSA 2YZMA 4E1BA 1J5XA 2QE7A 2QT1A 1GG2A 4Q1AA 5IDVA 1XMJA 5ES4B 1LK7A 4HH4A 3DMPA 3AEZA 2O8CA 1PJ2A 1WW2A 3RW9A 3PPIA 3OZAA 2E4YA 4AJOA 3GB9A 1OAKA 2O7QA 3MJSA 4Q3LA 3ITKA 4EFLA 1MB2A 3IKJA 1GIAA 3BG5A 5HFNA 5HYVA 1JZTA 2CVZA 1Y5RA 2R7KA 3OC0A 4O25A 1JTFA 3TNJA 3QKUA 4CNBA 1THGA 3GFFA 4HWTA 4YV1A 4MPPA 5EE9A 2QT9A 2I4NA 3LG2A 3QEMB 1K0UA 4JQSA 1DO8A 3E1GA 3N8GA 2EG5A 2VNAA 2BAGA 3V3TA 1EFCA 4LWQA 1R6TA 3CW8X 3DTVB 2GK7A 4L8YA 3TXYA 3C3DA 2H31A 3NMUF 4HYQA 4ZVUA 4CLOB 3MTGA 4JYAB 4MP3A 1GKUB 1Y8QA 2BVNA 3PI7A 5AIAA 4CLEA 2HQOA 5HSGA 1N8SA 4RK0A 5GIOE 4B7ZA 3BTVA 1FOEB 1EUQA 1R5BA 3D6UA 4JDUA 3ZWOA 2WAXA 4X1OA 2JFOA 1GZ7A 3MGAA 4KQ6A 3DDCA 2OKCA 1P1FA 4LYAA 5JH7B 4AQYB 3HB0A 2IZ7A 3IDAA 3IOEA 1G64A 3UPDA 2HK9A 4MVWA 1NVTA 1KEEB 3EIQA 4QD3A 5FOTA 5LUAA 4PX5A 4A8TA 3EYAA 5CT5A 1LPOA 3QUSA 3KUDA 4BMYA 1S1CA 5EJAA 4DLVA 1DEHA 1QFXA 5TR9A 3KXLA 3FI0A 2W2MA 2Y1WA 3II6X 1QVRA 2GXSA 2RD2A 2BZ0A 2OHIA 1HE3A 4X65B 2AYZA 3NTOA 4RKWA 4RGQA 3LJKA 2I1VB 3VSAA 3RFCA 2V7QD 1V8ZA 3BTUA 3Q0IA 2CMKA 3KJHA 4JX8A 1S2NA 1TYAE 5AHKA 3C45A 3D3QA 1AGPA 1P4HA 3G6WA 4MB6A 4KO4S 1J8YF 3JAKB 4W6ZA 2P2NA 1GUYA 2DPYA 4MWDA 3SICE 3TQRA 1RAHA 2GKOA 2ID4A 3TZQA 1F51E 4Z2YA 1XA4A 2UZIR 4PO1A 4CM7A 1DX9A 2HU2A 2I3BA 1KI6A 2QX7A 2XMBA 4ZOEA 4I1SA 3CF2A 3ELWA 4MR8B 4Q6BA 4S1OA 4YCNA 2GN6A 2I1WA 4QZVA 3NEJA 1QHIA 3H99A 4HGOA 3ESCA 4MEBA 1PZHA 4HZGA 4WPGA 4F4FA 5ITSA 2BGGA 3FVQA 2GRJA 2Z43A 4IG9A 2YMPA 4E5NA 2PUBA 3TRHA 2VUTA 4M88A 2AJDA 2XUHA 4OSOA 2V6FA 3R9KA 2P0AA 9LDBA 1OBHA 3UYLA 3PTZA 2TS1A 4BMVA 3M4XA 3VOBA 1DTEA 2Q41A 3B89A 2VYVD 4UM7A 4D0NA 3DP9A 1CDEA 2CVQA 3KOXA 3LUBA 3OUUA 4E5UA 4M54A 2Q1XA 3L4EA 5GZ1A 3C20A 3N2KB 5I8ZA 1IB6A 5AM3A 3R6GA 3OJXA 4FMDB 3OFNA 3W2GA 1UKCA 3CTPA 5IPFA 4KU4A 1DXYA 4G1EB 1EXVA 4KN6A 1OTXA 2NVBA 1EA7A 2XUFA 2QXUA 4QOHA 3UC9A 4AZ3B 3JU3A 3MMPA 4OHBA 2VI5A 3PJFA 4DIFA 2J5QA 1SCQA 4KQ1A 4RVSA 1X80A 4RIHA 5DK6A 3JQGB 4C87A 2ZWMA 5A05A 5LZ9A 3VOTA 2ABWA 1P1CA 1ZEMA 3ORRA 4PHGA 5CLIA 5ALQA 5ALJA 3GGPA 5K3SA 4C43A 4X71A 4L3OA 3C0KA 3L0ZA 3AW8A 4RSRA 5HXAA 2E0IA 3GCXA 1UBHS 3U3MA 5JEDA 4BO3A 2ZB4A 3EGDB 4G5FA 5HGJA 5EIOA 2AC7A 5DH9A 3MRSA 4IUBS 4DMGA 3NHZA 1B41A 3LP6A 3Q9NA 4YXWA 3WOVA 3HDVA 4TS4A 2A9VA 4MK4A 5F1OA 4CLRA 5MFPA 3UJ7A 2GFHA 3G5AA 4OI1A 1C1YA 1QIMA 1IOLA 2A0YA 3DT6A 1KIAA 2GA8A 3NM6B 3QSGA 4PAMA 1ZJWA 2KM1A 1PJCA 2Q27A 4HLDA 5D8DA 5H59A 3GRVA 3L6CA 4QPPA 2FHSA 4ARUA 2H59A 5TB5A 2NP6A 1T15A 3FPJA 2BHSA 3N75A 4DA4A 3A6ZA 5C7IO 4N5LA 3ORSA 2NM0A 4XLZA 4ZRDA 1ORRA 3QU5A 4V0SA 1RWWA 1V3UA 4JC0A 4M1TA 4ZC8A 3C43A 1BGWA 1VB5A 1A0OA 3BCHA 2JFYA 4PNZA 1N32B 5DNAA 3PNLA 1HT0A 1XRLA 3DR3A 1TFRA 1REQA 4MVCA 1XDGA 4MTLA 1RI4A 4AF6A 4R0MA 3UQZA 1XXHA 2MU1A 5BV2P 4FKBA 3GGJA 2EEZA 3UATA 5B1EA 1R3UA 1TQHA 5LP6B 4EKIA 2C98A 1R1DA 1TADA 2BE7A 3CJRA 4EG6A 1ENPA 1RWPA 1XKXA 2JLQA 1F8XA 1NULA 3WADA 3WLQA 3MQFA 1IN7A 2FU5C 1QIHA 4KV9A 3HYLA 5FKJA 1RJFA 3DL0A 1WPQA 4JJIA 2XLBA 2VDVE 2FX5A 3OZCA 2DGDA 3HVKA 5JS7A 1NAHA 1FXUA 1KL7A 5FNVB 3VJMA 4QICA 3PUKA 2WINI 4MQMA 5EJ7A 1Z0SA 2RDMA 2DPXA 2ETXA 3GQBA 4BNUA 3O8OA 1GNRA 3K70C 1E2MA 3O91A 2O9JA 4R68A 2A9QA 4RW0A 3UJ9A 4B0OA 1J99A 121PA 1OT3A 3LWDA 3P5BA 5J47A 3BILA 3TLEA 3H2ZA 2RH8A 4URYR 3AUUA 3B9PA 4H3VA 4BZQA 1JR2A 2ZREA 1G8PA 5IJZA 4BXOA 1TGVA 3HGQA 3SGLA 4MQ4A 4PW0A 5IS2A 3M83A 1U31A 4K2AA 1V9LA 1RE0A 3IKTA 1ML4A 4DIBA 4YLYA 3A14A 4A0FA 3HVIA 3RVMA 3JWJA 3QNWA 4IOJA 5AI4A 1BVHA 4YUZA 1Z5GA 3O4JA 4N39A 2FKNA 3NM5A 4ND6A 4QQKA 4AMVA 3OQIA 4Y0NA 4C76A 5GJWC 1EEHA 2ZU0C 1X3SA 3U3KA 2Q21A 1OHHD 3DZBA 3LA8A 3S8YA 3G0BA 1GFIA 621PA 4IXNA 1BXGB 2AZTA 4PFQA 3SZRA 3R0ZA 1RQ7A 4G6ZA 2X8BA 4MP8A 4OGWA 2PUGA 1CDOA 2R97A 2GCOA 5KTMA 4PBSA 1KYXA 3NHSA 3KBBA 5IDWA 3A1SA 1HTTA 3NIDB 2Z2IA 4JJ6A 1RM0A 2C9CA 1ORTA 2QN8A 2FW8A 4ALLA 5JO9A 3CKYA 4G84A 4WCFB 4YDRA 5TY0A 6NULA 1BTOA 2MSKA 3HPQA 3VR6H 4LF8B 4LMAA 1L7MA 5FI0B 4O1MA 5HUHA 2B34A 1YK1A 2QTLA 3NT5A 5JLJA 1KI3A 1DAOA 1T0IA 1Z0UA 3EC7A 4GT1A 4EB0A 4EL5A 3F78A 5ICGA 4J2OA 2DKNA 3QY0A 3KG2A 2NU8A 3STUA 3LIPA 1QBGA 2HU5A 2AXPA 3GEDA 4FSHA 4JK3A 3O94A 2W37A 4TTTS 1CNMA 1L7XA 2C4MA 1H2ZA 1RQRA 1VLHA 2VXCA 3O6VA 2DSTA 3O4HA 5TGZA 3HVRA 2QZZA 2A0UA 2HLHA 3EJWA 3OD1A 5AKLA 3UAZA 5LXTB 3TINA 1MQSA 1SIOA 1A2OA 2MSWA 3EVCA 3MINA 2IYQA 2AFIE 3PR1A 2A4MA 1NI4A 1X0VA 5F12A 4H7FA 3T4PA 4C08A 4Q4CA 3JQPA 3QLUC 5DMXA 5DNEA 4ZCIA 2ICAA 4J91A 4AX4A 4PLZA 2BOVA 5ANRB 2OKGA 5I9LA 1JHAA 3DZKA 5AKYA 3AB3A 5A03A 1HDZA 2AD1A 3PDJA 1ZH4A 1FFXB 3O1LA 3OLYA 2BKVA 3BSYA 2XUAA 1MOSA 2P1DA 1W1UA 4YCSA 4ZYLA 1U1EA 3V1LA 3EVAA 1SVWA 4OEHA 4UDNA 3DXFA 3FPEA 2WUEA 5LL6P 1IZ0A 1JWAB 1RT9A 2IHJA 4MUKA 3VYVA 1C3EA 2ZBEA 1MXFA 3WL4A 1VMDA 1YZVA 3OY7A 2VSOA 3S29A 1UBOS 4EP1A 1R9GA 1M1NB 5CEFA 2DT5A 2WV7A 3KK0A 5CLHA 4I9GA 3C7KA 3BQNB 2PZAA 5JE8A 3V97A 2OZLA 1ORIA 4EQ6B 4D8YA 5KYNA 1Q19A 3H5AA 4LJ4A 5JZMA 1ABEA 2AHOA 4G1VA 1MW9X 3DOEA 4BNWA 2FF7A 2GN9A 2DCUA 1RTKA 1Y8RA 5I7UA 2CXHA 2I78A 2F1HA 2Q29A 4M9QA 4EB6B 1V43A 3U7QB 4HI0E 1Y7IA 1NKSA 3TW4A 4RJKA 4YGYA 3OUZA 1YR2A 2QQFA 3B7PA 3W5UA 4IJQA 1XD2B 2YDXA 1YBHA 3ZZ0A 2GAFA 4B44A 2QRVB 1ZKMA 1RHMA 5L3SA 2YTZA 3OE7D 3G0HA 4QAJA 1FTGA 3D6HA 1VRWA 2XB9A 1YB7A 3C97A 1I24A 8AT1A 4QVIA 1CUXA 4WXEA 2DWCA 3RYIB 4A2WA 1BDJA 3G89A 4A3SA 4AS2A 5AFSA 1LBTA 3QZUA 2H1FA 2PTGA 3O82A 2WR8A 4Z51A 3LKZA 5FP0A 3ZBQA 1OTYA 3C6BA 2WWHA 2WE7A 2ZRDA 4NNJA 2FSFA 2YICA 4RUKA 4LE1A 1IBKB 1RNLA 2PGAA 5TV2A 2AFHB 2WYVA 1Q0RA 1HLPA 1YR7A 2BM1A 2J33A 2PGJA 2PGIA 2VJKA 2BSAA 4KOEC 3P9RA 4GI2A 4KXLA 4QKQA 3FCXA 5DWVA 2OBBA 1ATZA 3TW8A 3GZNA 1VXRA 2PR7A 2D2VA 3FTPA 4J0QA 4NPCA 4Y6SA 2WHRA 5BSUA 4ZMSA 1HT3A 1UXOA 2QPLA 4D97A 1M6VB 4Y2HA 1XL1A 1PNTA 1W9HA 1ZNZA 3NEAA 3QUTA 4KE8A 4MR9B 4MUHA 3TTVA 1B8NA 5HZHA 3FHTA 1PJLA 5K8CA 4RD1A 4WNIA 2JDID 3ESRA 4BVGA 1YHYA 1Z5OA 1JTEA 1YQXA 2YWCA 3EC2A 4FJ1A 2QV7A 3NWBA 3C3EA 1GPLA 1XCGB 4NCJA 1JT9A 4U6SA 2P7HA 1U9CA 4OXNA 3ZCPA 1TAUA 2C7VA 2LW7A 2FMKA 1W5AA 3IJRA 1PG2A 4DDUA 2XTAA 1JQEA 5I9BA 2HBRA 2QN3A 5SYNA 1EXWA 2YWFA 1F38A 2WB4A 2BMJA 1SCKA 4QJ4A 1N4AA 4GI3A 3VM6A 5ITZA 5AW8A 2YZ7A 1M8GA 4PSVA 3O1IC 5BV7A 2I9KA 1FW6A 1NV9A 4BV9A 4MS4B 4M21A 5EMMA 3ASUA 1YAJA 3SPXA 3LYAA 3RROA 4Y1EA 4ZC1A 4P5PA 3R4VA 1CYDA 1OILA 2XMCA 3UWKA 5JYBA 1TJPB 4S0ZA 4JHXA 1FPMA 3L8FA 4HQRA 1M6YA 1ZM7A 2EP8A 3QNUA 4P53A 3TLAA 5B58C 3OKPA 5DTQA 2ZT8A 5D7BA 2IYRA 5KYVA 3A3OA 1MB9A 2YH2A 2Z1NA 2IDJA 4GWGA 5A7FA 4DSOA 4WN9A 1M6EX 3ZWQA 4F46A 1D03A 1WKCA 3DJYA 1Z4LA 3OM1A 5C4GB 3RUEA 1WQ1R 1E6LA 1X1TA 4J1TC 4K40A 2HCFA 4G89A 3T5MA 4ETNA 1XPUA 2JARA 2OT3B 2JLXA 4YIKA 3KVVA 1AHNA 3IDOA 1FBTA 4MDYA 4ZOCA 3EVZA 1US8B 2EF1A 2W8BA 3GD5A 1R0ZA 3IQWA 3V8VA 3MWFA 4WZBB 2QL6A 2H7VA 3HVHA 5CNKA 2YQZA 5DHRA 10MHA 1D6MA 2FRDC 1ZNWA 4M1QA 3V1TC 4D4LA 1RZ3A 1M8KA 3QE0A 5ES3A 2A1TS 3W8EA 1U2QA 1DTWA 4MKIA 2OQ2A 5F3WB 1BXKA 3QE2A 4Y6PA 1NLYA 2ZVJA 3DDUA 3WX0A 2H52A 1DDIA 2SICE 1OD6A 3JQRA 1XB2A 1KO4A 2G3YA 2JFQA 2JS7A 4PTZA 4IICA 2ZG6A 4MMZB 1HDXA 1NPYA 2A5YB 1UBRS 2YNMD 2AUNA 5SZHB 3ZGLA 5LOVB 2J3JA 4I0WB 4RAQA 2FEMA 3GGOA 3G8CA 3KFVA 4G4SP 2CXRA 4HH3C 1HDEA 4MVYA 4UU7A 2R84A 4R1QA 2UYHA 4C06A 4NWIA 3VVBA 1EFPB 5FBVB 1M54A 3K8QA 1KSJA 4LOIA 2XWSA 5BORA 3QW4B 4EKDA 2ZJ7A 1A2BA 2C4KA 4RTQA 2DUMA 1CE8A 2Z1MA 4LW8A 4ZV9A 5I5EA 3KAPA 1XZKA 3PFWO 4AXBA 1ESNA 3D7RA 3NH9A 4B5LA 2DT8A 1ZD2P 1XKLA 2X1VA 4MAFA 3SKXA 1VCNA 1ZLXA 4G1CA 4IG4A 4KVGA 4N40A 3FKSA 2O59A 1NNUA 3CLKA 2ZI3A 4YFVA 4YPVA 1Y80A 1KETA 2W7TA 5EIBC 2CUNA 5I01A 4D57A 3EVBA 4OTZA 4WLUA 3ZS9A 4ATNA 1MGOA 3IPRA 4LY9A 4MWSA 4PFSA 4R2KA 4AJKA 3T5CA 3QWHA 1USWA 3KWJA 4HS4A 1ZBDA 9MHTA 2PZMA 4CL0A 3EXFB 3NV7A 4RF5A 5A5FA 3CWQA 3Q41A 1XZ8A 1CSEE 1N0WA 2OO5C 2W6JD 3MWDB 3OTGA 4LVUA 1ACJA 1EK5A 4NTZA 4CIBA 3AKZA 1MT0A 2QS9A 4DA7A 1DQZA 1WSAA 2BEJA 3JQ7B 1EWYA 5AKJA 4ZRNA 2CN1A 4RETA 2QXTA 3C3PA 5IHXA 3TF5A 5KTPA 1CZOA 3KT3A 1Z4OA 3Q7RA 1KHHA 5EQDA 1JT2A 4L50A 2IHKA 4PFJA 2Z04A 4PGMA 3I2HA 5IM4F 3KQUA 4NBWA 1FDVA 3GRKA 2BGTA 1ZICA 1Z26A 1QH9A 5BSFA 3GT4A 3AZQA 2O3QA 1Q50A 1W5EA 3TRJA 3ZDXB 2G0AA 4KI7A 4TM7A 5EIAA 3TBHA 4B3GA 4QBKA 4MPJA 1Z0IA 1ZD8A 2YVAA 5BMVF 2AG8A 3BMCA 1T2NA 3DDSA 5T4EA 4JC8A 1G3RA 3L7LA 1SXJC 4GI5A 2SNIE 4OMFG 3DDOA 1JKJA 1KOFA 3NOXA 4HADA 2LKDA 1RC0A 1E3SA 1R8JA 5B64A 3E6AA 1JHYA 4OHYA 4QBIA 2WFZA 2P30A 4CN8A 2O2YA 1CY6A 1RM4A 2COEA 1XRMA 3AVVA 1N77A 3EVDA 1EK1A 4DZRA 4F6LA 5BW6B 2WTMA 5K99A 3DZJA 1KQPA 4M9ZA 3FUVA 3IVRA 4RM2A 4E1AA 3Q88A 4MW4A 4BX0A 3ICEA 4ZU6X 2FOIA 4BKOA 2ZTHA 3G2QA 2MJLA 3V9AA 5LA6A 3JR3A 2H08A 2PZ8A 2GETA 1NA5A 1A96A 4QO7A 3HKCA 2NUAB 3CLTD 2BM9A 3I61A 2Y1GA 3U4DA 4IF6A 4AF7A 1CVRA 1T4DA 4WLFA 5AVXA 3F5MA 3NJ4A 2VAPA 3U7HB 3TXAA 3K0AB 4TLCA 3I5AA 3R0JA 4LSWA 1YRBA 2C5FA 4Q19A 2UUCB 1R18A 3RKSA 2JASA 5ECYA 1N0IA 5A04A 3W6NA 2PJRA 2PBRA 4IEIA 1PJSA 3AWDA 1UT8A 4MW5A 3T3NA 2C0PA 3AB8A 1NSTA 3U7IA 1A4RA 3SQWA 2WG1A 1SMKA 2EWWA 2ZIXB 1T4CA 4DREA 3TFWA 3TSYA 5HPYB 3FNQA 2FSGA 3OUTA 1BD4A 4JIGA 2DQKA 1LI7A 4BP3A 3WIBA 4ESOA 4JMPA 1YKGA 4R9UC 2PZBA 3JZAA 2V58A 5JPIA 1GNQA 3CXRA 5LWQA 4JC4A 1O3YA 1RKUA 4L78A 1QOQB 1DIGA 2O0KA 1U0EA 2JAQA 4XEHA 4BN4A 4ML3A 4D4JA 2B7BA 1O0CA 1QR6A 1KVTA 1CNEA 4ZANA 2C2YA 1I51A 2XQKA 4PAGA 4NEHB 1H1TA 4OM8A 2PEYA 2ACKA 1T5TA 4U2DA 4WKPA 1XMXA 2VT7A 4GXQA 2H11A 4OV6B 3NUQA 3JQBC 1TT7A 3DTVA 4OX9Y 2CE2X 4TYNA 4OXQA 3IR6A 4L5IA 2CLHB 3EDRA 4REMA 4Q4AA 4S24A 1EBFA 3RS5A 1FLVA 5FTLA 3RO7A 1HK7A 2OUKA 4DVJA 3V7FA 4E3ZA 5LWHA 3CT4A 4B9AA 2QE6A 6ABPA 1AF4A 3C5VA 3IPAA 1M2HA 1RCUA 1WXGA 2H29A 3MCAA 2FZ4A 5JH7A 2UDPA 3Q10A 3OESA 3UB2A 3CZ4A 1KH1A 3GQVA 1CS4C 2GQ0A 4KI0A 4WJLA 4KIUA 1L4BA 1P1IA 3WP1B 4CQMB 4L6IA 3E9DA 3N8IA 4JSTA 4F5EA 1F7UA 5IBRA 4LDRA 3CSUA 2H9YA 3O4GA 4LRSB 1PUIA 4YWHA 3ZZMA 4DL9A 2WPDA 5F7XA 1K08A 4MVJA 1DLIA 5K05A 1WDTA 2J8ZA 5TF0A 4CDNA 2VSQA 4KFRA 1P3Y1 2G71A 2WTBA 5JXIA 1XMPA 2YOHA 1JQDA 1NJ2A 4XD2A 3TOZA 5BQFA 5AVZA 4LYJA 5B3JA 5FTNA 1JSLA 4O63O 1JZQA 4ER7A 3LHKA 4M0DA 3L84A 1FQOA 5AKKA 4PYKA 5CA0A 1AQIA 1F3OA 2VIIA 3RVKA 2WP8J 4BKQA 1JDZA 1K3FA 2UUAB 1PZNA 3WIDA 5F2EA 3LCCA 2VAWA 4URUR 2BV3A 1UWVA 2CFSA 3DEYX 1OX6A 4BVAA 5K0GA 4UQPA 3QMWA 1WD7A 1WUIS 1E69A 3JYNA 3ZEIA 2CBZA 4UQOA 2AKEA 1VDZA 4UOQA 3PUZA 3LX5A 3K6RA 2QVYX 3X44A 3IJEB 1EFKA 3TKAA 4RIFA 4YFYA 2DLDA 4E0BA 3AXSA 2J6IA 4RMJA 5AJWA 4XB2A 4AJNA 3CUWA 4JJFA 2A0FA 4YTEA 4WZAB 2OEPA 2N9UA 2HB6A 3VGJA 5HRAA 2QSZA 2NSDA 1W48A 3DF7A 3BK2A 1HNWB 3CE9A 4FNMA 4P83A 1R8XA 2ZYUX 3KTDA 4Y2QA 5F2KA 5EGNA 4OKSA 4MWGA 4O4JB 4HGYA 2QL5A 1N2OA 3WBFA 4EKYA 3K70D 3JQGA 1NVVR 4N8DA 5FADA 4W7IA 5BUZA 1BVUA 2EAUA 1E7QA 1U6JA 3RC7A 3DMYA 1SC6A 1OI2A 4E4RA 4OHXA 2HSEA 3ZHVA 5EHNA 2JFNA 3DS8A 3I5MA 2WVAA 2Y8EA 4DC1A 1PYOA 3B20A 3KO8A 4I3HA 4C6HA 1ZOOA 4JU9A 1SOAA 3EGDA 2JFUA 5HJ2A 2PAFA 4D0GA 2BD0A 1K7EB 3U26A 4XWAA 5KNLA 1MRNA 2TMGA 5AICA 2CUKA 2REQA 1F8FA 4F60A 4ITUA 4L76A 3PIDA 4X64B 1AQNA 5CLFA 1EFTA 1KJZA 2C3OA 2I8LA 1X0XA 2ZS9A 2FGKA 3EQ7A 3GZJA 1C30A 2IH4A 2I2AA 5JXJA 3JTEA 3W0LB 1MJFA 3H8VA 5K0CA 3HY6A 4X90A 3NBFA 4HQOA 1VG9B 1L5MA 3TZEA 1TCAA 3OPMA 1NIPA 3BULA 4FCTA 5BXYA 5HJ5A 4RY8A 3RSLA 1KE2A 3EUEA 1NUTA 3CEMA 4NE7A 2W83A 2ZSDA 1AB5A 5JAOA 1H4SA 2XOEA 1PZFA 4II2A 3E9YA 3UMBA 2WUDA 3P94A 1XRQA 4EATA 4H1VA 2HADA 4E7OA 2GZ2A 3RRZA 4LXHA 4R7GA 1B00A 5AQEA 5C8YB 1HYGA 3E22A 5B7QA 4JLWA 1YF3A 2Q6IA 2ORED 2ZSFA 3UGTA 3ESXA 4L6AA 1KAGA 2YUIA 1WSDA 1A71A 1NJFA 2P2CA 4I81A 2OBLA 2D2IA 4IXMA 4DYDA 4GVLA 3F7OA 3P9SA 3IRUA 1PZMA 2QVLA 2VNJA 1VCHA 2VK2A 5A9RA 1TMKA 5C1OA 1M73E 1YK0A 1L2TA 2CYBA 2DLNA 2WSYB 3IDFA 1VHTA 3OCWA 2B98A 4HG2A 4IDQA 1V7PC 2ZP1A 4LGCA 3R8XA 4BGIA 5KOHA 3AETB 2I8CA 5DGIA 1AA6A 1TKAA 4Y6LA 5ITVA 2V6MA 1MP0A 1EFRA 1P0IA 1Y8CA 4AMYA 3AFIA 3I1FA 3ETNA 3H2KA 1V8PA 3C87A 3DOCA 4ZEWA 5FPYA 4F6RA 4AD8A 2FZGA 2HIGA 2PKRA 3CZMA 4EBFA 1C14A 4YCLA 1TK9A 3BT7A 4YRBA 1QCDA 1YE5A 2C94A 2COUA 3ME5A 3ADPA 3T7SA 2GCEA 1TM1E 2J7PD 1KBZA 2W93A 3AM3A 4WBSA 4WI1A 3TSWA 3WRWA 5K01A 4YP7A 3Q7TA 3W8FA 4IH1A 2ZRAA 1IUOA 3IRVA 4DMFA 4I50A 4Z4IA 1PD1A 1B6TA 4M0UA 4WLVA 3WDSA 2B9VA 4BLQA 4F38A 3ZD7A 4G0ZA 4UTRA 1K8XB 3RKRA 2IKSA 3UJNA 2RJ3A 4LDJA 1I5RA 2OHOA 5THQA 4KQ2A 1ZZGA 3HDQA 3BD6A 4CKWB 3OQMA 2FN4A 1HDYA 4BQFA 1ZPDA 3KBOA 2X0RA 3QW2A 4V0NA 2W4IA 3H9GA 4R1MA 3GRCA 2VYCA 1K8ZB 2PLRA 4DRYA 3LC0A 1FS6A 1EX7A 2UVDA 3PQ4A 4YMGA 5I7RA 3KD3A 3T7CA 1OGJA 1Z8FA 4Q4LA 4KXFB 1N0UA 4E2WA 3K6SB 1DJNA 2XAUA 2NUPB 2AT1A 3P5SA 1SVKA 4HS9A 4L1KA 4LAFA 3UAOA 3JD3A 5BQ5A 3AHGA 3AHDA 2PN1A 3N58A 2JAUA 1LY1A 4RF4A 1M1YA 2NQTA 1QQBA 2VTEA 3HUDA 1QRUA 2F59A 3I1YA 5JZOA 2A58A 4TZ6A 4MV3A 5DXFA 5DHTA 4PIVA 1YV9A 3QPUA 3RTAA 5AVTA 2JZOA 2OG2A 3QVGB 3OKCA 5KJ6A 5FJJA 2YRXA 2V98A 5BWCA 1YZGA 2O8FA 3PCXA 4PE5B 2E5LB 1U0LA 3IQZA 1J20A 2GJAA 3CH7A 3FZNA 1YOVB 1KNQA 1XTSA 3QP9A 3ZZNA 1D4AA 1GR0A 4WNAB 3UMFA 5A2GA 3EXAA 5LZ5A 2F1KA 3U4AA 4D6XA 1N8KA 1HL3A 2IZ0A 3IMGA 3PIRA 2IUTA 3ESAA 4XIYA 1YJXA 3VVLA 4EHAA 2GBLC 5MGBA 2VHJA 1LU9A 1TM2A 2DU8A 5AUOB 4M87A 4OHWA 2F1RA 4E07A 5GP1A 1MDFA 4LJ6A 1Z08A 3HJBA 4RQAA 4L72A 3OIGA 1FFXA 1ZM4A 4K2HA 1IE3A 2G04A 3A6PC 1FZQA 1ZUNA 1ISSA 1KERA 1XDSA 1I6LA 4CHTA 1FE8A 4M99A 2H8KA 2C9OA 2WWFA 4I36A 4WASA 5DV9A 5TNXA 5FO0A 3GMSA 5BT8A 4CEHA 3GBPA 3KYJB 2JD2A 4UC0A 2LTAA 5KWEA 1AXRA 2FN3A 2W6PA 3G9TA 2I91A 3B2NA 3CRNA 1ZM3A 4CTJA 3MCZA 5LU8A 1O0BA 4LCJA 4UXJA 2I3DA 5LDGA 1GUBA 4N9WA 3DBVO 1PBNA 3BWBA 1M1NA 3JCZA 1GT6A 2FB9A 4TKVA 1J4AA 1KSHA 3TJZA 1QH8A 2X7XA 3CVWA 3WA7A 4EG8A 1A9TA 4NATA 2F6RA 4CMHA 2WOJA 3JARB 5T8KC 4LK2A 5EYPB 2I71A 1T8RA 1ZKDA 1NJSA 3IP7A 5FOVA 4P08A 3RIGA 1Q16A 2FP3A 3UCFA 4YRAA 5C2JB 1OKKA 3FPAA 4MPTA 5LSAA 4JQYA 3HCBA 1RIFA 4Y2YA 3CZ9A 4JH0A 1KPIA 2CNKA 3LRTA 3C3WA 3T52A 3D8NA 1GRCA 4RZHA 1N6LA 4O2LA 3ZGOA 2WFLA 4IIJA 4F6CA 1YQWA 3AW9A 2ZFUA 3R9IA 4N0EA 3DFFA 1PTJC 1SIBE 2MR6A 3K1TA 3LQKA 1GFWA 5AM2A 4BEWA 2AUTA 2AB0A 3MWKA 1USUA 5EJ2A 4HEQA 1KDTA 1EGHA 1SQ6A 3KB8A 4ZVNA 2O4CA 4ZDWA 3ZDBA 2XH8A 3RAJA 3RYIA 4FYYA 5DOVA 2IUUA 4EO7A 2BWJA 5LLDA 2CEAA 3IQDB 1UPTA 1XZAA 4UEWA 4UXIA 5KX5B 4N6OA 4CI9A 2NO7A 5HG0A 1PYGA 4ASUA 1LNZA 3BGVA 3DKRA 3O3NB 4J1QA 4M9RA 1MC8A 1TEHA 1ZI9A 2HMWA 4LNUA 2NO5A 3URKA 1KMHA 4DVGA 1W36D 3CLVA 3ELUA 3VU9B 2BFDA 1P60A 3PX2A 3Q40A 2Z8YA 3IOYA 4NK4A 1KI8A 1YZ3A 4BDTA 1EG2A 2JNWA 2ZSJA 3BEOA 4AW9A 3P32A 1XGKA 3B2EA 3WKBA 2RJNA 4K6CA 3ZWNA 4GXTA 4PYLA 1FP6A 4KQMA 1UQRA 2Y71A 3FPFA 4UHDA 4YI3A 3TQOA 3BHMA 1A2QA 1GGMA 4P5DA 5F3RA 1R0CA 2CHEA 3NJRA 2EFYA 3AHCA 3LD9A 1WHSB 3Q8XB 4WFKA 1U3CA 4BLUA 1RZRD 3T7EA 3PKIA 1KY4A 3V8MA 8LDHA 3WK8A 5AJZA 4TTVA 4R2MA 2J0UB 4KP7A 4URZR 5HF5A 2GBIA 3ZNPA 1TF2A 2EP7A 1XCJA 4XB1A 3FH0A 4BAUA 2P9EA 5CH3A 1KQNA 5B4UA 1N2SA 3F6YA 3B3GA 1U6KA 1V4BA 3L1UA 3W9SA 4RPCA 5H0IA 1L5ZA 3S3TA 1ZLYA 3QXHA 1QZXA 4Q05A 3HM9A 4LECA 3WLEA 4IWYA 2HA6A 1EFDN 4PZ9A 3V7UA 4AYTA 5AESA 2QRGA 4FGZA 3CX4A 2A8YA 1E98A 3D7LA 3PQ5A 3A4LA 5EIBD 3TVDA 2X3UA 4XQ9A 2H65A 5ARDA 3WA6A 4LF6B 2H1RA 2HSJA 3MM4A 3D6NB 3LXRA 1QHXA 4BNVA 1WMSA 1U3GA 1UK9A 1KOJA 1KFCB 4KIFA 4M1KA 4PZUA 4G5HA 1W8DA 1D1SA 1C4XA 1FTNA 2LDBA 2O7NA 4H35A 4NLLA 1T4MA 2X6RA 3KOWA 4FFVA 1WKVA 3T94A 5JYDA 2EGUA 1L4KA 2O5RA 2VJCA 1MF7A 3TG2A 4K03A 1EP2B 2QTWB 3IVAA 2VLIA 4A8JA 3OLCX 4F4UA 2YMLA 4V2IA 3S70A 3BGDA 1US8A 1V6AA 1V5FA 5D01A 2HPHA 4WZBA 1C7IA 3HDYA 4BC1A 1LW7A 1D9XA 4NSNA 5G1OA 1OV4A 1U5BA 3U0VA 3GLHA 5K8VA 1XQXA 3A4YA 3MEQA 3IKLA 3EGXB 4OL9A 2M98A 3BFPA 2WIDA 3EZFA 2F90A 4FOSA 3D4NA 3L06A 4A2CA 1SXGA 4IFIA 1HDCA 5DFAA 2I2FA 1M6WA 1EWTA 1NZFA 3HN7A 3X1WA 5FHRA 4FKZA 1SVIA 1UBKS 3L0BA 3WTCA 4GX1A 1JVBA 2ILVA 4IGKA 1SXJD 3PPVA 3QY9A 3N3BC 4LYGA 3HYRA 3R3WA 5D1NA 4CLDA 2C7PA 5DWDA 4EHBA 1F9AA 2OGUA 5LOVA 3P0FA 3OPYB 4NCXA 4F9GA 2WSSD 2IS1A 1GILA 4XPZA 2JGLA 5TPZA 4ENWA 5BSHA 5KQGA 1I2DA 5B37A 5KUTA 2PVPA 2B92A 4EF4A 1Q91A 4XIFA 2ZAMA 5DU2A 3DOUA 1SC4A 3BL8A 3TQHA 3NOVA 4CM4B 5JNUA 1FSFA 1DFHA 3F67A 1FTQA 5ALDA 4RK6A 2NW6A 2WAOA 3LC2O 1FMFA 2ZIEA 1RSZA 1T0PA 1WMFA 3PUJA 5B58T 2KBEA 4I8XA 2XYVA 1LLUA 4HB3A 2ACWA 5EJ9A 5IAOA 4IQFA 1G66A 1UWCA 5SY6A 3WGKA 2PX2A 3EQ9A 4I1YA 4QWMA 4B31A 4EHLA 1A9OA 1OWNA 1V5WA 3ROGA 4FC7A 3OZUA 3SQOA 3GFSA 1WLYA 4YRGA 4XX1A 1F20A 3WWZA 3GZ4A 1YRAA 4JNKA 4IIUA 3L8CA 1E9FA 2OILA 2W0SA 4KXYA 1RADA 5DCWA 5F9MA 4UFOA 3PE6A 1F8GA 4DY6A 2BCGY 2CXQA 2ZBVA 1HTWA 4JWTA 5GJVC 1V7ZA 1LPPA 2AXQA 1Z13A 3AO0B 4CDRA 1O2DA 3ODGA 5FIUA 2OPHA 1C8VB 4CODB 5JJLA 1X7XA 2B5WA 3KTOA 4QVGA 3PTAA 3EXG2 4XQCA 3RHSA 1Y3BE 2PX4A 4KBGA 2O7SA 3PFHA 1TUIA 5FTMA 4P35A 3WISA 2BFBA 2X4GA 3G59A 4UW9A 2Z5FA 2WV9A 4OQQA 4MW9A 1Z6PA 2O1WA 4TTRA 1QX3A 5IABA 3Q1LA 2RARA 1LQUA 3KTAB 4OAQA 2IZ6A 2QE7D 4NQZA 4QJ3A 5K8LA 4DQUA 3TFOA 4I55A 3X2FA 5LMNB 5LQKA 1J1IA 1KVSA 1MC4A 4JSRA 3UKOA 1ZOIA 2OHGA 1GGVA 5DLQC 2XDWA 5IVKA 4HVCA 1QFZA 3SQMA 4OHPA 1X9HA 4GNKA 3LPAA 1NTOA 4XW2A 1L8AA 1PR0A 4Z3KA 4Y1RB 2J5KA 1X1EA 2PU5A 1PZEA 4Y30A 2XB4A 1K3UB 4YRDA 3CW9A 3ZHOA 2OZEA 4IDOA 5NLLA 2IHVA 3PUXA 3ZHBA 2PRSA 4TLLB 1QRTA 4R41A 1L1FA 3OZVA 2XF2A 1UBEA 1W2WB 4K86A 3R77A 5IBQA 4CKBA 3D7NA 1IRXA 4A0SA 3NHBA 5CJPA 5TMPA 2Q49A 3RVDA 4ND1A 2AN5A 2ZB7A 1T9HA 4KWCA 3FB4A 4NZNA 3VTFA 4C7MA 3M1AA 5A9SB 5BVHA 4FPXA 4FDVA 4RL6A 2F3SA 3K0AA 3SF8A 4AXXA 3AKCA 4BJ3A 4CMJA 1L5FA 1Z29A 2J9FA 1ZU4A 3L46A 3QUBA 3WRXC 1KAOA 2VP9A 2YC4C 4D45A 1PNRA 2E7ZA 2M9MA 3QWAA 2JZCA 2XV1A 4KO2S 5LVAA 2AG1A 1H0SA 1S8AA 4HRXA 4M0EA 4CF5A 5B2ZA 4TXMA 2ZTVA 1E3MA 2R79A 1CEYA 3QPWA 3OOYA 5DYTA 4GBJA 4P1ZA 2O2GA 2YS6A 5DI3B 2LZ0A 3SY8A 5D86A 4DV6B 1ADGA 1M1UA 1CF9A 3NI2A 1ZA2A 1TFUA 3EPRA 4HUJA 3AEQA 4G23A 2KI5A 1RMTA 1NG1A 3DV0B 5AKIA 1NE7A 4EMTA 4Y2UA 4WESB 3VZCA 5A62A 2CNWD 1CP3A 1I6KA 1ENZA 1L6RA 1SU4A 3WLRA 1DIOB 4QBTA 3KCQA 2DCMA 2BI8A 1ZN7A 2HA2A 4AJHA 4Z4QA 3TE7A 1UZUA 3K7EA 2PY6A 3N2ZB 4JI5B 1QHNA 1FC0A 2YYZA 3U9TA 4BE7B 3PJRA 3I2GA 3HV0A 2GTHA 3CS3A 1UZAA 1N1MA 3W2TA 3HGTA 3LDUA 2JIZA 3PUWA 5EMHA 4HWPA 5YASA 1ZS9A 2HTFA 4FHFA 3VZSA 3KAKA 1QTIA 1R6XA 3BAFA 4ZV7A 5LZ2A 4P4SA 4JASB 4WDRA 4BX3A 1W59A 2XX3A 2AOXA 2ZBDA 4KDRA 1SXPA 1GQQA 3ED5A 2AC2A 1F5NA 2QAGC 3ZG6A 4MROA 3NUZA 4NXNB 4OO3A 4QDOA 2WIFA 4MWTA 2ZUWA 2F3QA 2VF2A 1GAQA 3NHUA 2C4NA 4DWOA 4EEZA 1LQ2A 3PC4A 1OT5A 3Q6IA 3REOA 2ZE6A 2WJ4A 5EP3A 5DOZA 3C8MA 1GGNA 4IHAA 3BYZA 1YSCA 2H0QA 1JN0A 1XDUA 4M55A 2HK6A 2FPRA 5ALMA 1I9CA 2HY7A 2IITA 4RDIA 1S0UA 1DHTA 1ZWKA 1J2RA 5K3BA 1DINA 1SUFA 1E4OA 1NUSA 2R9VA 1B6SA 3KOZA 2R86A 3MYRA 3UJ8A 3W4JA 3WV5A 1FJHA 2C7QA 4FNGA 5AM0A 1M1YE 2DM6A 1N9GB 3SDBA 2QR2A 2HJSA 2YV2A 4HP8A 3OWHA 5KNCH 4AG6A 4U2KA 2BIFA 3AFHA 3FHJA 5JCJA 1VG0B 3ZDFA 4NE9A 3PUVA 4A4DA 1NOIA 1V8BA 2GEFA 2ZBRA 3K6JA 1EZZA 3EH1A 4GMFA 4GPAA 4I4TB 4LV8B 5DX1A 4BFXA 1ORDA 1FMTA 2EVWX 2PL3A 2QF7A 5L3ZA 5IYZF 4F3RA 4X7PA 4CTKA 4YX9A 2IYSA 2W2TA 4YXWD 4PVDA 1NLFA 4H7JA 4P6VF 3RRXA 3I8SA 5FWYB 1EHCA 3CNEA 4BNHA 4LF5B 1U5AA 2R1ZA 3VYWA 4XDHA 1OXBB 4X7MA 1JE0A 1Y5NA 3DVLA 2Q8PA 4HX2A 1GSIA 3FBGA 5IZCA 1U6IA 5JSKA 1XNQB 1P9NA 2DX7A 2UYQA 1E77A 2YHIB 3K1AB 4CEJB 2OV8A 3ABQB 4EVSA 3PF8A 4M83A 3PQ2A 2DQSA 5E9QA 4FCCA 2P5YA 5B1DA 5HUQA 2N47A 1ZH6A 5KCMA 4ZD6A 2IIBA 2LCIA 1QQ5A 3QPVA 5FUWA 4B84A 2QQ0A 3ZBTA 3ZLUA 4AKTA 4C7XA 5T6BA 4XUCA 5LB2A 1Y3IA 3IALA 1RKVA 4ZA2A 1BXZA 3VHXA 2ZE5A 4RPJA 3F7MA 1W94A 4GPEA 2RHGB 1LH0A 2I1QA 1CR4A 2VCYA 4TYMA 4XJXA 4BL5A 4YRKA 3W6OA 1QF9A 2WIBA 3C39A 3E27A 4EPXA 3FLBA 2IY8A 1HEIA 3N6XA 4I5GA 2ODQA 4Q1EA 3RWBA 3L8YA 1PL6A 1P7ZA 2HA3A 3CNLA 3ZNNA 2RSLA 3ASVA 2FR8C 4LYHA 5CXSA 4YONB 2CWDA 3JQDA 3AUAA 2CF5A 1H6BA 2V7UA 4U7PB 1XZBA 1WKBA 2DSNA 3BCSA 4TUYF 3J7AC 1OAOA 4UTVA 2Y0DA 1E60A 1TQ8A 2X5XA 2XGGA 4QUAA 4TROA 1OFHA 3WDLA 4EGFA 2P6OA 1VJRA 2WAMA 1VECA 3Q98A 3U9SA 3H9JA 1DVRA 4L7VA 2WICA 4NJMB 3KQHA 4C6SA 3TPFA 1XZFA 2CXXA 3V32A 2ZOSA 4QXAA 2Y1DA 2XWJI 1DC6A 3EGOA 3FNGA 3SS7X 5ED4A 3I30X 4X8LA 4ANFA 2C8KA 1XMIA 1YWGO 1W9MA 3UJHA 1Y9DA 1X39A 4NCHA 5ALYA 2B94A 4YCDA 1L5NA 2FPPB 2H5JA 3U0BA 3WL6A 4AN1A 3BB3A 4DJEC 3RHZA 4DLNA 3OQOA 2NXWA 5BR4A 4TTQA 4Q5IA 3ICOA 3CLRD 1G6Q1 5IT5A 1JDBC 2FKAA 2AFHE 2Z2KA 2OE2A 1QIDA 4J0EA 3LNTA 3LC1O 3VTKA 2WU3A 2Y1CA 3LX6A 1WHTA 1O89A 1KAEA 4U7TB 3KVRA 3KYBA 1A9ZA 3DO8A 4XJTA 1KZGB 2VEOA 4JLAA 2H1SA 4QQNA 4UBIA 5E6UB 3F73A 1Q3TA 4NONA 3SMVA 1W581 1TZJA 2QZSA 2OB2A 1Z2OX 3FD8A 2IVFA 2NQ2C 1XV5A 4KWIA 1UM8A 3KM0A 4P9NA 2ISSD 2PQ2A 3AETA 3CBGA 2VQEB 5KB3A 5DULA 2WM9B 1JG2A 2PE5A 1VKNA 2Q5EA 1T0UA 5D5HA 3O9ZA 4U2BA 2I03A 3WYBA 1VYVA 3FWPA 2QMUA 4Q7KA 1A04A 2WJWA 4G01B 1TL7C 3ML1A 1C1DB 3BSWA 3EVTA 5ABPA 1F2DA 4NU5A 3VSBA 1VL6A 1OR8A 2BPOA 4X63A 2G4LA 4CYMA 2A3RA 4LPSA 1KDRA 4Q03A 1CJUC 1RXCA 3IE2A 4LZZA 3S2FA 4EGJA 2ZDHA 2GX6A 3ONFA 1QIIA 4ZAZA 4TWJA 4KHPB 6CHYA 5KSYA 2KWIA 4XWTA 3SXUB 3SYMA 3B70A 1ZINA 3SJUA 1BROA 4KQIA 2VTVA 4U7JA 5DRYA 2KW5A 2RBEA 1TQ2A 3KKQA 2JZNA 3NBMA 1ZN2A 4MDEA 2ERXA 4B43A 4FB4A 2H2WA 5AW0A 3C8DA 4BPBA 1TB4A 4IDGA 3QENA 4P84A 5B6IA 4W5OA 1PW5A 4YP9A 3OZBA 4KAAA 1UAGA 4XWOA 2QUZA 4QVKA 3GLGB 3LDFA 1E0SA 1F3LA 4KMRA 3DW1X 3LUAA 3OF5A 1ENYA 2HWXA 4J8PA 2ZVQX 1FUKA 1SG9A 3M4ZA 4WZBE 5DKFA 2ACVA 3CVJA 1X7ZA 3E8MA 3FTFA 2IKQA 4GSLA 1WDWB 3EZ7A 4O29A 1E1QD 1N2GA 1XT6A 2ZANA 3RG8A 3X0DA 2V45A 4WBNB 4D5GA 2PH5A 4G0PA 4ED9A 1VHWA 1BYUA 3WBJA 1RKBA 3EIWA 4F1KA 2PKWA 1ZM2A 4ID3A 3D6FA 2V74B 4GRIA 2R60A 4KNVA 2WW8A 3JATB 3JQEA 1IM2A 2ZTLA 3JAMA 2F17A 2PD6A 3ZXSA 4NG5A 1U1FA 4LDQA 3I12A 5BNFA 4UZSA 1SM4A 1D4FA 1E2LA 3VNSA 5K0JA 2AX3A 3SX2A 3SOPA 3HA7A 1KFEB 4FDMA 1N6HA 4EW2A 2P78A 2QRHA 2OCBA 2A0WA 1NRXA 1NY6A 2NU7B 4FD3A 5JALA 1B7GO 4EFNA 4DLUA 4G0UA 3GNSA 1SHUX 4IQ8A 4MR7B 4IIGA 1GADO 5BW8A 1G42A 1BWRA 2AE1A 1C3OB 4AO6A 2DR3A 5FEMA 4MVJM 1W8IA 4UNSA 2BR4A 3C1MA 1HEUA 5K1ZA 1JDJA 3TBFA 2Q0QA 4YC7A 4YRZA 1AMNA 4PZYA 2Y92A 3ZD8A 4C0AC 2YVUA 1IBLB 3H13A 4G0NA 1CY4A 1VSVA 2O06A 4KW7A 1MH1A 4XUDA 1BHJA 5CIQA 4Q66C 1HQKA 1MTOA 4ZVVA 2YZKA 4FDAA 1O94C 1NJ5A 4W5NA 5HKOA 2ZU6A 4OYHA 3F96A 3RVNA 4FGSA 4RFVA 5TRTA 5CYOA 3L05A 4BNXA 5EYPA 1P80A 3IT2A 4TS9A 3COSA 3IYLW 2ZRLA 3S2EA 2R25B 3M0EA 4EB3A 1W6RA 3IOBA 2RHHA 4R84A 1VE3A 3IE1A 3HV2A 3EWAA 1J5PA 2V7GA 2JLZA 3ZZUA 3ZY5A 2AD5A 3OWXA 4IH9A 4IUCS 5F9HA 5KNCD 3GX1A 3P96A 4MH0R 4Q3KA 3DB1A 5EFZA 5D3QA 1A50B 4L5CA 4RDXA 2RIRA 1M83A 3NKFA 1H4TA 2FWNA 1RHJA 3OLQA 4S1NA 4BZZA 3ICCA 2ECFA 5EFOA 4N6NA 5GADl 1WMEA 1Z34A 2ZKLA 1DFIA 2B36A 3C85A 5CPBA 4EWLA 5IRCD 4RY2A 3LA6A 3B1VA 3T1OA 5IKMA 2OL4A 5I7EA 3KAJA 2WJAA 3O73A 4MS3B 4MVJH 4QFMA 4RU1A 3K5HA 3O7WA 3Q3JB 5DBFA 4C05A 1A8IA 1KRXA 1GAEO 4EVQA 4ZHQA 3R9XA 2ZJ0A 4N76A 1UBMS 1V5GA 2PCJA 3WQRA 1PQYA 3UH1A 1CIJA 4JR1A 4JBIA 1E20A 2JD1A 3S2ZA 4REQA 4B40A 3V6LA 1NFRA 1ONBA 2J1LA 2SECE 3N2YA 4TSRA 3BMXA 4U8GA 3DBHB 4LVNA 5DNVA 4ZHSA 4KE6A 4JKYA 3KWMA 3FWHA 3N0RA 1FFAA 1M76A 1I8TA 1LSJA 5JT1A 3K72B 3UXMA 1XQ1A 3F4KA 3BHJA 1A8SA 4I8DA 4M4SA 2ILTA 3KVOA 3DYIA 3BMQB 5EQTA 2C2BA 2J0UA 3MMSA 2AR0A 3K1YA 2IDZA 1L8XA 3Q7SA 4HWOA 5G0WA 1P9WA 2VXYA 3ORYA 2QDXA 4OQPA 3B52X 1WXHA 3CWCA 3IHLA 4UAVA 1QIGA 4MULA 3RYFB 4EPTA 2YW2A 2Z2JA 2AZ4A 4OSEA 5A6SA 2QM3A 1YB6A 1HR0B 1KYVA 2CHGA 5J2TF 4YV7A 3V1UA 3HG7A 2XMPA 4V0RA 3HB4X 3O3MB 3VRHA 1ZMRA 3AK4A 2ST1A 3PHGA 4LJSA 3AERB 1X19A 2JLRA 2ET6A 4BNMA 2WIAA 5BN5B 1DAIA 1I5OA 4WCDA 1WO8A 3H2YA 1WY7A 3RRMA 2I4MA 1WTAA 2O20A 2XNJA 4QREA 3HFJA 5HTKA 1TC2A 1Q15A 4HJXA 2IY7A 4X1YA 3OWOA 2ENWA 3SAJA 4CETA 1G18A 1N57A 3JVEA 2J6CA 5D87A 5DO9A 1HNZB 5EP2A 4OHMA 2P40A 3CKLA 2XKBA 3DLPX 1T8WA 1SIUA 3DYBA 1H2EA 3KFLA 2WUVA 5GAJA 3FSGD 3THXB 1AE1A 1NF3A 3L0DA 4J2TA 4ZQFA 5HRCA 1AKTA 4PLTA 1T0HB 2A9JA 3AAWA 4Q4JA 3AM4A 4JBWA 5F2OA 2J6BA 2P62A 3RJ9A 2O23A 3FKSD 1KH2A 3M9WA 1MORA 2VBCA 3NHMA 3GEEA 3QX3A 2P9FA 1BHO1 1KTIA 1X87A 4EFDA 1FU8A 1Y4SA 2QK4A 3EGXA 4JEHA 1GUDA 2HRRA 2QLMA 1JIVA 1IHDA 3HQ4O 5EJ5A 4HGNA 1XWIA 1JXAA 4FHDA 3HO8A 5M29A 2VHTA 4PXSA 5I51A 4HRYA 3PVSA 5B57C 4PINA 5DHPA 3AP1A 3FVTA 5SZIA 2WY2D 1RXEA 3GF4A 4DCOA 4EO9A 3GPBA 1NASA 5DHAA 1YC5A 4DAOA 2XCRB 2QN2A 4I19A 4B1FA 5U1PA 5JAHA 2UAGA 4D3ZA 3UPTA 2MWMA 3OPYA 5C7OO 4OU4A 1QIKA 1DP4A 2ZM5A 3P9CA 4A36A 3A2MA 1A72A 1SVLA 2HAEA 3KIPA 5EPUA 5C9ZA 1M10A 2H7YA 5JD4A 3AR3A 2VDWB 3PHIA 1IL0A 2EERA 3ZDYB 4CEIA 1DB3A 5K3FA 1OB2A 1DUIA 3C6YA 2V59A 1EVKA 2J31A 1EWQA 5CDFA 3H7AA 3ORQA 4NV1A 4UTZA 5BWLA 3UF0A 1UC4B 4EUFA 2MOKA 3SOZA 1E5TA 3T9AA 4Q0MA 3FDFA 3DXXA 3BDVA 4NKRA 1UT5A 5L8VA 4KQXA 2QM7A 4M0PA 3VJLA 3CRRA 3F1LA 3OF3A 1K89A 1EUYA 4BZXA 1V41E 5JATA 1XD8A 1KFKB 3I3SR 2V6GA 3DUFB 4JB3A 2PXAA 4P2BA 4RBNA 3VYSB 1QNFA 5JQGA 2VZ0A 4U5QA 1XCLA 3RV4A 5KQPA 1YS4A 4G97A 4DE5A 3HS3A 4NAVA 2ZBQA 3R24A 3D8HA 4DMKA 1UWKA 5JC1A 1IG3A 1BE6A 1ZO8A 4K6FA 1GD1O 3IVXA 5JRJA 2XOXA 5AXBA 5GJCA 3AOEC 5AVOA 2NO9A 2DHDA 4WZAE 4CW7A 5LJIA 3J80A 3H0CA 3MUFA 1OH5A 1ZGJA 4QNRA 2G70A 1AKRA 3EAQA 3SZOA 1K66A 1CHNA 2JIMA 3KFXA 3TL3A 3FWKA 3IDZA 1W4CA 3PGA1 2NMVA 4WMLA 3GAZA 1Y4DE 3EFHA 4OSPA 4DYHA 2QIOA 2V7BA 2WHPA 3JQAA 5KPJA 2JCXA 3NUGA 4OHVA 4RE5A 1JYSA 2YKGA 4RKEA 4BU0A 1I6WA 3O8RA 3DMDA 2VP6A 4A0GA 3U6BA 2CBXA 1VCMA 3BTOA 1N1DA 1JVSA 1L7VC 1WPXA 2XUQA 4E13A 2DUJA 1D8TA 3HP7A 1FIUA 1WETA 4NZOA 3T9DA 1R5OA 3AMVA 4LA4A 2GUWA 4D26A 2AMLA 2QVGA 2R1TA 1V37A 2YIDA 1N7HA 5TX7A 3UHPA 4CU2A 4GC5A 4NAHA 2HUPA 3MD9A 3WBKA 1EFVB 3AQIA 5A3JA 2I4RA 3K32A 1ODTC 3T7DA 5JCOC 4MUGA 1R88A 5EWJA 5LYJA 3SF0A 4CF7A 4WY8A 3PJEA 5IBPA 1C8LA 5A0FA 5K9ZA 3P0HA 2VQSA 1RI5A 1FL9A 3Q9UA 5J9FA 3RT7A 1G5IA 3QVUA 4G2TA 4FQ8A 1CZRA 3ZR4B 2NUTA 1HQDA 1II9A 3JSXA 1G17A 4KKXB 4AMBA 2GPAA 3HKBA 5DPMA 3WNBA 1OXUA 1C8BA 1DKRA 3PGJA 4MV5A 4EUNA 3FAKA 4I6EA 4JJ4A 5EMJA 1GPJA 2FQ1A 4GC9A 3WMXA 1DIRA 1QPBA 5A9SA 4QIHA 1SVOA 4MAMA 4MITA 1TI7A 3L07A 4WY5A 2R7MA 3BH6A 4EGAA