3C20A

Crystal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with l-aspartate
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
469
structure length
465
Chain Sequence
b'TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable aspartokinase
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 154
structure length 465
sequence length 469
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c20A02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c20A01
3TVIA 2BMUA 2BTYA 3QUOA 1YBDA 2RD5A 4KZTA 3QVHA 2V4YA 3D2PA 4NDPA 1OHAA 4F6TB 3KZFA 4A7XA 2HMFA 2J4KA 3S6GA 3S6KA 2A1FA 3AB2A 2JJ4A 2BRIA 4AB7A 2R8VA 3C1NA 3D40A 3ZZGA 3LKKA 4I49A 3B8GA 4NDQA 1Z9DA 2WE4A 1OH9A 2WE5A 3C1MA 4A7WA 3K4OA 3S6HA 4NDPB 3QURA 2CDQA 4Q1TA 2J4JA 4JZ8A 2J5TA 1GSJA 2IJ9A 4NDRA 2F06A 3QUNA 2BNEA 2OGXA 3AB4A 2J0WA 3ZZFA 2JI5A 4NDQB 3ZZHA 4USJA 2X2WA 3EK6A 2V5HA 2JJXA 1E19A 4OLCA 3K56A 4NDOA 3T7BA 3C20A 2OGXB 2J4LA 2WXBA 4JZ7A 2VA1A 2R98A 3EK5A 2BNDA 3AAWA 1B7BA 1GS5A 3D2MA 2W21A 3WWNA 2J5VA 2AKOA 4AXSA 2E9YA 3K4YA 2BUFA 1ZVPA 3ZZIA 3L86A 3L76A 3LL9A 2J0XA 2BRXA 3LL5A 2AP9A 3U6UA 4F6TA 3K52A 3WWMA 3QVFA 4NDOB 1ZHVA 3D41A 3NWYA 2BNFA 4NDRB 1OHBA 4JZ9A
chains in the Genus database with same CATH superfamily
3TVIA 2BMUA 2BTYA 3LDUA 3QUOA 4KR9A 1YBDA 2RD5A 4KZTA 3QVHA 2V4YA 3D2PA 4KR7A 4NDPA 1OHAA 4F6TB 3KZFA 4A7XA 2HMFA 2J4KA 3S6GA 3S6KA 2A1FA 3AB2A 2JJ4A 2BRIA 4AB7A 2R8VA 3C1NA 3D40A 3ZZGA 3LKKA 4I49A 3B8GA 4NDQA 1Z9DA 2WE4A 1OH9A 2WE5A 3C1MA 4A7WA 3K4OA 3S6HA 3TM5A 4NDPB 3QURA 2CDQA 4Q1TA 2J4JA 4JZ8A 2J5TA 1GSJA 2IJ9A 4NDRA 2F06A 3QUNA 2BNEA 2OGXA 3AB4A 2J0WA 3V97A 3ZZFA 2JI5A 4NDQB 3ZZHA 4USJA 3LDGA 2X2WA 3EK6A 2V5HA 2JJXA 1E19A 3K0BA 4OLCA 3TMAA 3K56A 4NDOA 3T7BA 3V8VA 3C20A 2OGXB 2J4LA 3TLJA 2C5SA 2WXBA 4JZ7A 2VA1A 2R98A 3EK5A 2BNDA 3AAWA 1B7BA 1GS5A 3D2MA 2W21A 3WWNA 2J5VA 2AKOA 4AXSA 2E9YA 3K4YA 2BUFA 1ZVPA 3ZZIA 3L86A 3L76A 3LL9A 2J0XA 2BRXA 3TM4A 3LL5A 2AP9A 3U6UA 4F6TA 3K52A 3WWMA 3QVFA 4NDOB 1ZHVA 3D41A 4KR6A 3NWYA 2BNFA 4NDRB 1OHBA 4JZ9A
chains in the Genus database with same CATH topology
3TVIA 2BMUA 2BTYA 3LDUA 3QUOA 4KR9A 1YBDA 2RD5A 4KZTA 3QVHA 2V4YA 3D2PA 4KR7A 4NDPA 1OHAA 4F6TB 3KZFA 4A7XA 2HMFA 2J4KA 3S6GA 3S6KA 2A1FA 3AB2A 2JJ4A 2BRIA 4AB7A 2R8VA 3C1NA 3D40A 3ZZGA 3LKKA 4I49A 3B8GA 4NDQA 1Z9DA 2WE4A 1OH9A 2WE5A 3C1MA 4A7WA 3K4OA 3S6HA 3TM5A 4NDPB 3QURA 2CDQA 4Q1TA 2J4JA 4JZ8A 2J5TA 1GSJA 2IJ9A 4NDRA 2F06A 3QUNA 2BNEA 2OGXA 3AB4A 2J0WA 3V97A 3ZZFA 2JI5A 4NDQB 3ZZHA 4USJA 3LDGA 2X2WA 3EK6A 2V5HA 2JJXA 1E19A 3K0BA 4OLCA 3TMAA 3K56A 4NDOA 3T7BA 3V8VA 3C20A 2OGXB 2J4LA 3TLJA 2C5SA 2WXBA 4JZ7A 2VA1A 2R98A 3EK5A 2BNDA 3AAWA 1B7BA 1GS5A 3D2MA 2W21A 3WWNA 2J5VA 2AKOA 4AXSA 2E9YA 3K4YA 2BUFA 1ZVPA 3ZZIA 3L86A 3L76A 3LL9A 2J0XA 2BRXA 3TM4A 3LL5A 2AP9A 3U6UA 4F6TA 3K52A 3WWMA 3QVFA 4NDOB 1ZHVA 3D41A 4KR6A 3NWYA 2BNFA 4NDRB 1OHBA 4JZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVI A;  2BMU A;  2BTY A;  3QUO A;  1YBD A;  2RD5 A;  4KZT A;  3QVH A;  2V4Y A;  3D2P A;  4NDP A;  1OHA A;  4F6T B;  3KZF A;  4A7X A;  2HMF A;  2J4K A;  3S6G A;  3S6K A;  2A1F A;  3AB2 A;  2JJ4 A;  2BRI A;  4AB7 A;  2R8V A;  3C1N A;  3D40 A;  3ZZG A;  3LKK A;  4I49 A;  3B8G A;  4NDQ A;  1Z9D A;  2WE4 A;  1OH9 A;  2WE5 A;  3C1M A;  4A7W A;  3K4O A;  3S6H A;  4NDP B;  3QUR A;  2CDQ A;  4Q1T A;  2J4J A;  4JZ8 A;  2J5T A;  1GSJ A;  2IJ9 A;  4NDR A;  2F06 A;  3QUN A;  2BNE A;  2OGX A;  3AB4 A;  2J0W A;  3ZZF A;  2JI5 A;  4NDQ B;  3ZZH A;  4USJ A;  2X2W A;  3EK6 A;  2V5H A;  2JJX A;  1E19 A;  4OLC A;  3K56 A;  4NDO A;  3T7B A;  3C20 A;  2OGX B;  2J4L A;  2WXB A;  4JZ7 A;  2VA1 A;  2R98 A;  3EK5 A;  2BND A;  3AAW A;  1B7B A;  1GS5 A;  3D2M A;  2W21 A;  3WWN A;  2J5V A;  2AKO A;  4AXS A;  2E9Y A;  3K4Y A;  2BUF A;  1ZVP A;  3ZZI A;  3L86 A;  3L76 A;  3LL9 A;  2J0X A;  2BRX A;  3LL5 A;  2AP9 A;  3U6U A;  4F6T A;  3K52 A;  3WWM A;  3QVF A;  4NDO B;  1ZHV A;  3D41 A;  3NWY A;  2BNF A;  4NDR B;  1OHB A;  4JZ9 A; 
#chains in the Genus database with same CATH topology
 3TVI A;  2BMU A;  2BTY A;  3LDU A;  3QUO A;  4KR9 A;  1YBD A;  2RD5 A;  4KZT A;  3QVH A;  2V4Y A;  3D2P A;  4KR7 A;  4NDP A;  1OHA A;  4F6T B;  3KZF A;  4A7X A;  2HMF A;  2J4K A;  3S6G A;  3S6K A;  2A1F A;  3AB2 A;  2JJ4 A;  2BRI A;  4AB7 A;  2R8V A;  3C1N A;  3D40 A;  3ZZG A;  3LKK A;  4I49 A;  3B8G A;  4NDQ A;  1Z9D A;  2WE4 A;  1OH9 A;  2WE5 A;  3C1M A;  4A7W A;  3K4O A;  3S6H A;  3TM5 A;  4NDP B;  3QUR A;  2CDQ A;  4Q1T A;  2J4J A;  4JZ8 A;  2J5T A;  1GSJ A;  2IJ9 A;  4NDR A;  2F06 A;  3QUN A;  2BNE A;  2OGX A;  3AB4 A;  2J0W A;  3V97 A;  3ZZF A;  2JI5 A;  4NDQ B;  3ZZH A;  4USJ A;  3LDG A;  2X2W A;  3EK6 A;  2V5H A;  2JJX A;  1E19 A;  3K0B A;  4OLC A;  3TMA A;  3K56 A;  4NDO A;  3T7B A;  3V8V A;  3C20 A;  2OGX B;  2J4L A;  3TLJ A;  2C5S A;  2WXB A;  4JZ7 A;  2VA1 A;  2R98 A;  3EK5 A;  2BND A;  3AAW A;  1B7B A;  1GS5 A;  3D2M A;  2W21 A;  3WWN A;  2J5V A;  2AKO A;  4AXS A;  2E9Y A;  3K4Y A;  2BUF A;  1ZVP A;  3ZZI A;  3L86 A;  3L76 A;  3LL9 A;  2J0X A;  2BRX A;  3TM4 A;  3LL5 A;  2AP9 A;  3U6U A;  4F6T A;  3K52 A;  3WWM A;  3QVF A;  4NDO B;  1ZHV A;  3D41 A;  4KR6 A;  3NWY A;  2BNF A;  4NDR B;  1OHB A;  4JZ9 A; 
#chains in the Genus database with same CATH homology
 3TVI A;  2BMU A;  2BTY A;  3LDU A;  3QUO A;  4KR9 A;  1YBD A;  2RD5 A;  4KZT A;  3QVH A;  2V4Y A;  3D2P A;  4KR7 A;  4NDP A;  1OHA A;  4F6T B;  3KZF A;  4A7X A;  2HMF A;  2J4K A;  3S6G A;  3S6K A;  2A1F A;  3AB2 A;  2JJ4 A;  2BRI A;  4AB7 A;  2R8V A;  3C1N A;  3D40 A;  3ZZG A;  3LKK A;  4I49 A;  3B8G A;  4NDQ A;  1Z9D A;  2WE4 A;  1OH9 A;  2WE5 A;  3C1M A;  4A7W A;  3K4O A;  3S6H A;  3TM5 A;  4NDP B;  3QUR A;  2CDQ A;  4Q1T A;  2J4J A;  4JZ8 A;  2J5T A;  1GSJ A;  2IJ9 A;  4NDR A;  2F06 A;  3QUN A;  2BNE A;  2OGX A;  3AB4 A;  2J0W A;  3V97 A;  3ZZF A;  2JI5 A;  4NDQ B;  3ZZH A;  4USJ A;  3LDG A;  2X2W A;  3EK6 A;  2V5H A;  2JJX A;  1E19 A;  3K0B A;  4OLC A;  3TMA A;  3K56 A;  4NDO A;  3T7B A;  3V8V A;  3C20 A;  2OGX B;  2J4L A;  3TLJ A;  2C5S A;  2WXB A;  4JZ7 A;  2VA1 A;  2R98 A;  3EK5 A;  2BND A;  3AAW A;  1B7B A;  1GS5 A;  3D2M A;  2W21 A;  3WWN A;  2J5V A;  2AKO A;  4AXS A;  2E9Y A;  3K4Y A;  2BUF A;  1ZVP A;  3ZZI A;  3L86 A;  3L76 A;  3LL9 A;  2J0X A;  2BRX A;  3TM4 A;  3LL5 A;  2AP9 A;  3U6U A;  4F6T A;  3K52 A;  3WWM A;  3QVF A;  4NDO B;  1ZHV A;  3D41 A;  4KR6 A;  3NWY A;  2BNF A;  4NDR B;  1OHB A;  4JZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...