2F06A

Crystal structure of protein bt0572 from bacteroides thetaiotaomicron
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
144
structure length
144
Chain Sequence
SNAMVAKQLSIFLENKSGRLTEVTEVLAKENINLSALCIAENADFGILRGIVSDPDKAYKALKDNHFAVNITDVVGISCPNVPGALAKVLGFLSAEGVFIEYMYSFANNNVANVVIRPSNMDKCIEVLKEKKVDLLAASDLYKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal structure of protein BT0572 from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 37
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 2f06A00
2HMFA 1ZHVA 3C20A 3TVIA 3AAWA 3AB4A 3C1NA 2F06A 3C1MA 1ZVPA 3AB2A
chains in the Genus database with same CATH superfamily
3LDUA 3C1MA 3LDGA 4KR9A 2HMFA 4KR7A 3AAWA 3AB4A 3C1NA 2F06A 4KR6A 1ZHVA 3C20A 3TMAA 3TM4A 3V8VA 2C5SA 3V97A 3TM5A 3K0BA 3TLJA 3TVIA 1ZVPA 3AB2A
chains in the Genus database with same CATH topology
3LDUA 3C1MA 3LDGA 4KR9A 2HMFA 4KR7A 3AAWA 3AB4A 3C1NA 2F06A 4KR6A 1ZHVA 3C20A 3TMAA 3TM4A 3V8VA 2C5SA 3V97A 3TM5A 3K0BA 3TLJA 3TVIA 1ZVPA 3AB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMF A;  1ZHV A;  3C20 A;  3TVI A;  3AAW A;  3AB4 A;  3C1N A;  2F06 A;  3C1M A;  1ZVP A;  3AB2 A; 
#chains in the Genus database with same CATH topology
 3LDU A;  3C1M A;  3LDG A;  4KR9 A;  2HMF A;  4KR7 A;  3AAW A;  3AB4 A;  3C1N A;  2F06 A;  4KR6 A;  1ZHV A;  3C20 A;  3TMA A;  3TM4 A;  3V8V A;  2C5S A;  3V97 A;  3TM5 A;  3K0B A;  3TLJ A;  3TVI A;  1ZVP A;  3AB2 A; 
#chains in the Genus database with same CATH homology
 3LDU A;  3C1M A;  3LDG A;  4KR9 A;  2HMF A;  4KR7 A;  3AAW A;  3AB4 A;  3C1N A;  2F06 A;  4KR6 A;  1ZHV A;  3C20 A;  3TMA A;  3TM4 A;  3V8V A;  2C5S A;  3V97 A;  3TM5 A;  3K0B A;  3TLJ A;  3TVI A;  1ZVP A;  3AB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...