3C20A

Crystal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with l-aspartate
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
469
structure length
465
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Probable aspartokinase
total genus 154
structure length 465
sequence length 469
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c20A02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c20A01
4NDQB 2JI5A 1OH9A 1YBDA 4JZ7A 2HMFA 3ZZIA 4KZTA 1OHBA 1OHAA 1E19A 2VA1A 3LL9A 3QURA 2V4YA 2BRIA 4NDOA 3B8GA 3T7BA 3C20A 3QUNA 4NDOB 2F06A 4JZ8A 2RD5A 3LL5A 3U6UA 4I49A 4F6TB 1GS5A 2OGXB 3ZZHA 2J4JA 4F6TA 3L76A 2R8VA 2JJ4A 3D2MA 1ZVPA 2WE4A 2OGXA 2AKOA 3C1NA 2J0XA 2JJXA 1GSJA 2A1FA 3AB4A 2BNFA 3ZZGA 3WWNA 3D41A 2CDQA 3AAWA 2E9YA 4A7WA 4JZ9A 2V5HA 3C1MA 3TVIA 3K56A 2IJ9A 2J0WA 1ZHVA 3K4YA 3S6KA 3ZZFA 3L86A 2J4KA 2BTYA 2X2WA 3QUOA 3S6GA 2J5TA 4NDPB 3EK5A 4NDPA 3QVFA 4AB7A 2R98A 2BUFA 2AP9A 3D2PA 2BMUA 1B7BA 4AXSA 4Q1TA 3D40A 4A7XA 2WE5A 1Z9DA 3LKKA 3QVHA 2BNDA 4USJA 4OLCA 4NDRB 3NWYA 4NDQA 3K4OA 2W21A 3EK6A 3K52A 3AB2A 3KZFA 2BNEA 3WWMA 3S6HA 2J5VA 2BRXA 2J4LA 4NDRA 2WXBA
chains in the Genus database with same CATH superfamily
4NDQB 2JI5A 1OH9A 1YBDA 4JZ7A 2HMFA 3ZZIA 4KZTA 1OHBA 1OHAA 1E19A 2VA1A 3LL9A 3QURA 2V4YA 2BRIA 4NDOA 4KR6A 3B8GA 3T7BA 3C20A 3QUNA 4NDOB 2F06A 4JZ8A 2RD5A 3LL5A 3U6UA 4I49A 4F6TB 3TLJA 3TM5A 1GS5A 2OGXB 3ZZHA 2J4JA 4F6TA 3L76A 2R8VA 2JJ4A 3D2MA 1ZVPA 2WE4A 3V97A 3K0BA 2OGXA 2AKOA 2JJXA 3C1NA 2J0XA 1GSJA 2A1FA 3AB4A 2BNFA 3ZZGA 3WWNA 3D41A 2CDQA 3AAWA 2E9YA 4A7WA 3TMAA 4JZ9A 2V5HA 3C1MA 3TVIA 3K56A 2IJ9A 3LDUA 2J0WA 1ZHVA 2C5SA 3K4YA 3S6KA 3ZZFA 3L86A 2J4KA 4KR7A 2BTYA 2X2WA 3QUOA 3S6GA 2J5TA 4NDPB 3EK5A 3LDGA 4NDPA 3QVFA 4AB7A 2R98A 2BUFA 2AP9A 3D2PA 2BMUA 1B7BA 4AXSA 4Q1TA 4KR9A 3D40A 4A7XA 2WE5A 1Z9DA 3LKKA 3QVHA 2BNDA 4USJA 4OLCA 4NDRB 3NWYA 3V8VA 4NDQA 3K4OA 2W21A 3EK6A 3TM4A 3K52A 3AB2A 3KZFA 2BNEA 3WWMA 3S6HA 2J5VA 2BRXA 2J4LA 4NDRA 2WXBA
chains in the Genus database with same CATH topology
4NDQB 2JI5A 1OH9A 1YBDA 4JZ7A 2HMFA 3ZZIA 4KZTA 1OHBA 1OHAA 1E19A 2VA1A 3LL9A 3QURA 2V4YA 2BRIA 4NDOA 4KR6A 3B8GA 3T7BA 3C20A 3QUNA 4NDOB 2F06A 4JZ8A 2RD5A 3LL5A 3U6UA 4I49A 4F6TB 3TLJA 3TM5A 1GS5A 2OGXB 3ZZHA 2J4JA 4F6TA 3L76A 2R8VA 2JJ4A 3D2MA 1ZVPA 2WE4A 3V97A 3K0BA 2OGXA 2AKOA 2JJXA 3C1NA 2J0XA 1GSJA 2A1FA 3AB4A 2BNFA 3ZZGA 3WWNA 3D41A 2CDQA 3AAWA 2E9YA 4A7WA 3TMAA 4JZ9A 2V5HA 3C1MA 3TVIA 3K56A 2IJ9A 3LDUA 2J0WA 1ZHVA 2C5SA 3K4YA 3S6KA 3ZZFA 3L86A 2J4KA 4KR7A 2BTYA 2X2WA 3QUOA 3S6GA 2J5TA 4NDPB 3EK5A 3LDGA 4NDPA 3QVFA 4AB7A 2R98A 2BUFA 2AP9A 3D2PA 2BMUA 1B7BA 4AXSA 4Q1TA 4KR9A 3D40A 4A7XA 2WE5A 1Z9DA 3LKKA 3QVHA 2BNDA 4USJA 4OLCA 4NDRB 3NWYA 3V8VA 4NDQA 3K4OA 2W21A 3EK6A 3TM4A 3K52A 3AB2A 3KZFA 2BNEA 3WWMA 3S6HA 2J5VA 2BRXA 2J4LA 4NDRA 2WXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDQ B;  2JI5 A;  1OH9 A;  1YBD A;  4JZ7 A;  2HMF A;  3ZZI A;  4KZT A;  1OHB A;  1OHA A;  1E19 A;  2VA1 A;  3LL9 A;  3QUR A;  2V4Y A;  2BRI A;  4NDO A;  3B8G A;  3T7B A;  3C20 A;  3QUN A;  4NDO B;  2F06 A;  4JZ8 A;  2RD5 A;  3LL5 A;  3U6U A;  4I49 A;  4F6T B;  1GS5 A;  2OGX B;  3ZZH A;  2J4J A;  4F6T A;  3L76 A;  2R8V A;  2JJ4 A;  3D2M A;  1ZVP A;  2WE4 A;  2OGX A;  2AKO A;  3C1N A;  2J0X A;  2JJX A;  1GSJ A;  2A1F A;  3AB4 A;  2BNF A;  3ZZG A;  3WWN A;  3D41 A;  2CDQ A;  3AAW A;  2E9Y A;  4A7W A;  4JZ9 A;  2V5H A;  3C1M A;  3TVI A;  3K56 A;  2IJ9 A;  2J0W A;  1ZHV A;  3K4Y A;  3S6K A;  3ZZF A;  3L86 A;  2J4K A;  2BTY A;  2X2W A;  3QUO A;  3S6G A;  2J5T A;  4NDP B;  3EK5 A;  4NDP A;  3QVF A;  4AB7 A;  2R98 A;  2BUF A;  2AP9 A;  3D2P A;  2BMU A;  1B7B A;  4AXS A;  4Q1T A;  3D40 A;  4A7X A;  2WE5 A;  1Z9D A;  3LKK A;  3QVH A;  2BND A;  4USJ A;  4OLC A;  4NDR B;  3NWY A;  4NDQ A;  3K4O A;  2W21 A;  3EK6 A;  3K52 A;  3AB2 A;  3KZF A;  2BNE A;  3WWM A;  3S6H A;  2J5V A;  2BRX A;  2J4L A;  4NDR A;  2WXB A; 
#chains in the Genus database with same CATH topology
 4NDQ B;  2JI5 A;  1OH9 A;  1YBD A;  4JZ7 A;  2HMF A;  3ZZI A;  4KZT A;  1OHB A;  1OHA A;  1E19 A;  2VA1 A;  3LL9 A;  3QUR A;  2V4Y A;  2BRI A;  4NDO A;  4KR6 A;  3B8G A;  3T7B A;  3C20 A;  3QUN A;  4NDO B;  2F06 A;  4JZ8 A;  2RD5 A;  3LL5 A;  3U6U A;  4I49 A;  4F6T B;  3TLJ A;  3TM5 A;  1GS5 A;  2OGX B;  3ZZH A;  2J4J A;  4F6T A;  3L76 A;  2R8V A;  2JJ4 A;  3D2M A;  1ZVP A;  2WE4 A;  3V97 A;  3K0B A;  2OGX A;  2AKO A;  2JJX A;  3C1N A;  2J0X A;  1GSJ A;  2A1F A;  3AB4 A;  2BNF A;  3ZZG A;  3WWN A;  3D41 A;  2CDQ A;  3AAW A;  2E9Y A;  4A7W A;  3TMA A;  4JZ9 A;  2V5H A;  3C1M A;  3TVI A;  3K56 A;  2IJ9 A;  3LDU A;  2J0W A;  1ZHV A;  2C5S A;  3K4Y A;  3S6K A;  3ZZF A;  3L86 A;  2J4K A;  4KR7 A;  2BTY A;  2X2W A;  3QUO A;  3S6G A;  2J5T A;  4NDP B;  3EK5 A;  3LDG A;  4NDP A;  3QVF A;  4AB7 A;  2R98 A;  2BUF A;  2AP9 A;  3D2P A;  2BMU A;  1B7B A;  4AXS A;  4Q1T A;  4KR9 A;  3D40 A;  4A7X A;  2WE5 A;  1Z9D A;  3LKK A;  3QVH A;  2BND A;  4USJ A;  4OLC A;  4NDR B;  3NWY A;  3V8V A;  4NDQ A;  3K4O A;  2W21 A;  3EK6 A;  3TM4 A;  3K52 A;  3AB2 A;  3KZF A;  2BNE A;  3WWM A;  3S6H A;  2J5V A;  2BRX A;  2J4L A;  4NDR A;  2WXB A; 
#chains in the Genus database with same CATH homology
 4NDQ B;  2JI5 A;  1OH9 A;  1YBD A;  4JZ7 A;  2HMF A;  3ZZI A;  4KZT A;  1OHB A;  1OHA A;  1E19 A;  2VA1 A;  3LL9 A;  3QUR A;  2V4Y A;  2BRI A;  4NDO A;  4KR6 A;  3B8G A;  3T7B A;  3C20 A;  3QUN A;  4NDO B;  2F06 A;  4JZ8 A;  2RD5 A;  3LL5 A;  3U6U A;  4I49 A;  4F6T B;  3TLJ A;  3TM5 A;  1GS5 A;  2OGX B;  3ZZH A;  2J4J A;  4F6T A;  3L76 A;  2R8V A;  2JJ4 A;  3D2M A;  1ZVP A;  2WE4 A;  3V97 A;  3K0B A;  2OGX A;  2AKO A;  2JJX A;  3C1N A;  2J0X A;  1GSJ A;  2A1F A;  3AB4 A;  2BNF A;  3ZZG A;  3WWN A;  3D41 A;  2CDQ A;  3AAW A;  2E9Y A;  4A7W A;  3TMA A;  4JZ9 A;  2V5H A;  3C1M A;  3TVI A;  3K56 A;  2IJ9 A;  3LDU A;  2J0W A;  1ZHV A;  2C5S A;  3K4Y A;  3S6K A;  3ZZF A;  3L86 A;  2J4K A;  4KR7 A;  2BTY A;  2X2W A;  3QUO A;  3S6G A;  2J5T A;  4NDP B;  3EK5 A;  3LDG A;  4NDP A;  3QVF A;  4AB7 A;  2R98 A;  2BUF A;  2AP9 A;  3D2P A;  2BMU A;  1B7B A;  4AXS A;  4Q1T A;  4KR9 A;  3D40 A;  4A7X A;  2WE5 A;  1Z9D A;  3LKK A;  3QVH A;  2BND A;  4USJ A;  4OLC A;  4NDR B;  3NWY A;  3V8V A;  4NDQ A;  3K4O A;  2W21 A;  3EK6 A;  3TM4 A;  3K52 A;  3AB2 A;  3KZF A;  2BNE A;  3WWM A;  3S6H A;  2J5V A;  2BRX A;  2J4L A;  4NDR A;  2WXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...