4KR7A

Crystal structure of a 4-thiouridine synthetase - rna complex with bound atp
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
386
structure length
386
Chain Sequence
ELRVYIVRYSEIGLKGKNRKDFEEALRRNIERVTGMKVKRQWGRFLIPIDENVTLDDKLKKIFGIQNFSKGFLVSHDFEEVKKYSLIAVKEKLEKGNYRTFKVQAKKAYKEYKKGVYEINSELGALILKNFKELSVDVRNPDFVLGVEVRPEGVLIFTDRVECYGGLPVGTGGKAVLLLSGGIDSPVAGWYALKRGVLIESVTFVSPPFTSEGAVEKVRDILRVLREFSGGHPLRLHIVNLTKLQLEVKKRVPDKYSLIMYRRSMFRIAEKIAEETGAVAFYTGENIGQVASQTLENLWSIESVTTRPVIRPLSGFDKTEIVEKAKEIGTYEISIKPYQDSCVFFAPKNPATRSHPSILEKLEQQVPDLPVLEEEAFTSRKVEVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA sulfurtransferase
publication title Crystal structure of a 4-thiouridine synthetase-RNA complex reveals specificity of tRNA U8 modification.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase/rna
total genus 119
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.8.1.4: tRNA uracil 4-sulfurtransferase.
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02568 ThiI Thiamine biosynthesis protein (ThiI)
A PF02926 THUMP THUMP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.30 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 4kr7A01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4kr7A02
2Z09A 4JXZA 1T6YA 1XNGA 2H2AA 1NSYA 2YWCA 2AKEA 2BTEA 3CLTC 5EKDA 2OQ2A 2WQ6A 3A04A 1I6LA 3CLUD 2YWBA 5HUJA 1YI8A 4MQ6A 4U63A 4G5YA 4OUDA 4GU5A 1GTSA 3L93A 1B6TA 3QTTA 4PY2A 1X8XA 3X1KA 1NYLA 3AIIA 4KPUB 4CT0A 2J09A 1KAQA 1O94C 4NDAA 3FDXA 4ND7A 1U3DA 3ZJUA 3RFFA 2QTMA 1O97D 3LDUA 1NURA 1WXFA 3IOCA 5H7XA 1QRSA 3A2KA 1TYCA 2HZ7A 4MUKA 3MXTA 5H16A 1EUYA 2DXIA 3AKZA 2ZUEA 3SYTA 1O6BA 1T9GR 2A1TR 5LLTA 1Q77A 3N9IA 1NUSA 1PFYA 1N3LA 3GMIA 4K0RA 2A4MA 4Q93A 4MWCA 1D2RA 4KR7A 1TYDE 4ND6A 1TEZA 1JGTA 1N2EA 4UZFA 4KKVA 1JECA 2JANA 4MVYA 3CVXA 3UOWA 4HJXA 1H1TA 4P2BA 3H9CA 5J59A 2D5BA 1Q19A 2X1MA 2E89A 2PXHA 1J1UA 3Q10A 2BYTA 3PRHA 3DPIA 5LFAA 1CT9A 3UY4A 1N2HA 1OWPA 1WZ2A 4MULA 4QBTA 2QJOA 2C5SA 3CLTD 4MW4A 2E0IA 4MVWA 3PXUA 1EJ2A 3KT8A 4HK4A 2QJFA 1OWOA 3CLUC 1Q15A 2OV4A 3P0HA 1VLHA 4OUDB 5TS2A 1M8KA 5HG0A 3CLRC 1I2DA 1M83A 4YBRA 3AL0C 3ZIUA 4KPUA 4ZT2A 1O94D 2A1TS 4RPIA 1MB2A 3TQIA 2A84A 2WQ7A 1F4LA 4ZCTA 1H3EA 3DO8A 5TEWA 4J75A 3V8VA 2CV2A 1RQGA 3ZJVA 4R2LA 2DUMA 5KHAA 3L92A 1MAUA 3HGMA 2A88A 2GKSA 1IHOA 1WQ3A 1NUTA 2WB2A 1XNHA 4MUEA 4MW1A 3COYA 2PZAA 2QUJA 1TFUA 3N8HA 4E1AA 3V97A 1JEEA 5FO0A 1O0BA 1QU3A 4MW2A 3G6KA 1ZUNA 4OJMX 1JIJA 3KT3A 1M8FA 4KR9A 1IQ0A 3IODA 2QUHA 5K0TA 1EUQA 1U7DA 2X3FA 2CV1A 5K0SA 1ILEA 3OP1A 1N78A 1LI5A 1GPMA 3CLSD 2RE8A 2V0CA 4G6ZA 3RJZA 4ZT3A 3ND7A 3PNBA 1QNFA 4MW5A 3S3TA 1QU2A 4MWDA 2VXOA 1LW7A 1M8GA 1N1DA 3ZGZA 3IMCA 4EG3A 1P7PA 5HUHA 1WOYA 2PZBA 3CLRD 3ND5A 4GRIA 1YIAA 3P52A 2A7XA 3MMXA 3ISJA 1KQNA 2V0GA 3PNYA 3X1MA 2CV0A 4R0NA 3SDBA 1N77A 1VBKA 1FYDA 1H3FA 4F4HA 3LE8A 5FNZA 2I1LA 1WXIA 1IRXA 3INNA 4I6JA 1GN8A 1IQUA 2J08A 3FETA 4ARIA 3IDFA 1QTQA 1PG2A 5BNZA 1J21A 1WKBA 5KWVA 5DASA 1R6UA 3H9BA 4NATA 1N2BA 4EG1A 4CDMA 4MW9A 4QREA 1O95C 5JBNA 2QUKA 3TM4A 1IH8A 1XNJA 3JXEA 4EFKA 1EFPB 1ZH0A 3MUEA 5LM3A 5FO1A 1T6ZA 3COVA 3VGJA 3QTBA 3CVWA 4ARCA 2DR2A 2TS1A 3VU8A 3U1VA 3Q12A 2VTBB 1S4MA 3H05A 3P0JA 3OTWA 2CYCA 1V47A 3NBAA 3CLSC 4XFJA 3G59A 3FNRA 4A91A 4DLPA 1YUMA 1K92A 4MWBA 1GZUA 1XJQA 1N75A 1OD6A 3AFHA 4Q16A 4CDNA 1ZJWA 1K97A 3LOQA 3N2YA 3TLJA 3TS1A 2CYAA 1G8GA 4EG6A 2A1UA 2DERA 5AHWA 1GLNA 2Z3VA 3IVXA 2HGZA 1EXDA 3Q4GA 5IHXA 4MWEA 1JILA 1I6MA 1COZA 2E18A 1OBCA 1NUPA 2IELA 3HL4A 3ILVA 3FG9A 3CA8A 4L2IB 4DDHA 2PIDA 1KH1A 1G59A 1PFVA 1N2JA 4K03A 1WQ4A 4DE5A 3AG6A 4AQ7A 1WY5A 2G36A 1T6XA 2J07A 1VBMA 4JFAA 4MVXA 3ND6A 3K9WA 2JA2A 1O95D 1O96A 1K4MA 3LDGA 3FIUA 4MUGA 3ZUGA 3F3MA 3IUEA 1NI5A 4DDKA 2IJGX 4QRDA 4MUHA 3TMAA 4WNYA 4JXXA 5J58A 1MOPA 1NZJA 1EE1A 4ZT5A 1YIDA 5J5AA 2AZXA 1EFPA 3QE4A 4ZCSA 3FHJA 4MLPA 3IVCA 2IP1A 3FY4A 1J20A 1Y42X 4JYZA 4YP6A 1KQPA 3K0BA 2XRZA 2VTBA 3N05A 2O5RA 1H3NA 2NZ2A 1JIKA 1U3CA 1X6VA 2PG3A 4I6GA 2CUZA 1N2IA 3HV0A 2Z08A 2RD2A 1WXGA 3G5AA 1OWLA 1MBZA 2DLCX 1KKUA 1UFVA 2DETA 4H3SA 3TZLA 4NX2A 3IOEA 1MAWA 1KH3A 4X0EA 2CFOA 3C8ZA 1NP7A 3COWA 3PNVA 2ZUFA 3ZJTA 2EJCA 3A4IA 3MLAA 1PG0A 2A1UB 1F7VA 2HMAA 1GTRA 4RUKA 4TS1A 1SURA 3FWKA 1J09A 1JZSA 4I6EA 2QJTA 3TZEA 1A8HA 4JZYA 4EGAA 3GLVA 1MJHA 3CVUA 1J1ZA 3KT0A 4DDMA 4L2IA 2D54A 4MVCA 3HFJA 3SP1A 4MW6A 1WXEA 4YMIA 4YP7A 3RK0A 4EG8A 1I6KA 1YUNA 3RBAA 3IH5A 1TQ8A 4ZCPA 3I05A 1O96B 1YULA 2XRYA 1HYBA 2AG6A 4PBRA 3ZXIA 4EG5A 2E21A 5IJXA 4ZCRA 4XSVA 1ZH6A 3NBKA 1VL2A 4NZPA 4EF6A 3X1JA 1N2OA 4BWVA 4HJRA 1KQOA 2YY5A 4NAHA 2J4DA 2X1LA 4XFDA 1MB9A 3RK1A 1FFYA 1IQRA 1O0CA 1KAMA 2B7LA 1M8JA 4EG4A 2YXNA 4KR6A 2GM3A 3ZXSA 4DJAA 1JIIA 3TNJA 1EFVB 2PZ8A 3IMEA 1JHDA 3NV7A 5TEVA 2X0KA 4J76A 1QQTA 1JEDA 5KCMA 5DB4A 1NUQA 2QTNA 1M1ZA 4F3RA 4EG7A 1Q11A 3SEQA 3UK2A 1KH2A 3D6VA 2CSXA 3FI0A 3IOBA 4ZT6A 3D6UA 4U7JA 3UC5A 3CVVA 1VBNA 2GOYA 2R5WA 1ULHA 1N2GA 4MUIA 1J70A 4YP5A 2D13A 3BL5A 4U8HA 4DNXA 1IVSA 2NSYA 1U0BB 2DPLA 2PFSA 4WSOA 1OWNA 3COZA 3SZGA 3H97A 3KT6A 3P0IA 4G5FA 1JZQA 3DLAA 1BS2A 1K4KA 5DEOA 4ZT4A 1LI7A 4NAUA 1T9GS 1U7XA 2ZP1A 1F9AA 3IVGA 4MUNA 1DNPA 1GAXA 1OBHA 2H29A 3SEZA 1O5TA 2EL7A 2J5BA 3TQOA 3CR8A 1O97C 5TGTA 4MUFA 1G8FA 1IFXA 3RHSA 3GUZA 2DEUA 3AG5A 1QRUA 1JMVA 1MC1A 1F7UA 1PFUA 3KFLA 3ELBA 3FOCA 1KR2A 3MLBA 4FZJA 3UMVA 3VRHA 5F23A 3H99A 3CVYA 2CT8A 1QRTA 5DK4A 2JAXA 1G8HA 2QUIA 3FH0A 1KP2A 3DV2A 1QJCA 4PBSA 3A05A 1EFVA 4MW7A 4MUJA 3IMGA 1NUUA 3HZRA 1TYBE 1KORA 3LCJA 2WSIA 4AS1A 4UZEA 1R6XA 4ZT7A 3SZ3A 1V8FA 4MAFA 4ZCQA 1WJGA 3TM5A 4S1OA 4CQNA 1TYAE 1M8PA 1KP3A 2CYBA 2O8VA 3M5WA 4MW0A 3K32A 1MRZA 2A86A 1WXHA 3HMQA 4PBTA 1R6TA 3E27A 4R2MA 3IUBA 4HPWA 1OWMA 2QTRA 1PFWA
chains in the Genus database with same CATH superfamily
2PAFA 4US2R 2CDNA 2P5SA 3L04A 1OQAA 1A5SB 1A97A 1X0XA 3HUTA 3KTAA 4XGQA 1SQFA 4OG2A 2QVGA 1NXPA 4UDNA 1GM5A 4UBMA 5JTTA 4MV5A 5GZ3A 3EVCA 3I8OA 4IOKA 3W8NA 2QXYA 4MJ7A 4ZA2A 1RHRA 3RUAA 5LN1A 5E6UA 3FNHA 5TF0A 2YKGA 4GMGA 3R5FA 5KX5B 2RG7A 3QLEA 2HIHA 2BM1A 3EAQA 4HMPA 5ALMA 1ESDA 3FJYA 3TZHA 3TNLA 4N49A 3I28A 4IV0A 5K0NA 5AOAA 3D6MA 3THWA 4C6SA 5A3RA 9LDBA 2WKWA 5EN4A 4CT0A 2NTEA 2VATA 3PPXA 2QLFA 3K71B 1G3IA 1IZ7A 2ZJ6A 3B6ZA 2JAUA 1FSZA 1M1NA 1T2VA 2ZJYA 4Y6SA 2VZ9A 3MOIA 1M7HA 3BSWA 2C2KA 4PQFA 1EB9A 1R18A 2ZZNA 5H16A 3LOPA 5DOVA 4S24A 4HGQA 1U1EA 1KEZA 3SLGA 2Y0BA 3D4LA 1EGVB 2OBLA 2BGNA 2O5VA 2VJLA 4BNLA 1PFYA 3IXQA 1R27A 4HCJA 3GMIA 1PJBA 4G1CA 4NC9A 1V3UA 2HYDA 5LLTA 2AFRA 1W47A 2ZUDA 4GS5A 1U0JA 3PIDA 1TEZA 2I4MA 2J31A 3RUDA 2F9FA 1CUCA 3C5HA 3HCEA 3QFCA 5FUVA 4HDQB 1JECA 3HUFA 4RTNA 1S2OA 4CEJA 4UE6A 1CHNA 1UKCA 4BJHB 3GJZA 1YRQA 4LQLA 4AZ0A 4BB0A 1E1NA 2QW8A 2EDCA 3WHIA 5AESA 4BO7A 5JAHA 3T3MB 5L3SB 5TB5A 3I5UA 4NAVA 3TO5A 3AJ8A 5EY5B 3EBPA 3NDBB 1U0NA 2DFTA 1ZNQO 1JJFA 2WFZA 3MJVA 2OP0A 1EI9A 3V8PA 3THXB 2I66A 4D4JA 4KFCA 4RDXA 3E22B 3LC1O 1I6WA 1Z39A 2P9QA 3C2QA 4LHWA 5DBHX 3DO6A 5DU2A 2B1GA 3BK2A 3S4YA 1J8FA 2FZEA 2WM2A 1GL7A 1EA5A 1Y3CE 3GD5A 4MJXA 2C5HA 3O2NA 2NVWA 1IHPA 3DLPX 1XHFA 2WICA 3H2YA 2YFYA 1A2QA 2FPGA 2HF9A 2MTBA 3RAPR 5JCPA 5L51A 5AT1A 4F9EA 3VO8A 1O6ZA 4PG7A 4LDJA 2OR3A 2R65A 2ZTVA 1SZCA 4XD7A 2CDRA 5EQTA 1M8KA 3RD5A 3E05A 5HFJA 5HG0A 3OJCA 4S05A 4MS1B 4G9BA 4YBRA 1U65A 2EV9A 3ZXXA 2C78A 4BKPA 4E1BA 5LYJF 2PX8A 3MRTA 2QMQA 2H8GA 2PS1A 4PZLA 4DFDA 2YJ5A 3CNLA 3I6QA 4CLRB 1SUDA 3PA6A 2HWUA 4J16C 3DYVA 1CS0A 1IY8A 1Q20A 1UFRA 2BEVB 4H0CA 4KFSA 3T7AA 1ZM9A 3TTUA 4BGUA 3L4BA 1OCEA 4DV2B 5TQJA 2W6JD 4DB4A 1U1FA 2CLOB 3DEZA 4KK4A 3DXXA 4L4ZA 2GKSA 1Q44A 3PNLA 4NXMB 4JA2A 2J8ZA 3DDSA 3W3AD 5ECWA 4TV8A 2PX0A 3GZ4A 1P1JA 1DJLA 2W2QA 1JHOA 3RAGA 1XNHA 2PS9A 2RAVA 2HDWA 5M2QA 2AQ8A 4B6EA 3RFUA 4CTKA 1M5RA 1TVCA 2RHBA 3RYTC 1VRWA 4MRAA 2QN1A 4OU4A 1QVAA 3VBEA 5FI5A 4KLCA 1U4SA 4BV8A 5FO0A 4ZDWA 2V03A 3T7IA 4ZEVA 3VKVA 4B2PA 4UATA 2GAOA 2O8BA 3ONEA 4I1OA 2VAWA 3TJRA 3WIUA 4QYXA 2FN8A 2CLKB 3TAXA 2JJ1D 4TGLA 2H2DA 3R76A 2HO4A 2DPMA 5JH7A 4QM7A 4TVBA 2ZOSA 3RS4A 1SC1A 4URYR 4FFDA 3EFOB 4KVZA 1N78A 4AG3A 3ET5A 3GEIA 3HN6A 3TL6A 1QBGA 1TO6A 1VSUA 3FFWA 3HKBB 1GG8A 2WWIA 3GCGA 1C7FA 4IXDA 5ECDA 3T7JA 5K3OA 3FM9A 3DOEA 5B1IA 1W5FA 1NW4A 1C1HA 1EGQA 1G66A 3ND7A 4KHZA 4LX0A 2AF4C 4IJ5A 1E8NA 4OTZA 4UPDA 3R09A 2FF5A 3F1KA 2C96A 5D00A 2EZUA 3W2IA 3WB2A 4KL8S 5ITZB 1KYXA 4CKWA 5THXA 1IBMB 2H4YA 2AZDA 2WIAA 1B16A 3ANTA 4KE7A 5CR9A 1YJQA 4B33A 1OV6A 1OR8A 2IOYA 1N5IA 4JQYA 3P52A 4HL6A 2A7XA 3IEKA 3ASVA 3OQIA 4IAOA 2IHTA 2P9EA 5SYAA 5TPZA 1P5ZB 2AN1A 3GT0A 3K20A 4ZYYA 3TPZA 3SDBA 4RXUA 5A1TA 4NXNB 4AY2A 5EESA 5KJ1A 2AKAB 4R51A 4L4UA 4WN9A 4K0KB 2VSFA 1RQ7A 4H0NA 1ZS9A 2E4YA 2UV8A 4TROA 4GSYA 4NMLA 1GN8A 3WMFA 2SKDA 4U6QA 1TA0A 3IVAA 3TI9A 1F8GA 1Q17A 5JI3E 1DC7A 3I0MA 1G60A 4XSHA 2HQ1A 3WJ1A 3W05A 1E1YA 1MIHA 3B1ZA 1FXSA 4A92A 1LJUA 1H8ED 1WKBA 3MMNA 1TAUA 4D9HA 1WD7A 1QHFA 3QWIA 1NVWQ 4UUAA 5CW2A 4B73A 1O0SA 4WEQA 4HYTA 2QA5A 3EQ6A 3EXG2 3UQZA 1N2BA 3GELA 1GRQA 3BXZA 3A14A 1QLHA 1C1XA 3DZIA 3LY7A 2FX3A 2I6UA 3WLFA 2IYAA 4IDDA 4EY4A 5KYGA 3D6HA 1NZDA 1N5RA 4AJIA 1W5TA 2IA5A 2WU3A 2VH5R 1PQUA 4UFPA 1D8TA 3G2HA 2R6DA 3R6TA 4DHEA 1MXFA 1TIBA 4E70A 3ETNA 5TLSA 1BE6A 3DKKA 3IHLA 1GLVA 1U8ZA 2Q4BA 2QN9A 2EFYA 3O73A 5FF9A 3F6PA 5I9SA 2OHGA 3A06A 1DBIA 3SJ7A 3WDKA 4DV1B 4ARCA 1IZ9A 4RS3A 4RTSA 3H1AA 5AHOA 2SCUA 3PR1A 2XA9A 1YNOA 3NB0A 1HKHA 3WQHA 2BMEA 3FDZA 2P5YA 1Y8RA 2VTBB 4GX1A 3I1IA 1GRRA 3GLRA 3OC0A 2F48A 1V47A 1WP4A 4RFLA 2HQSA 1NYRA 3EC7A 4PQGA 5DCYA 3I6IA 1XZBA 3E6AA 5CT8A 3RHTA 5BW8A 3EZNA 4P4SA 1I01A 2B8WA 3LT4A 3LJKA 4F84A 1SXIA 3CJQA 3OA0A 2IBMA 3A4TA 4RD3A 3N86A 1M2HA 2DR3A 1DELA 3BAFA 1QC5B 3B9BA 3LOQA 4GPIB 5BSUA 4MRMA 4A0SA 4BMNA 4BMSA 2GBGA 3QX8A 3VR5A 4YQEA 3A6ZA 3WLOA 4HFRA 3ZD8A 4NQRA 4LVOA 2E37A 4OQFA 2W2NA 1J0EA 4I1PA 3NJ4A 4PZ9A 2IHZA 3B52X 4LJKA 4TXJA 5K8JB 3BK1A 1UK9A 2OZPA 3SM9A 2HTEA 4LFCB 1Z17A 1YJ5A 1E79A 4Y2SA 1VB5A 2NQTA 4L2IB 1ZVPA 2OXEA 2ZRGA 1PFVA 3PQDA 3FBTA 4C7MA 3DULA 4D9BA 4KN8A 5AKLA 5I4CA 1WQ4A 2XMRA 1OW3B 1YFKA 2R7MA 4KJZA 4BBPA 4L8GA 1ULZA 2ZYAA 2N75A 2PMFA 4MWGA 3WKCA 1XZ8A 3DAOA 4I50B 4Y2GA 2I71A 3ER9A 1RM4A 4U0JA 3BHMA 5C31A 5CVDA 4D0LB 1TJYA 4XTCS 4ND2A 4DSOA 4OX9Y 4A36A 3ZYZA 1E5TA 4DR5B 3HI4A 3IXLA 1RC1A 4ZC8A 4GICA 3QE4A 1G7TA 1CS4C 4GX0A 4PC3A 5AVJA 3LUDA 4C0JA 2AQKA 2VQ6A 3LFUA 4D80A 4MLPA 4UJ5A 1EK0A 1M54A 1ZMOA 3G9ZA 4KU4A 5HJ5A 1YDHA 3HU2A 1THTA 1U1CA 3FYUA 1J8DA 2HJ9A 5DSTA 4KQ6A 4Z7NB 4UUNA 4JYZA 3U3ZA 4L0DA 4NPCA 2JFWA 4EJ2A 2OKGA 2WWFA 2Q99A 2JLYA 4OI0A 3N05A 3K0FA 4QO8A 3W06A 3U0VA 4EELA 2C99A 4I6GA 4IP0A 1UWLA 2CUZA 2E4ZA 3O1LA 4ZJZA 4GR9A 1Z26A 1UBTS 3EY9A 3VNQA 3G5AA 3ZC3A 1FU7A 1BDHA 1YZNA 2NUPA 4HQOA 3JQEA 3INGA 4EYEA 1F2UB 1NRXA 1NFFA 3BF7A 4H3SA 1X7YB 3TZLA 4KREA 1GY8A 4R0MA 1MB4A 3GGOA 5EQJB 3IEMA 3AFGA 1T3HA 2GJSA 3CNOA 2QIPA 2VK4A 2WINI 5LQAA 5F76A 2XCSB 1FDIA 3JQCA 2X7HA 3OECA 4C6RA 2VUIB 1O9HA 4OQZA 2VAXA 4J6FA 1GTRA 4Y8VA 3HBJA 4UD6A 5K3SA 2Y8EA 3V7YA 5AVSA 3HYSA 3UMSA 2Q1SA 3ZY4A 4N76A 3AGQA 4CMGA 4HI0E 4CLHA 4F3CA 1RE0A 2VOJA 1JT2A 4LA4A 3QYPA 4XDGA 3Q1LA 4UNPA 5JHGB 1NHWA 4P08A 3D0OA 1TM1E 4Y2UA 2FRXA 3DLIA 3GARA 5T7BA 5BR8B 2BKXA 5ENVA 2EGHA 5KKCA 3EWNA 2H1HA 2IUEA 5BO5A 4XA8A 4J9UE 1DFHA 1W49A 2I54A 2LRHA 4AO8A 5B7NA 3SE7A 3AVWA 5D01A 2CXUA 2L0XA 1RPTA 3I9LA 1EEHA 1ILWA 1GPKA 5GGYA 4ZCPA 4XR9A 1TIKA 5TARA 1ESZA 4DCPA 1HTWA 2HQRA 3HB7A 3T1YB 1OLUB 2X7XA 4BN0A 4DDUA 3ZBTA 1KVUA 4Z9AA 1M6WA 2AG6A 2R1TA 4OKNA 3PT5A 4OAOA 1T6NA 4Z0PA 4DN6A 4XSVA 1IY0A 1KEUA 4MRRA 2J9GA 1K88A 4LXUA 4R1QA 3G2LA 1FCJA 1VL2A 1CF9A 1K9SA 1KO5A 1XA4A 1Z6TA 3ET4A 1CR4A 4I5EA 4P1ZA 5D3ZA 2G1UA 4DSZA 1JQKA 1Q0UA 3U3OA 4XOIA 4RVGA 4WBNA 3O91A 3D0QA 3O8DA 5KREA 1YGPA 3W7BA 3WLMA 1JAHA 4Q9JA 4INAA 4LC0A 3AEZA 1G20A 5CA0B 3E2MA 2X1LA 2CJYA 4N12A 1LRJA 1R4NB 2C4VA 3RVNA 4G4JA 1ONSA 5MFZA 3PRKE 4M9UA 2AN4A 1Z2EA 3I09A 4KPGA 3QE0A 2YXNA 1ZOPA 1EWTA 2J0UA 4LDAA 1DQYA 1I3NA 1ZRSA 1H1LB 3K35A 4FKZA 4KVAA 5EPUA 2PGAA 1ZVMA 1QRDA 3IAEA 1H22A 2HLHA 4J90A 2BUCA 1FDTA 4J76A 5IBCA 4P36A 1QQTA 3KG2A 1A9RA 4HEJA 5AVTA 3EDRA 1NUQA 3IE2A 1A2BA 4HS9A 2VKQA 4F3RA 2QS9A 1FSGA 1H66A 2VP2A 3WISA 1SD2A 1KH2A 4TV9A 2HF7A 3CW9A 3GV0A 1A9TA 1F60A 4XGIA 3TL2A 1C3OB 5JJKA 4TMKA 3EDQA 4LK2A 2MSNA 4X90A 2QAIA 3LXUX 1U98A 4LNUA 4XUDA 3UMCA 2BGGA 1VL1A 2P9GA 4OFBA 4R2WA 3ZWNA 3ZS8A 3W5JA 3GA0A 1GTMA 2FRDA 2ZIUB 1KRXA 4C05A 4D9GA 4LYDA 1PEDA 1H2HA 4K1XA 4AF7A 3GLIE 1O95A 5AD1A 4HQ6A 2OHOA 2IY8A 1YS4A 1YS9A 1UADA 3QY0A 4WACA 4ROSA 3QELA 2AOTB 4AY5A 4WPGA 1Z47A 3Q8KA 2AXNA 4AKTA 1Q22A 5LZ9A 4BU1A 2W6QA 1WM1A 1XTKA 1KTVA 2JLCA 2NIPA 1UBGA 2QENA 4ND3A 3FZEA 4IGFA 4TVOA 2B4YA 2ENUA 1CX9B 2O4CA 2VNSA 3D5TA 4LJLA 1QRRA 2FN9A 1FUKA 2EBHX 4FEYA 4QO7A 5CLHA 5LA6A 4LFAB 4B6GA 4MUNA 1GL6A 1I0LA 3AR6A 1Y8QB 2WIJA 4FYKA 1RLTA 4GMFA 2B1IA 1KI9A 3DG9A 3UMYA 4ECEA 5IVHA 4Z3DA 4J3JA 1HMYA 2XI4A 2GA8A 1YZQA 2CXNA 3NIWA 4TWRA 3VH2A 2DEUA 4AX4A 1GWNA 1BAPA 2DECA 2C83A 5EZQA 3T7KA 4RENA 1NSFA 3H1PA 3RSHA 4I2NA 2V9ZA 3EYWA 4FLEA 5K03A 4LTNA 4FFNA 3H5AA 1EQUA 1E18A 3TSCA 5BXYA 2EBFX 1G8HA 4A1OA 3RC2A 5HS6A 4BO0A 2BMWA 3GFFA 1IM8A 3AB4A 5IN5A 4BJ5A 4AF8A 3VDMA 4MUJA 4DIBA 4TLCA 1DLIA 1F8FA 1IPFA 1NY5A 2ZBDA 4L9RA 5JJBA 3FVWA 3ZHQA 4IHJF 1V16A 3O2QB 3KVOA 2BR3A 2R6CA 3MWGA 1LD3A 1QMGA 4U9UA 4W5QA 5E38A 4HRXA 3KR2A 3G9UA 3RC9A 5JNLA 1F8YA 2ZKIA 1CE8B 2FMKA 1GTJ1 1MO2A 1ZGHA 3OZAA 2Z95A 2QOEA 3I37X 4C6TA 4F8JA 2AKEA 3CUKA 2LKCA 2XE6A 3M2PA 4WWHA 3ZCVA 2D1FA 2C5FA 2WG1A 3CLTC 1Z7WA 3R7SA 3BZUA 4PYLA 2SNIE 3QZUA 2FW8A 3OQBA 5FAKA 5HUJA 4NZZA 1UEJA 2NTYC 1P7ZA 3QLJA 4I08A 3UGQA 1PNOA 1JR3E 1EDOA 4WCFA 3KPVA 3KDPA 1E6LA 2B8JA 4B6QA 2GCGA 2XMGA 4LQDA 1PEYA 4KCGA 1NYLA 2IS4A 4DKXA 1HLDA 5GTDA 2VXCA 3WRVA 3CUEF 4TMXA 4E22A 1HFWA 3C1OA 3RRXA 1O94C 4PVDA 1PE0A 3CSSA 4BIIA 5AUOB 5KNLA 3F6EX 3O6VA 4NG5A 1WD5A 2GZAA 3JWEA 4IRMA 3RSLA 3WB9A 4OU5A 5B7PA 3U61B 2BHTA 3V8BA 2GNAA 4BNFA 2JLXA 1RAIA 3HMKA 3A2KA 5JYBA 5AKGA 4NPAA 1RJEA 2JIDA 1PR1A 3AJEA 3Q3VA 4M9XA 4NSNA 1DKPA 4RJJA 3BMXA 4UEWA 4YALA 3BRSA 3UHAA 1KEEA 1O6BA 4NBTA 1PWEA 1FDVA 3QVWA 4QPDA 2ZREA 4A6PA 5CFZA 4YRDA 1UBSB 4PZDA 3SQDA 4V1CB 4HMQA 1WMBA 4G1EB 4KXXA 4HWKA 4JB8A 4RHCA 1Z74A 4FD3A 3CZAA 3JVUA 3QXJA 3EIOA 1BEZA 1KJYA 4W7SA 5JI2E 5KB3A 2BEWB 1JGTA 1Q6YA 1U3GA 5EJ7A 4ZCLA 1U8XX 3LIIA 1KDZA 1IBLB 1WB9A 4U5XA 2BMFA 1N9GB 2W6MA 1NAIA 3FSJX 5CIWA 4M8KA 4YAKA 3D8BA 3B2EA 3CUUA 2MMCA 1C0KA 3E9NA 4V38A 2XXJA 2XSZD 1LB1B 3K8YA 1UMBA 1EHIA 1TZBA 2GM4A 3U7HB 2IK8A 1N7IA 2XUHA 4YRFA 2W6OA 3PRHA 4U2FA 1XPOA 5SYMA 2XKKA 2PQ6A 5DV9A 1X1BA 2FN4A 3LQFA 2BHRA 2UUCB 2I3BA 2L2QA 4X1KB 1T5HX 4FB5A 4ISCA 4RLQA 3HGQA 1XXHE 1CRWG 4DJEC 2IYPA 4NU5A 2VRWA 2XWSA 1BMQA 2UZ0A 4MV0A 2UZIR 2O8CB 1NG1A 3DB2A 3EVEA 4K8RB 3UV3A 1Y9ZA 4FBLA 4FUTA 3EVZA 3ML1A 1S2LA 4EA9A 3KAKA 4WLUA 1M1YE 3PUWA 4HXGA 1T36B 2GM9A 1NLFA 2EF1A 3DC2A 4GKKB 4ZHSA 3DMHA 3E58A 4YV1A 4NP6A 4P3KA 4YK7A 4D4LA 4IO1A 3C7DB 3EEBA 4WV3A 1FNBA 2JEYA 3CNEA 1Q5PA 2I7VA 4WA8A 3M3HA 2A1TS 2XBUA 4RPIA 2AVNA 4KBYA 2AVDA 3LQQA 2Q3EA 1XA0A 2XUOA 2PL3A 4YH1A 2ZXFA 2ZRMA 5K0LA 2B9EA 2Q1WA 2Z3ZA 2CV2A 3JASB 2V7UA 3WWPA 4F38A 5KKNB 5HQJA 1KAHA 1KMHA 4QM6A 1FSFA 3WBKA 4O4HB 3T7EA 4DABA 5LMZA 1N2CE 1DMSA 3L7BA 1ORRA 4OD0A 4XGRA 5KTYA 2CLSA 3Q87B 2AFHB 3UB2A 2FP3A 3IDSA 1Z6AA 3SS8A 1VBFA 2WC1A 3H5OA 5HDBB 3VYTB 4MW1A 3M0EA 4EI7A 4C5BA 4K5QA 1Q57A 3ZU6A 1OYOA 3DTTA 3ZH2A 1KFEB 3HQ4O 5IS2A 1YAHA 2FN7A 1U2DA 3G6KA 3PCXA 4KIFA 4RD0A 2NYUA 1Z8FA 1JQJC 3QU5A 4W7IA 4B7UA 3ER8A 2O7SA 1CB7A 5JARA 3ZG6A 1U8CB 2PKEA 3F46A 1ZVVA 1P1RA 4ZMSA 5H1YA 5JR3A 1XP5A 1WABA 4PICA 1VPWA 1V5IA 3MIIA 2B4RO 3PUZA 3GP8A 3HJNA 3V2GA 1L8AA 1L6IA 3NASA 5GY7A 2QN2A 2ZAMA 1Q12A 5ALOA 2ZBPA 4KITB 4GPZA 1QHYA 3C5EA 3VJKA 4EB6B 3ZLTA 2XHEA 4OJNA 3R8FA 4JHLA 1CDDA 3EIWA 3O3MB 1V5GA 4XVRA 1HTTA 1VJCA 2Q4RA 1EFKA 1UQTA 2Q9AA 2A58A 3F97A 4TKMA 3KXDA 5CCEA 3ENNA 4ZVPA 4QG7A 3RVPA 1AMUA 1AKWA 3SBOA 1ISPA 2TECE 3OIVA 2R1VB 4LJ6A 3KE9A 5IM5A 5M29A 1LLUA 3TTXA 1JJIA 1BNCA 2YDXA 1DUSA 3TB6A 1GTL1 1I1QB 1YVDA 3FUUA 4TUYA 2G4VA 3PHBE 3UH0A 4D8VA 4F4HA 1E9RA 2W71A 2INGX 3D0RA 2D7DA 3DMTA 3FCOA 3GWGA 1YQQA 3HXKA 1RE1A 3HYNA 2VYNA 5BNZA 4ER0A 2HCJB 1KGSA 2Q3DA 3V6MA 2A8YA 1YDFA 2CLCX 3MSCA 3TEFA 4E2XA 3NIFB 1JP7A 4D3YA 4B3DA 5KWVA 3EQ9A 1ZNZA 4K1LA 5K2MA 4ZYWA 1WIWA 4ND8B 5CDTA 2ATIA 2UYOA 1C4KA 1TQHA 4X6UA 5AR1A 5IBPA 1PR9A 4YT2A 5I8WA 3A4VA 2QJWA 2J3IA 4QREA 4BLSA 4K9PA 5BN1A 2CMKA 3OOHA 4PHGA 1ZD4A 2C4UA 3U4CA 2E2WA 1IZ0A 2G5TA 2G4CA 2HMWA 4PS1A 2W7TA 3JALB 1C80A 1AKYA 4JLBA 4X1IA 4RY2A 1YBFA 3UIEA 4C4RA 3R0VA 1OXKB 2C4TA 1KC1A 3CX3A 5T8KA 5FWYB 1QP7A 5EJEA 3DM5A 2HSEA 1W44A 2TS1A 2KLBA 4LEIA 5JNSA 2WMNB 3CHYA 3IQWA 4EENA 1FJHA 4EJSB 3HNOA 3K0HA 4D9FA 4UAVA 3H05A 4I8DA 1UZMA 3OTWA 2I03A 1W0CA 4QHTA 1KI1A 1TC2A 3N8KA 4GOXA 5HGXA 3HJGA 3ADDA 1AKQA 4QJIA 2EW2A 4DCJA 4CUKA 3RV4A 1GFIA 2FR8C 1NNLA 2PUHA 3SX4A 4F60A 4TKVA 2NV2B 4YUAA 1FFEA 2F8MA 4MI6A 5JFTA 5B64A 3N0XA 3AGPA 2I2WA 4MS3B 1BOFA 1PYOA 1CSEE 1QGED 3WTCA 2B34A 3DL7A 3P9ZA 4TWJA 2MSCB 2EVWX 4DSAA 3TSYA 1N34B 3G7SA 4RVSA 2IUFA 3I64A 3VX3A 4BOYA 2XD4A 2IYNA 4CIAA 1HRDA 2ID8A 1BCSB 5KBYA 1KFBB 4RIIA 1TYEB 2YDYA 4D41A 3GDOA 1NUPA 2OA0A 2JLSA 3FG9A 4MYDA 1RQLA 1U02A 1XDSA 2FZ5A 3R1IA 4ABTA 2BDEA 2FUKA 2JLVA 2ZAOA 3ZK7A 1Z37A 2ACEA 3CKYA 3B1FA 3MAAC 3GC6A 5FAXA 3IURA 2I6SA 3WFJA 4BTVA 2NUTB 3KL2A 4HH0A 4R1NA 2BZ0A 1VTKA 1RI5A 2XKBA 2NU9B 2EARA 4E3WA 3DE4X 2DFPA 4Q03A 1XHLA 3HDJA 1VLMA 2G9UA 1M67A 1O96A 1ZK3A 2ZB2A 1BE8A 1P0PA 2AIRA 4IWXA 2OCAA 1T0BA 1VGRA 1L8QA 1LDYA 3GQBB 4TV8F 2VHZA 3BSSA 2COUA 4CBVA 2PFKA 3JWGA 4A82A 1MOPA 3LPNA 5IJ0A 3O9ZA 2AZXA 3FLAA 4QQ8A 5B2ZA 3W79A 4BNDA 4COOA 2YMPA 4MEBA 4WKNA 5SZKB 1HURA 5HJEA 3TB4A 4BZQA 1R3UA 4FQ5A 2I2FA 3FHLA 1YZYA 2WZBA 3H3FA 5FTMA 1RAAA 3QMPA 2PHZA 1DCMA 1QKKA 1SCQA 1TF7A 1XL0A 2PMWB 4GBMA 4IH4A 4CLDA 1ZGGA 5FNVB 2ZJ1A 4RNDB 5H83A 3QSYA 1O7JA 4ARVA 3S8EA 3AM3A 4YB8A 2FKAA 5EWJA 4DQVA 1O58A 1YE8A 4RJIA 1B74A 2FSFA 2DLCX 1U9JA 1PBNA 2A9QA 5K3AA 3T1NA 1RI3A 2DZDA 5AOBA 3ZDFA 1PK8A 2DTDA 4LECA 4QQFA 2AFIA 1H5UA 4AROA 2XMDA 4FT2A 4Y0NA 2Y1DA 3C7KA 5DVZA 3PFNA 4A0GA 4Z4EA 3AHDA 2CFOA 4L73A 3DMGA 4K3VA 2JVIA 5C5IA 3TFOA 3O8QA 5DCWA 3ZVKA 1AGXA 1H2XA 2X2OA 1F7VA 3AI7A 4RO0A 3P32A 2VBFA 3ZE9A 5ALEA 1JDBC 1SOWA 3MCTA 2C2GA 2V7GA 1AUPA 2WYHA 4CCWA 1UZAA 2GBPA 2WP8J 2OBYA 2AF3C 1TTTA 4NBUA 4MO2A 3LY5A 4LTMA 1OIWA 4W8GA 4RPHA 3SXPA 1XU4A 4O63O 2VF5X 4GT1A 1SIOA 3DUFB 2H1LA 5JSKA 5FOTA 1JXMA 4EB0A 3K53A 5AVKA 3KJFA 1XMJA 3BQNB 2EIXA 3I58A 3W90A 5KHLB 4I1VA 1O6GA 2CXRA 1MN6A 2N9UA 2XVZA 1T8UA 3AR5A 2PKWA 3DOJA 5ALRA 5CFMA 2B98A 4GWKA 2VQFB 4JI1B 3MINA 2OFFA 1HE2A 4E5UA 3E23A 3ILXA 4GSLA 4GWGA 4Q3AA 2CF6A 1GRCA 5KKAA 2FW6A 3UCXA 2OO3A 1BHJA 5I9MA 4BQQA 4UEOA 1ZH6A 4DILA 2ID9A 3HR7A 2IPMA 4GBGA 3X1JA 3HKCB 2P4EA 4ER7A 1TYZA 4R01A 1JAYA 1E5XA 1US8B 1DBRA 4HKTA 3UJAA 3UWPA 1XFDA 1UJCA 5EE9A 4XVCA 1CY1A 1NNSA 2F90A 2P2GA 3ITNA 4UM5A 3W5IA 3HJAA 2GBLA 1L3CA 2PS0A 2PVCA 3PB3A 3U7GA 3KHKA 2IZOA 3C6ZA 4WQMA 4LY6A 2AHRA 5H80A 2Z9DA 3ZIAA 5HX7A 2NTJA 5L3RA 1T24A 3KJZA 2X2PA 1S9DA 3AHGA 3WK8A 2O4UX 3TNJA 1Y37A 4QARA 5KDLA 4BRUA 3ZWKA 4DBLE 1T9BA 3NV7A 3O90A 1RFLA 3I39X 1J2JA 3QIAA 5J2UF 3IAM6 1A2KC 3RADC 1GGVA 3KR1A 5TIIA 1N6RA 1J7KA 1S1CA 1T2AA 2IDJA 2QPOA 4BCCA 3HXOA 3KB8A 3TQCA 2FWNA 4G0YA 2IXAA 2EKZA 4IJMA 1FYVA 3OIUA 4AJ4A 1Z6GA 1V4NA 1RKUA 3TJMA 2F1IA 5KX5F 1JU3A 4ZXFA 2P2CA 4G0OA 1RC0A 1Y3HA 2FW0A 2WFLA 2IOHA 4P82A 3RBZA 2Y76A 1Z6PA 4G84A 4R9NA 5AOVA 1GKUB 3EH1A 4QBFA 2WW8A 2R85A 2DFKB 3EZYA 3TPFA 2YFKA 4YRNA 2GEKA 5A03A 4FYYA 1U9YA 3T3EA 3TVDA 2B5WA 1EHYA 1SPXA 3T61A 2FJUA 3R24A 1MH1A 4KQIA 3SZGA 3WO1A 3SQOA 5FOQA 2PUTA 1W59A 4HGNA 1J9GA 3OZTA 4KSYA 2CDCA 1KSJA 3EG9B 2GEJA 1N36B 4OGLA 1U9IA 4B6OA 2PWYA 5CD1A 2IC5A 4XWTA 4FN5A 3A9UA 3RSZA 1D2GA 5ALVA 1TCVA 4MICA 1I0ZA 2YH2A 1HDXA 5F77A 3RCBA 1ECPA 1L4HA 2ASVA 4EGJA 1ENOA 4XD7D 3B7GA 1S8OA 3U4IA 1G4HA 3F8SA 3NP9A 2GN9A 3F7NA 4MWSA 5B3JC 2F55A 3U4MA 1FP4A 1QOQB 1WNTA 3HN7A 3ZY5A 5BN3B 5FEUA 1OIVA 2P91A 3J81k 6CHYA 3OHPA 4ZGBA 4NH4A 2I1VB 1XE3A 5FI0B 5ESRA 1ZEMA 3P2EA 1F0KA 3RTGA 2JLRA 4U7WA 3VPSA 3X2EA 2JHAA 2A9RA 1KPGA 2I7DA 4LF8B 1E1CB 5FI3A 1JDBB 3FRJA 4H0FA 1FUIA 4UXIA 1PS9A 3V4RA 3EEFA 5KWIA 2QUAA 4L4XA 1VLJA 4N6OA 3PICA 4R5MA 1ZU5A 2QVCA 4MVJI 4PLWA 3HPQA 1W19A 5EXSA 4ZEXA 5HOQA 4KR2A 1N5MA 3QI2A 4OOEA 3FPEA 4ZU6X 1GUBA 1T5TA 4LPSA 1USGA 4WD3A 4CN9A 3ANYB 4RTQA 1QTRA 4ZO6A 1YBHA 2GTIA 2KS6A 4GL2A 2E1RA 3KC2A 3H9JA 1E3WA 1XD2B 1QGUA 5I7RA 4WFQA 2EFDB 1W29A 2PYDA 4G4GA 4QOFA 2QY9A 4PBTA 4DMHA 1PT8A 4PSAA 3UTDA 3ZE0B 2Y0PA 3MWLA 2QK4A 2ZRHA 4JEUA 4WINA 1DU4A 5AW5A 1P39A 1ZD2P 4L8WB 4P83A 3VR3A 1XPUA 5L6LB 3H11B 2O2SA 3ZWMA 3IT3A 3ZEIA 3JQAA 1A2OA 5HKKD 1WPXA 2WQ6A 5KNBA 2HRBA 1J5PA 1ELOA 3KLNA 1ZFNA 5DTEA 5TR9A 4EEKA 3RJ9A 4U2KA 3JQGB 4EGFA 5GOZA 1N3IA 4C0HA 2FFAA 4G5YA 4AJ9A 1GZVA 2F1OA 1CJSA 1X1TA 4QOIA 1THGA 4D8XA 4IXMA 3ETHA 5LOVB 2XMBA 4JBNA 1VG8A 1DXHA 2QP9X 1BC5A 2FPRA 1M0EA 3NAZA 2CD7A 2D5IA 3OM9A 3ZDBA 1Y3FE 1JR2A 3RYFB 3O8OB 3V46A 1YCDA 4RKRA 4EUHA 3L7CA 3U19A 1J0XO 3A9VA 3PZRA 5CNIA 2RH8A 5DKFA 1L7VC 2I7TA 3EWAA 2WKRA 3GJ4A 1XLVA 5TPZD 3DCIA 4N8SA 3U7QA 2ZWVA 4B4WA 1ES9A 1I9GA 4NCIA 1YZKA 2DWPA 2OV1A 5H7XA 5FX2A 1WUTA 4HDAA 2OPHA 4O4JB 3K1TA 1RSZA 1UBUS 1EP2B 4OQ4A 1DOHA 2NACA 3OOEA 1Z29A 4EY7A 1FK8A 4RHYA 1JYEA 3PNMA 2JLWA 2ZUEA 3PDIA 1S8AA 2C2YA 2YY6A 3BPSA 1L0BA 1N33B 3W04A 3KVRA 1TADA 1Y3BE 1C1DA 4QXAA 3KQSA 1DAHA 5GVRA 2A4KA 2GUWA 3B70A 2CMHA 2CVZA 3F96A 3MMPA 5GIOE 4UZFA 4EWLA 4OLJA 3QBVA 1RJFA 3AR7A 3CUYA 1C2YA 3CVXA 3BUSA 3JYOA 3NH9A 3SC3A 2BFEB 4KUGA 1WXQA 1UMDB 1PJ2A 1E9AA 3ZZNA 2QQGA 3DWFA 1NDHA 2EF0A 3DDUA 3HSSA 5KJ6A 1RZRA 3L18A 2WE7A 3OLQA 3T7RA 4BWFB 2WM8A 4JBIA 3JVEA 1Q1AA 1XRJA 1IXYA 1MA0A 2QTAA 2X2FA 3O9MA 3OPVA 5EXTA 3FPSA 5EP1A 2QP3A 1P0QA 4Q4DA 2O8EB 2JEOA 1HPLA 4GWLA 5CDFE 2R4QA 4OL9A 4YCCA 1Z5VA 2BSXA 3PUXA 1D1PA 1X19A 2HA2A 4NZ9A 5EVJA 4RZUA 1G1MA 1Y9JA 2HU8A 2GASA 2IGBA 1JJVA 2ZJ0A 3QOFA 2PUGA 1EFUA 2WHPA 3AR4A 3FDIA 3M2TA 1ZIDA 1F2DA 4WAUA 1YRLA 1RYBA 3E15A 3ZE8A 3FDJA 4NCHA 1EVEA 4L5YA 4AU1A 4BYGA 3PHHA 4O4IB 2DFLA 4UOEA 1I2DA 2O05A 1D2NA 3KQTA 4YI5A 3EFHA 4M1WA 2FR1A 1NMSA 3TSZA 5CB4B 2DF8A 3C74A 2Q3FA 3D8SA 2H6EA 3LK6A 3OE4A 1LFDB 4KPUA 3LRPA 2JJMA 3DEKA 3JW8A 2AOUB 4PYRA 3MERA 2OENG 5NULA 4E33A 2BTQA 1L7OA 4BVHA 4IG4A 3KCQA 3O9VA 5AVRA 3S1SA 4RKYA 4YEDA 1P9NA 3IEPA 1G6HA 3QUCA 1RQGA 4QSMA 4BO5A 1E62A 4MB0A 5H4GA 4JP1A 5CVUA 5KHAA 2GEFA 2OAP1 3GG9A 2X14A 3QFSA 2FFQA 2VDKB 1E2UA 1Z7EA 4KFUA 4UBLA 1AGRA 1VJDA 3ZS9A 1E79D 2BFFA 3FMGA 3Q7QA 4I8XA 1NUTA 3K2BA 1VHWA 2YUIA 3RT7A 2CJPA 1FX0B 3F47A 1LQ2A 4FMDB 4X3PA 1XMQB 2P0YA 3D0KA 1MNQA 3ZCRA 1XUOA 3LP8A 1LDEA 4HLCA 4LOAA 2VQEB 1KO7A 5HR5A 1JEEA 1O0BA 4DWOA 3QPBA 5CK4A 3RIHA 3OTOB 2IYXA 1K8RA 5K0TA 4RJKA 1EUQA 3V8EA 2XMQA 4RANA 3WHPA 5C8DA 3DXYA 5BORA 2JB9A 2ZYDA 4BV9A 1M6VA 4P81A 1Z5PA 1P77A 4X20A 1RABA 1JA0A 3BILA 4DMGA 1C30B 1THMA 2NXCA 1U0RA 4M83A 3QEOA 4R1PA 4EHHA 2FEXA 3IJ5A 1NONA 4GG1A 2MCFA 5G4KB 4BP3A 3DW1X 3O4VA 2BKLA 3BIJA 4R1LA 2W90A 3UT6A 4EJ6A 1DTWA 3BD7A 1KK3A 2IT1A 4PLTA 4PYNA 5JWOA 3ACCA 1NASA 2GZRA 3L84A 1SQ5A 3LUJA 5LDDC 4RESA 1UPFA 1UFOA 3V3TA 1KAEA 4CMIA 4E51A 3ICPA 2BH9A 5JSHA 1CUFA 4I50F 5JO0A 2CV0A 4O8CA 4M1TA 5T64A 3HB5X 2QG4A 4ARBA 1SKBA 2XWBF 4D98A 5HZHA 4A8TA 2WHQA 3DMPA 5FNZA 5B5SA 4FGUA 1WQ1R 3LOUA 4I6JA 5KYXB 3ADCA 1X7XA 3A3OA 2WDPA 1GJRA 2PLWA 2QTZA 4IS3A 2UXBB 3RB8A 4B3MB 1GT6A 5ESWA 1P75A 1VKRA 4J2HA 1EQ2A 2G04A 3GDGA 4O4LB 5BYJA 3S2UA 4YJ2A 2B99A 3EPLA 2I8CA 5IJ9B 1YL7A 4RK5A 3GG2A 1IHDA 1RI4A 5BN4A 3H18A 3UGJA 3N7AA 1E0KA 1SR8A 2ZSBA 2F1KA 4LYFA 4UTVA 4OGGA 3VOBA 3P94A 2RGEA 1G7RA 4JVOA 2AMJA 4P53A 1I2BA 3B60A 2JGFA 4EFKA 3BE8A 5JY6A 1MQ9A 4YCDA 5LKRA 1YR6A 2WSLA 3K1YA 4M60A 4A1FA 3BB1A 4NK4A 3H4IA 2EQAA 3LXXA 2W6IA 2C4HA 3QVMA 4UEQA 5DM1A 1X42A 5LSAA 4UBIA 3QTBA 5JH7B 2V7PA 2ZVQX 2XE8A 3ESRA 4Y67A 3P97A 4LHSA 2G09A 3HHPA 4RHXA 3DO5A 2FW7A 3TYXA 3LSYA 2AC4A 1ZM7A 1NMXA 2FDXA 2Q0XA 5JRDS 1HDOA 3H1GA 4MR9B 4RKEA 3WK9A 2AB0A 1DKNA 4HNHA 5AKJA 2QTLA 5GWXA 4AULA 2MYUA 4AYXA 3FYUC 1E1KA 4Q4LA 1XPJA 3PYXA 4M0CA 4U2GA 3RSFA 3S44A 2OBNA 1MC8A 4RK7A 2J46A 4W9MC 2JCGA 2G70A 2QHXA 2VDUE 4M0MA 1XQWA 3HCPA 3OPXA 1JEJA 1OFUA 3PFHA 4ZREA 1R8XA 3L05A 3CIFA 1ZL2A 2HSZA 4PLPA 4EEZA 2ZT7A 4GBJA 5FORA 1I7DA 3LV8A 3T7TA 1NQOA 1FTYA 3SZOA 1TIPA 2WU0A 2HA5A 2WSSA 1AGYA 4YIHA 3NKVA 3EDYA 5HQ3B 3QLUA 4QOHA 3VC1A 4KJXA 4D4IA 2WJYA 4Z2AA 1Z07A 4R41A 1NIPA 4IQ8A 5HDQA 3NRCA 1PR0A 1XELA 3AG6A 3B53X 2WOJA 3D02A 5ITVA 3WL6A 1M66A 1E99A 4YJFA 3ZXUB 3SMVA 2ZIZA 5FOVA 1I9CA 2JA2A 3GGDA 4DZZA 5EIEA 1O95D 3NONA 4BQIA 3W1WA 1FTNA 2DKNA 4N7RA 5DGTA 3WL5A 2CFTA 3KZVA 3QGMA 3SJCA 2YHAA 3L6DA 4RBNA 5CA0F 4E2ZA 2JIOA 2EL9A 1LNSA 1FDOA 3A2NA 3TX6A 1H2FA 2BWJA 3C41J 4N40A 5J58A 3WYBA 5JTUA 2ZRQA 1H2AS 1N5DA 3JQFA 2GHTA 2PV7A 3QOXA 3WBFA 4PGFA 3TAUA 5BN5B 5JDIA 3BD8A 1PR6A 4DCCA 3I04A 3FY4A 4KV9A 2AR7A 4M49A 4X6LA 5JIBA 1LPMA 4FOSA 3RPEA 1CY4A 5FUWA 3FDZB 5JUWA 1Y8RB 1VIAA 3PGKA 1E2EA 2FRVA 1BX0A 3N75A 2O5RA 3MRSA 5JO9A 3UHFA 4EFNA 4F2PA 1WCIA 4YAIA 4QVIA 3DBRA 2VKTA 4NJMA 3RUPA 2RD2A 3IGFA 4K2AA 2DH6A 1EFTA 1FFAA 1PL0A 2UVQA 1TTHA 2HA0A 3GN2A 4LV5B 4NK5A 4YIKA 3T7SA 4H7EA 3M4JA 4IIVA 2K2WA 4ZEMA 5FBWB 1B76A 2JLZA 3BWEA 2CHUA 2BUAA 1DXOA 2NU7A 2GXUA 4C07A 1IXSB 2XNKA 2YWJA 1C8KA 1JDNA 3QKRA 4MDEA 1CUGA 1Y4SA 3VR2A 1KFJB 2I4LA 4RABA 3A4IA 8LDHA 1ZIYA 1PG0A 3WYEA 3IEVA 2XW6A 4UQPA 3ZK9A 5ADHA 2OK8A 4KXYA 3H13A 2X9NA 2Z9BA 1EIWA 4M3NA 5H9VA 3VR1A 4G8JA 1AQLA 1MC4A 3R77A 1VL5A 3FZQA 1YOBA 3T4PA 4W9RA 5L7TA 3KQNA 1J0CA 3QFFA 1GTVA 4TMZA 1GL9B 1XMSA 2VTVA 3ORYA 1JWLA 1GCAA 5T5QA 4U7TB 3ZK8A 1J39A 1KKMA 2RGYA 5M04A 5E1BA 3HWWA 3EQZA 4MVCA 4UTOA 3OZSA 2PKXA 3GX1A 3PTZA 5FFNA 1ZXLA 1EXWA 5D3MA 1DG9A 1WV1A 1HDGO 2FOXA 3QSGA 4ZVKA 1WTCA 4X66B 1DEXA 2IY9A 1RJWA 4Q1EA 3IH5A 4K9MA 3MJSA 2CNDA 3HKDB 2GO1A 3TRIA 1F6DA 2J32A 3X0DA 3ZLJA 1W2WB 3OX4A 3LKDA 1MVNA 4XIFA 3TNYA 4ZCRA 2WTUA 4EG5A 2WIGA 2VK1A 3RUHA 1L4BA 2C9OA 4BX2A 2ILVA 2XNCA 5I9NA 4FC7A 1V0JA 4NJEB 1HG1A 2QZPA 4Z8XA 3V4SA 4GW3A 1TCCA 3UA3A 4JJGA 1M1XB 4WA7A 1XMXA 4JSRA 5DULA 4FJ2A 4IIYA 1EVJA 3H8VA 4MVJA 4K9OA 4WUVA 4X45A 2P11A 5HUQA 2BY4A 2F43A 1I7QB 1K5DA 4WZ6A 3C16C 4Y6GB 3D3EA 2XOEA 1HDYA 1SVMA 4IWYA 3NNDA 4PS0A 4S1TA 5CA1A 1KAMA 1UDAA 2QRGA 4IIHA 1UXGA 5LQMA 3TF5A 5KOHA 1BSVA 1ZY2A 1AD2A 1ADCA 3L7AA 4GI2A 4YREA 3VM6A 5JNVA 3GCDA 2XMPA 3NU1A 2QM0A 3CNQS 3GH1A 3NYQA 1Q91A 3UO8B 3H2KA 4MPDA 2FEOA 2LV8A 4TTRA 2IIBA 1EP1B 2ODAA 3M6VA 1N4AA 3TI7A 3BFVA 5CLJA 1JKIA 5CEJA 4QELA 3OCUA 3IQXA 4PNPA 5KCMA 1ZCFA 4B3FX 2DVMA 2QP4A 2AMVA 3IIKA 4U2DA 1E0JA 5LZ5A 3W4JA 2AW5A 5BR7A 5H3HA 4Y98A 1PFQA 3P0RA 1RPZA 3D6VA 1ECLA 1UKBA 2H9YA 1V7ZA 2ZAIA 4IDPA 1L5YA 5JY1A 2WUEA 1FL9A 1LZKA 1ADFA 1NWCA 2H16A 2H4WA 3BTOA 4YRQA 1VE1A 1P1BA 1JDUA 3UMJA 3PEVA 4G81A 5DPMA 3KZ1E 3I2KA 2R8XA 2QX7A 1A7AA 4S0XA 1RCUA 1NBMD 3OI7A 1A69A 2W2OA 3N2GA 5CNJA 4MUIA 1L7NA 2NSJA 1ZD1A 5CGZA 4KQHA 4C21A 4DNXA 4BJ6A 1X7HA 2O8NA 5CYPA 2CZGA 1ZH4A 2VOEA 2UZ1A 4PAMA 5G3YA 2XT9A 3A0UA 4GP7A 5L95A 1IOLA 3KSAC 5I6DA 4UTNA 3FLEA 1GXSB 1VCIA 1HGXA 5F52A 1WRBA 1IVNA 2Q1YA 5C7LO 4QJBA 1PLLA 4NYJR 3RUFA 1YS7A 1JE1A 5AVQA 1RIIA 1FP1D 4M99A 2R1TB 3BD9A 1QCDA 1FFHA 2NTNA 3EGWA 2OOSA 2ZP1A 1RMYA 3QU2A 4ROTA 1SAYA 4URHA 2J5RA 1AO3A 2IFTA 3I6MA 2GSWA 4WCFC 1KJ8A 2PDAA 1W93A 3DBLB 5IDYA 1YVEI 1Z6QA 3K8ZA 2WZCA 1KSHA 4OPMA 3TINA 1H9CA 1I32A 1NXQA 4CVNA 3RHSA 3AZOA 4CTMA 3WNBA 4O59O 1X1RA 5FFFA 4CGZA 1R00A 1U8UA 3GLFB 1KJNA 3AO0B 2W70A 5FLXA 3KFLA 4JUCA 4EM6A 4FEEA 4JU8A 4JMLA 2JH8A 2YL2A 4REQB 1T26A 5CTAA 2HQBA 4UHDA 1CWUA 2J0UB 2JVKA 1LS6A 3N58A 3C3BA 2WJZB 4UBJA 4B0PA 2QUIA 4BKMA 2V74B 3J81A 1KP2A 3DV2A 3M81A 4HZUB 5K0JA 2BUBA 4UEKA 1T5IA 1UXIA 4F06A 5FYQA 1NUUA 2QRQA 4H7PA 4YXWA 3TKLA 3UAGA 1WBJB 3SIXA 3F4LA 2I7XA 2WSIA 4EX7A 3O4IA 3UJCA 2C2OA 4GOKA 5K1ZA 4AYTA 1QK4A 4HEA1 2NQ8A 2Z83A 3ZHUA 4EQZA 1BCRA 3R6LA 3WLTA 4DCTA 2X0NA 2HMFA 1C9DB 4W6QA 3E48A 3WGVA 2A86A 1I7NA 1WBBA 4LE0A 1NW5A 1UJ4A 3EXFB 1VDMA 3KLPX 2EG5A 3BGDA 5ES4B 2FFRA 1Z34A 1P7CA 4L5AA 3TUZC 3KKZA 2GETA 5FXMA 1X74A 1GG2A 3A7EA 3EJ6A 4TOIA 1EM8B 1I30A 1LTHR 2DQSA 4BLOA 4PZ0A 2Q9BA 4GPAA 1UR5A 4EBBA 2RHTA 4HDNA 3OO1A 2HH9A 1GNRA 4DDVA 4JOBA 4R4JA 5FOUA 1COWA 3N8NA 3OCVA 2UYCA 3FUCA 1ID1A 2Y9MB 3UMFA 2Q45A 3IPCA 1L5MA 5IDVA 1C7QA 2PK3A 1JSCA 5C8YA 1CQJA 1QHIA 3RO7A 5JWHA 4FOOA 5LA6B 1QZUA 1LSUA 2EWWA 4XH9B 2BIFA 1HLPA 2GD0A 3D5EA 5E4FA 3ILYA 2R44A 5IVPA 2H4ZA 3ZJUA 4NYJQ 4JI8B 4GE3A 3NTRA 5EYPA 5F5LA 3H9QA 5DHUA 2NV0A 3QIVA 2OLJA 5E2IA 2PXXA 1T1SA 1P7VA 5AI4A 5JSUA 2EEZA 1ZAYA 4Y6QA 1XU7A 1K63A 3IYLW 2GFHA 3KBOA 4QATA 4XASA 5DGXA 5F1YA 4O2LA 3BHJA 2G1JA 3LYHA 4RH0A 4S12A 1OLXA 1EX6A 5BT9A 1QGYA 1Y81A 1CEQA 2NZUG 5IC6A 1N3LA 4GKBA 4K0RA 4KXMA 4P5DA 3W6NA 3ADBA 3TBKA 1D2RA 4IPTA 4Q02A 2Q4OA 1EAMA 4FYPA 3TGPA 4M6WA 1ECJA 3CZ9A 4JVLA 4B4OA 4Q3KA 2F1RA 3N3AC 1YU6A 2VP4A 4F9FA 1XDZA 4HDRB 1N0IA 2OCXA 3GBVA 2FG7C 4I1YA 1PJ4A 1BW9A 4O3FA 1TX4B 3SKYA 3U7IA 1PJ8A 5DOZA 3WL4A 4BGIA 3I1YA 3F2VA 3MCUA 5CX4A 1L7XA 3P5BA 4HD8A 4UHHA 4B84A 3ZIDA 3WICA 5HF8A 2E55A 3Q5GA 3LI2A 2GAJA 3NR2A 4J7AA 2A9OA 1NYQA 5U1PA 1U2DC 1N2HA 2GN1A 4MR8A 4UMDA 5J1TB 1RJ9B 3RVBA 5ADWA 3GEHA 4GPTA 1XN4A 5JASA 3HC7A 5E7MA 1A82A 2A35A 3AF1A 3QEAZ 4O8ZA 3QWAA 3AVQA 4B74A 2NO1A 1YQTA 1YOVB 1B0PA 2IU4A 4ZI7B 3L1VA 2CNBA 1M1YB 2FZLA 3C6XA 3FPFA 4FDAA 4JLNA 4QBHA 1LUAA 4QDKA 2X76A 5A1JA 1IK6A 3NRBA 3BL8A 3P0HA 3LM8A 3NTVA 5TS2A 4B40A 1AHIA 4C04A 5B4TA 1PJCA 2O3SA 1V9LA 3NUZA 1H65A 2C9YA 4QDJA 1P2SA 3B78A 4KFTA 4XGNA 4JI0B 3GIDA 3NP7A 4JUDX 4CCYB 4BB6A 3SAJA 3RIEA 4LZZA 1QTIA 2C4WA 4IJVA 4G5HA 2WQ7A 4MINA 3J7TA 1LPPA 4OBXA 1YA4A 3MUNA 3R0QA 4BAGA 3VVLA 2RBEA 3PDHA 1E2BA 5FPYA 3EGDB 2C97A 3GR6A 2R3SA 1FVXA 4OHZA 3C8UA 3NUGA 4FSHA 2O20A 5B12A 4DCVA 1IZ8A 1RAGA 4I99A 4MA4A 4LJ9A 1BHQ1 1RXCA 3DMTC 3S1AB 4MQ4A 1DKMA 2GRJA 1A9SA 1JN0A 4Y1EA 1G4AE 2BFBA 3AINA 3FR7A 3IILA 2F9MA 2J3QA 2XCLA 4DY4A 3DOIA 5KQMA 1ID8A 1TI7A 2BL4A 1P9LA 1XYGA 3TNFA 4BE7B 1GPLA 1G8JA 5BP7A 3BB4A 3BFJA 1KMQA 1CP2A 2H17A 4CFSA 3FPJA 1LPBB 1N8NA 1ZIOA 2QUHA 5CPFA 1QNLA 4XQEA 5E1MA 5F12A 3WKEA 4DVJA 1ZR2A 2ZUWA 4Q3OA 3MWEA 5K0SA 1ENPA 4DR4B 5IULC 1CF2O 2QZZA 1E3MA 4D99A 5EI5A 3GLIA 2C2BA 2VHQA 4UREA 2C07A 3OY2A 4L4YA 3REOA 2IZ7A 1L8LA 1VSVA 3G0CA 4B8YA 4BFLA 2CLEB 2CGEA 3VBCA 5T8KC 1AOXA 1D6NA 2ZULA 3RS8A 3H17A 4LZWA 2VVTA 1KNXA 1E7QA 1QBKC 1QNFA 2YWRA 4IV8A 4K6GA 4O2BF 5EINA 4E94A 2VH1A 2ACKA 4AXXA 2GDJA 1LPAB 4PG6A 5HW0A 5ES3A 1M8GA 2J87A 4J8PA 4RYLA 5L4SA 2IPOA 2ZETA 4EG3A 5CFNA 3ABZA 1Q0SA 4CM6A 1TCUA 2OV6A 1IATA 3MEQA 1L6RA 3ETCA 3D6FA 1DWOA 1EFRA 2C7VA 4PO9A 2XUZA 1KQNA 2O3JA 2FXIA 3HM2A 1PAUA 4YJ3A 4RA9B 3AMVA 3NPAA 5ALIA 4FFSA 4MCJA 2EJTA 1XVAA 5J4HA 4NG4A 3GJ5A 3MD9A 4M0PA 1O08A 2AR0A 4UM9B 5DM70 1UODA 1YKGA 2IP2A 4LRQA 1LBHA 3OQVA 4ODIA 3S7TA 5BPFA 4KR3A 1KMHB 2G08A 4FOPA 5C81A 3WRYA 2OEPA 5CXQA 3EE6A 2NZJA 2QE6A 1AUVA 2Q49A 4R69A 4RTLA 1XDBA 4L08A 4FYMA 1A9XA 4RVOA 1AURA 5BSMA 3SF8B 4K40A 2ONJA 1Z68A 2Z04A 4GLLA 4ZFNA 3ZDCA 4WOJA 1QPGA 2WM3A 2ID4A 1UKEA 2VA8A 3CF4A 2PRJA 4P4TA 4QXMA 1XNJA 3TTYA 2A2ZA 4QU5A 5JDCA 4NESA 5LDHA 1LQTA 4P32A 1KBZA 1DDGA 3DNMA 3P4YA 3WTBA 4BE4A 3AKYA 5CG2A 4PLGA 4Q1DA 3UM9A 1CB0A 2P79A 5CJPA 4V02A 1T9KA 1PTKA 2XMZA 3U09A 4BXOA 1RWXA 4LN1A 4W7HA 3C3CA 5K4HA 1JHPA 3ZGNA 5IYZB 1SCKA 1B8UA 1C0EA 1QQ7A 1R9GA 3MHTA 2ZQZA 2Q2WA 3AF2A 4FX5A 5CBKA 1GEEA 3EODA 1KQ3A 4QFDA 5KTNA 1NMYA 3DFMA 3I5MA 4OQMA 2WYUA 1WU7A 2FSHA 2WM9B 3RC1A 5JEEA 4BU0A 2L17A 3MQFA 4LDPA 1Y9DA 4PPFA 3SEFA 3KR0A 3ZD6A 3IDOA 3ZV3A 2ZCVA 2LDBA 2HB6A 1SXJE 4PX5A 4AMVA 3IULA 2WD7B 5TQ2B 4G0VA 2BMDA 2IKSA 5HMLA 1MVOA 3WBJA 2HHCA 4LE1A 2QGNA 1DO0A 1JR3A 3K05A 5HF9A 4CF7A 3MWDA 4KV7A 1JMKC 2HMVA 5D51S 1XTRA 4C6HA 1H05A 4YRIA 1ADBA 4MYTA 2C59A 4AK9A 4JJFA 3R8XA 1T8RA 3IVXA 2R5FA 3FVTA 2WLSA 4HAZA 2X58A 2A0YA 3B6EA 2J5XA 1RM3A 1Q1EA 2GUGA 3IR5A 3Q4GA 4FFBB 1I5RA 2VHEA 4PZCA 4YVFA 3W6UA 5JJ5A 1A9PA 4WKBA 4HAIA 3U49A 4J2TA 4WXHA 1EVLA 1AS3A 1QP8A 1S8FA 3FCCA 3JATB 4HB3A 3LC0A 3CA8A 3VPCA 1E64A 1NIJA 2Y92A 4ZGWA 3MJDA 1A27A 1P1KA 4CEIA 4F72A 1RWWA 3K1JA 3KTOA 5BWLA 1OV4A 1M0WA 1BJRE 2QWXA 4KLZA 4LHEA 3T1QA 4C4YA 1A1SA 2H1WA 4UOZA 2O48X 3Q41A 1ZONA 3M1IA 5JS6A 2PVPA 3RSCA 3WGKA 4FQ8A 2BAGA 1YQGA 2SHKA 4IDBA 4IOLA 2VSOA 3Q5DA 5EIAA 2XVXA 1PV4A 1YQXA 1MJGM 2BT4A 1TVKB 2RJNA 2JEZA 2JGDA 4GOMD 3ZDRA 4WCVA 4AF6A 4BYMA 4CIVA 3ME5A 3MS2A 2IJGX 4FJ0A 3HNPA 4DJTA 5JW6A 3M7IA 3BSFA 2P9JA 2AYYA 4JP8A 4WNYA 3JQ7A 2KE5A 4RORA 2G71A 1RFGE 5CW1A 3RODA 3EXHA 5DX1A 5IKXA 4QYIA 5K3BA 1IY1A 1EX7A 1PN3A 1NJFA 7GPBA 3GH3A 1FU4A 3B12A 3LP5A 2IXFA 4OB8A 3EMKA 1CNMA 2HCFA 1SOMA 2OGSA 3W2HA 5A3JA 2L19A 3H8JA 4MV8A 3EQ7A 1Y42X 4RFVA 3TZEA 4JD5A 3T9EA 4M4SA 3GN1A 3TVTA 4JS0A 1B8OA 1QFYA 2A0WA 4RD1A 1DHTA 1XXHA 1YKSA 5JECA 2G5GX 4CI0B 1NOIA 1D03A 1XKQA 2HD4A 3GFQA 2X9LA 4KIGA 1YWGO 1MABA 3X2FA 4JOQA 5AM0A 2JZCA 3HTXA 1EU1A 4A5SA 4EA8A 2P9YA 1I14A 2OECA 2ZIGA 2DQZA 5CXXA 3LTNC 2C57A 4LNHA 2BMVA 2QT0A 5SY6A 3W3ZB 1YMUA 2VRCD 4TWZA 5BWBA 2ZBRA 4ZOLA 1Z2NX 1GVHA 2WIFA 3GLQA 1L7RA 3KFVA 5L7YA 3UMRA 4LJ5A 4Q7QA 5AVUA 3U6BA 2ZUFA 1NXOA 4BFWA 4UKDA 4CKBA 3DVQX 1ECFA 4RCVA 3V7WA 5C2JB 1XVIA 2YZMA 2WNHA 1XNQB 3H6KA 5AUQA 5FA8A 2KMLA 3H2IA 2YMQA 1U9CA 2FYTA 3RUIA 3CVUA 5J4KA 2XWPA 4E7PA 3N7UA 1D8AA 1D2EA 2WWGA 4HDSA 5JAOA 2C2ZA 4QPNA 4BFSA 2QUZA 4GE0A 4KDEA 2ZSUA 3U3XA 1JKFA 1W9HA 2OCPA 2OGUA 3HFRA 4A0RA 2YJNA 4I5IA 3NJRA 1QIDA 3A4YA 5HM8A 2JLAA 4FEGA 3FF1A 3VR3D 1H0SA 1Z5OA 4BB5A 3LG2A 4PHTA 1IMJA 1B0AA 3CR7A 4WKCA 1O96B 4YJ2F 5LQCA 5ULLA 1N6HA 1HYBA 3HDVA 3U17A 5JNRA 5KNBD 5FLEX 2NPFA 1RQPA 1TMYA 2O57A 2XIQA 4TMYA 2RHDA 4OY3A 5ALXA 4C0BA 2EZ4A 1BD4A 2GT1A 2HMYB 3KWFA 2POCA 3NBKA 5D3KA 4JBLA 4HMOA 3RC8A 1EG2A 3QQ5A 5CXSA 5GMOA 4MIKA 4DCGA 3CG0A 3F98A 3OVMA 3QVSA 5I7UA 1G9TA 3HY4A 3ZEAA 1T1RA 2I55A 1U9IC 3GFGA 2JFBA 3R20A 4GI7A 4LYJA 5AM1A 1T10A 5KMGA 3GLGE 4CPDA 1PJRA 3LZ6A 4Z4CA 3AF3A 4AZWA 3OCWA 1I33A 4A26A 3RK1A 4B3JA 2N46A 3B89A 4Z4IA 3AR9A 3EVBA 1GFWA 4ARAA 2B7LA 3OF2A 4AS3A 1QP4A 3VMMA 4EG4A 1X9GA 1RW4A 5EWJB 4BO2A 3NHYA 4KZPA 2GM3A 1PZXA 2BKVA 2PANA 4JFRA 5JLAA 3ROQA 3IO3A 3IJPA 3STYA 4F85A 1M34B 3FFBA 3GRZA 2FN3A 3M6AA 4Y6LA 5CG1A 1MRSA 1Z56C 3JAWA 1U0SY 1WMEA 2AFIB 3FFTA 2V4UA 3OQPA 2X0KA 2YV3A 3GYBA 1J0AA 4IDHA 4N3BA 2O0JA 4W99A 1VP3A 5CLGA 4YUVA 4H17A 1K6XA 3D2LA 1DAKA 1M1ZA 2KM1A 4N0QA 3R6WA 1T9AA 1H42A 5GQSA 4MYCA 3V2IA 1GGHA 4JLVA 5FBRB 1I4LD 1UBHS 3TNDA 1MW8X 3OEHD 3OF5A 1XEXA 3A11A 2EGGA 7YASA 5LWHA 1G2IA 1LRKA 1TDJA 3ZV4A 1KMIY 4D0RA 3JAKB 2O8FA 1F06A 3C6MA 1JFLA 3R3YA 4KK3A 5FOXA 3L4KA 2G1KA 2HC9A 1GARA 3D8UA 1L8OA 1QHNA 5J63A 4E08A 3BL5A 2E7ZA 1HG0A 1AZSC 1SPBS 1KY2A 3V48A 2CL0X 3BKXA 2R86A 3SKXA 5KTTA 4H4EA 4LDZA 5D5HA 3OESA 1JKXA 4GI5A 1EBFA 2GTPA 3F1LA 4Q9IA 1KVRA 1ZINA 1CZRA 3A9SA 5IASA 2PT5A 1HT2E 3PEFA 4O4JF 3ZJ4A 3EDCA 2YHIA 3FVRA 3MINB 3H5VA 4G5FA 2VPTA 3OICA 3V7FA 2IQIA 3PHIA 4Q05A 1B42A 3DFUA 4ONEA 3BAZA 4Y9DA 5T6BA 5K99A 4ESVA 4UPEA 4A2CA 2IEAA 4BNYA 4D26A 3ZDYB 3W8DA 2HSJA 1OBHA 2H63A 5ECGC 4JNKA 3SBDA 5HK9A 3PX2A 1X7GA 1YKFA 2QW0X 1QIEA 5DNCA 3G2QA 2QI9C 3WL3A 1WB4A 4TSKA 2J85A 4IIXA 1TMGE 1LNZA 3TRJA 1TU3A 3L6UA 3MFQA 4HDCA 3ZGOA 1OGJA 3MJ4A 2ZSAA 3IBCA 3WK5A 5HYVA 3ZZUA 1RRCA 4II3A 3DAYA 4JUBA 2PU5A 1ZCZA 5DXAA 2QLBA 1Y9AA 3CBGA 5CK5A 1R9MA 4IIUA 1JU4A 2JAXA 3SG0A 5L3VA 2VSQA 3CISA 2R4UA 4JCCA 2DH5A 4LDQA 4P80A 4XLTA 1X94A 3IJRA 2QW1A 2HNKA 3I92A 4UNQA 3A6DA 1STOA 4F6LA 2NXEA 1R8SA 1YCGA 2XDAA 3NFYA 721PA 4QYWA 3C3JA 2Q3MA 4IIJB 1V8FA 1E2MA 2CFCA 2GZ1A 3OOWA 4YJHA 1AY0A 3VYWA 1W35A 3AWIA 3DJFA 3N6RA 3OJEA 1GIAA 4Q4AA 4MGHA 3OAAD 4DLYA 3R3UA 1J8VA 1TW2A 1J5XA 2O8VA 2ZQYA 3AR8A 1NF9A 1JPUA 1SHLA 3ICVA 3P2OA 3HVIA 4GO1A 1DTSA 2VRBA 1WAMA 1YC2A 4EEXA 3RGWS 1JT9A 3HWSA 3PSHA 4O4IF 4PTYA 2C7RA 1Z15A 2FLVA 1KYZA 1DC8A 1W9MA 4EUNA 1CUHA 2DTXA 1BH6A 3QXSA 4EAQA 1PHRA 1IEWA 3F7MA 5CJ2A 1QK5A 5BT8A 4ARZB 1J00A 3RTAA 4WVFA 2P7IA 3W8RA 4B45A 4ENQA 4IIJF 4NQZA 3JZMA 4O1IA 2A9VA 3ORQA 5E0KB 3RWOA 4ZIRB 3ICOA 3FOAA 4GMXA 2TMYA 3AF6A 4GDFA 1TUIA 1JV2B 3IUPA 3GUCA 2O6HA 1J5EB 4BLVA 3ASUA 3GZNB 2HK6A 2JJ2A 3NBYC 4PR3A 2NQ2C 3SR4A 4F2GA 4GLBA 1T43A 2WFMA 3PR2B 1YF3A 3KDAA 2WSBA 2LTAA 1UZLA 3P4XA 1IUNA 2HCBA 4GRDA 5TQ0A 1OF1A 2ERXA 3UJPA 3ZH9B 2XKAA 3IP3A 5JMPA 4Q9AA 3LDUA 1B6GA 3AFNA 3ZHZA 1TYCA 2MYNA 1WS6A 4UOQA 1REQA 1FP4B 2IRWA 4D9MA 4EI9A 3NHUA 1PT7A 4CIYA 2DXIA 1PG5A 2FGKA 1LBQA 2AT1A 2LIPA 3H2SA 4LY3A 3QYJA 4N6NA 5BW6B 3W5AA 5DLPA 4ECAA 4EK9A 3G9QA 5JPCA 3BULA 2VHCA 2DWQA 2Y1CA 2ZB3A 2Q5OA 1B6SA 2ZJ7A 3K73O 4G2NA 4NYMR 3LPAA 3VI4B 5EIXA 1U5AA 2DBQA 3WB1A 3O82A 2BSQA 3F8WA 2AG0A 2LUOA 4KKVA 5B58C 3JWPA 3WGGA 2GERA 4TT8A 2QPTA 5B3KA 4BEVA 4MIEA 3LT0A 5CEEA 4KE6A 5LBTA 1W73A 3WLKX 1ATZA 1IB0A 4RIHA 2V5VA 4RTOA 4JBGA 3AZPA 3Q6IA 4QPCA 2ZI7A 3AVXA 2QY6A 1XZJA 4JP3A 4JI2B 1Z45A 3SQLA 2RJOA 2FQWA 4KBFA 2W6ID 3C3AA 3QJ5A 2XCOA 3N6VA 3UYKA 4P84A 4WI1A 1LLQA 1X3LA 3AIOA 3JYLA 3MFYA 3W5UA 1R0XA 3JQAB 4D81A 1ZISA 1A8PA 3AUAA 2VHWA 2PNFA 3FTNA 1B0ZA 4BVEA 1CNEA 1D09A 1LLDA 3CZRA 1VI2A 4R1UA 4P54A 1WSAA 4IDFA 3V4OA 8MHTA 2F8TA 1WUYA 1T29A 1Y5IA 3TCNA 3FA2A 3VR6A 4ZPJA 3ULKA 1K8XB 4PINA 4O4LF 1BXGA 2I6XA 2IITA 2YV5A 4C7OA 1EK2A 3M9XA 1DAEA 5LLDA 2OBBA 2F6RA 4PC2A 4EATA 4RVUA 1GUDA 2ONYA 2ZU6A 1Q7GA 4RH1A 1TXGA 1YONA 2ZSFA 2BR4A 2ZJFA 1F4LA 1HTBA 1NUAA 1ZH8A 4DC9A 3NC1C 1TEHA 1GSHA 1EXNA 3WR5A 4LCJA 5EJ8A 5JISA 2BFWA 2FW1A 1RHUA 1W85A 3D43A 1P8AA 1V6SA 1T8TA 1U0TA 2Q6IA 3KB6A 2H7CA 3L92A 3Q9LA 2WSSD 4HT3B 1KRHA 3TOSA 5A4IS 2B83A 3HM9A 3EIHA 3PDIB 5F1OA 3S28A 4EY5A 3EXEB 2Y0DA 5KNCH 1XAGA 3WNVA 4BFCA 4HVAA 3K96A 1Z36A 4Q7KA 2OXIA 3DNPA 1UP4A 4MYUA 3W0LB 3ONNA 3NXSA 1DQNA 4IJQA 4DMLA 3ZPXA 4EW6A 3UJ9A 4AYWA 1NLMA 4AB1A 1T9ZA 4M1MA 3V97A 3K6KA 4B3CA 1ZITA 1II0A 1R4MA 1WPGA 3AY3A 2WG2A 4NYMQ 5IK2A 5JCJD 1Z5WA 4RD6A 3D8TA 4LHVA 3KT3A 2H1SA 4R8KA 3TDKA 3E82A 3LHFA 5KYUA 1IE3A 2FH5B 2JAWA 1U7DA 2NAPA 3HDTA 1PS0A 3C0KA 2L18A 3C85A 1QWSA 2FEAA 3UG7A 2UZ4A 3L8GA 3OP1A 4BNXA 4PSVA 5KSPA 3FLBA 1GPMA 3WIOA 2FVXA 2YWEA 2XQGA 1RU3A 2WVAA 2VZ8A 3LVRE 4H9GA 4ZQBA 5A04A 4AICA 1TD9A 3QMWA 1BROA 4FP9A 1UDRA 4RE5A 1SK9A 4P86A 5DBFA 4AKGA 1Z4OA 2D74A 3NETA 1U3VA 3HS3A 2IYZA 1ZM2A 2OO5A 2AFVA 1FUYB 3UB4A 1Z8HA 2WHPB 3B2NA 3U5ZB 3VHRA 2YQ4A 3CB4A 3OZIA 2AI2A 4AUEA 4D0SA 2VBIA 2YHBA 4QSHA 4BVAA 2V7XA 4OA8A 1GKYA 1YIAA 4EUFA 2EFHB 4C1BA 4H15A 1NQAO 2XECA 3FPBA 5TVGA 5F9FA 4EKDA 3C6QA 3ZU2A 1XRLA 1FQWA 1FDRA 2PSFA 4R8LA 4ABYA 5CX1B 4NRDA 2GKOA 1PX0A 1ORHA 1ZBQA 2PXAA 2C1XA 2NV6A 3V1YA 5EJMA 2JFVA 4JQSA 1F8XA 3PHLA 1IRXA 2BTQB 3FETA 3NI2A 2ESRA 1QR6A 3BMNB 4M38A 1WDWB 2CWWA 621PA 5AMXA 4BKRA 1GZ7A 1BD3A 3RHFA 4P0PB 2C7GA 4JB0A 4Q12A 1L5NA 3T06B 3WAKA 4ME6A 1G8PA 3I4LA 4L7VA 4E2YA 1XR3A 1QVRA 4FXOA 2ADMA 2Z9CA 4RSRA 1R6UA 4U3JB 2D1QA 4B3TB 2DQYA 1VG9B 4QOEA 2BRUA 1L3IA 4J29A 1MW9X 4MDYA 5DF1A 3TN7A 2IVZA 1I4EB 3QLUC 1TJPB 4IZIA 2IYEA 4JSYA 4LWZA 4YJGA 2A30A 4NMWA 1E1RA 4A27A 4HN2A 1X0VA 1QOPB 5C5DA 4XB2A 1XPRA 2XNDA 5LXTA 1W36D 2QGZA 4J0FA 5KYYA 5A0TA 1OY1A 1V7PC 1N8KA 2ONCA 2P9ZA 2VSXA 3S6JA 3DDCA 4TRJA 3TW4A 3U1VA 1U8FO 2JIQA 1X14A 2NSHA 3JQPA 3SDZA 3WKDA 1BQ4A 2BGWA 3JQFC 3IQEA 1W5SA 1VJ0A 4MJLA 4C3UA 3F73A 5TGZA 1SNYA 2C2XA 2ZJAA 4JSTA 1OX4A 5JDIC 4AN4A 2OYRA 3ILSA 3VGPA 3JZAA 4M0DA 2QROA 2PJDA 3RANA 2WVHA 1KI6A 1O9GA 1G6KA 5KVAA 1T8YA 4EPXA 2QLMA 1B8VA 5EGNA 1XZLA 1JU9A 2RAPA 1T8SA 4JWTA 2A1UA 1KYIA 5IZCA 3PQEA 1GLNA 3VH4A 4AY6A 1U1DA 2RONA 2HGZA 2V65A 1J8MF 3T54A 1RBMA 3JD3A 4V0MA 7REQB 3HVRA 1G8MA 1F51E 5DI9A 4DLNA 3KELA 2K87A 3N5CA 4X97A 1PYGA 3KQHA 4D79A 5EIFA 3Q6NA 2I99A 3T12A 2E5WA 4DTCA 1YC5A 1XZEA 1E61A 1Z7YA 1OVGA 2VQSA 2PZFA 1KH1A 3EAGA 4OP3A 4Z3KA 5L3QA 3RU2A 5JJIA 1LBEA 1RXUA 2VTKA 3HDHA 4EY6A 5FADA 5GADl 1MTOA 4YQZA 3WGHA 4ZU3A 4L8VA 2FU5C 4B35A 2LE0A 1NBOA 1WY5A 1NJ1A 2V8BA 1R3DA 3QYAA 4BNMA 1I1OA 4UD2A 3RKSA 1J42A 4Q3BA 4CNQA 1X86B 1PO7A 1BE1A 1X70A 4HBZA 4YAWA 3TZQA 4DIFA 1I8TA 1XA3A 4R40A 5A6VA 4HWSA 1QB8A 3TMAA 3IUJA 2JGKA 1FLAA 5G02A 2C8JA 4P8RA 1E92A 2H4HA 2ADOA 1GGJA 3NWPA 2Q3CA 2SBTA 4RIEA 3NT4A 5DO9A 2R00A 2YV2A 4UFNA 3CCBA 3PFWO 1XLTA 5I51A 1MAVA 1VKJA 3L8DA 6REQA 2P2DA 3T7DA 2IBTA 5LUAA 3OSZA 2QYSA 1W8IA 1CHDA 1ZP6A 4JYPA 5CDFA 1ZNWA 4QGSA 1RBZA 4ILEA 3IB6A 3VJMA 2VH2A 1E1QA 2GMWA 3CZMA 3OKCA 4I4TA 1AKEA 2ISCA 3W5CA 2JARA 2VCEA 1NKTA 4LC1A 3IBSA 5AK4A 1QG0A 1UPAA 2AG1A 2GPNA 4ENTA 1IN4A 5JQGB 3EGOA 3UQYS 4E4TA 4E5VA 3F74A 4RQBA 4UFOA 5B7GA 3R2JA 4O2AA 3COWA 5H82A 1LK5A 4FFOA 3MGAA 1TOAA 3G9XA 4EKNB 3B7WA 1KDPA 3QKSA 4H59A 3KYDB 4UMFA 2C2WA 3I62A 1CULC 4QG3A 4RSHA 4B2YA 4C0WA 1CUXA 4YXWD 1K7YA 2IW3A 3SC6A 3ROZA 3Q72A 1A8HA 4LX8A 4OXIA 2UU9B 3EIXA 2XA1A 4DDMA 1TM7E 3TGWA 4Z7JA 3LLMA 2FF7A 3LGAA 4I81A 4YJ3F 5BV8A 1ZJZA 1P4SA 3A1TA 4EJFA 4XX0A 1XDGA 3AF0A 1ECBA 4D0NA 1ZG3A 4XM0A 1XQ9A 4ZZIA 1BKDR 2GWHA 1MQAA 3H4MA 2O5CA 4FI3F 4Z4FA 2ERYA 2GO7A 3QVJA 2EP8A 3OWHA 1K6JA 3CTPA 3ZQ4A 1ZSNA 2ZQ5A 1M74A 1HI9A 1YUBA 2C0QA 1YR2A 4IRXA 4XI9A 1YSCA 1JL3A 1FLVA 1RAEA 3DKVA 3PHCA 5I7EA 1QDEA 4DV6B 1N6LA 3GW8A 1H6BA 1M2EA 1V8PA 4YCLA 1XL1A 2FK8A 2X8WA 1RCFA 2E21A 3OT5A 3UAZA 2Y05A 2W4MA 2JZNA 3CRMA 2XDQA 3CNNA 3KKNA 4MS4B 4E5SA 3LWBA 3OFSA 2PWZA 3ZBQA 1CU1A 1QHEA 3BMQB 3GP3A 3HCRA 2TSYB 3VFDA 4BWVA 1N9KA