3C20A

Crystal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with l-aspartate
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
469
structure length
465
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable aspartokinase
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 154
structure length 465
sequence length 469
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c20A02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c20A01
3LKKA 3T7BA 3L76A 2BMUA 3QUNA 2J5VA 1ZHVA 2CDQA 4F6TB 2OGXA 2R8VA 4NDOB 2WXBA 2BRIA 2BTYA 2WE5A 1E19A 3C1NA 3QURA 1Z9DA 3D2MA 4F6TA 3EK6A 3LL9A 1OHAA 4OLCA 2J4LA 2V5HA 3QVFA 3KZFA 3QUOA 3S6GA 2AKOA 3ZZGA 4A7WA 3U6UA 3AB4A 3D40A 2BNEA 2V4YA 4NDPA 3B8GA 4Q1TA 3K56A 3K4YA 3AB2A 2A1FA 4AXSA 1OHBA 4NDRB 2F06A 3C20A 2J4JA 2BNFA 3D2PA 2JJ4A 2R98A 4NDOA 2WE4A 2JJXA 4USJA 4NDPB 3LL5A 3S6KA 2BNDA 4NDRA 2HMFA 2J5TA 4JZ8A 1GSJA 1YBDA 4KZTA 4NDQB 2BUFA 2J0XA 2X2WA 3K4OA 3C1MA 2RD5A 3ZZFA 3K52A 4NDQA 3ZZHA 4A7XA 2J0WA 3WWNA 1GS5A 3NWYA 2J4KA 2VA1A 2E9YA 2W21A 4I49A 3EK5A 4AB7A 3D41A 4JZ7A 2JI5A 2AP9A 3WWMA 3TVIA 3AAWA 3S6HA 1OH9A 2IJ9A 1B7BA 3ZZIA 4JZ9A 3L86A 1ZVPA 2OGXB 3QVHA 2BRXA
chains in the Genus database with same CATH superfamily
4KR7A 3LKKA 3T7BA 3L76A 2BMUA 3QUNA 2J5VA 1ZHVA 2CDQA 4F6TB 2OGXA 2R8VA 4NDOB 2WXBA 2BRIA 2BTYA 2WE5A 1E19A 3C1NA 3QURA 1Z9DA 3D2MA 4F6TA 3EK6A 3LL9A 1OHAA 3TLJA 4OLCA 2J4LA 2V5HA 3QVFA 3KZFA 3QUOA 3S6GA 2AKOA 3ZZGA 4A7WA 3U6UA 3AB4A 3D40A 2BNEA 2V4YA 4NDPA 3B8GA 4Q1TA 3K56A 3K4YA 3AB2A 2A1FA 4AXSA 1OHBA 4NDRB 2F06A 3C20A 2J4JA 2BNFA 3D2PA 2JJ4A 2C5SA 2R98A 4NDOA 2WE4A 2JJXA 4USJA 4NDPB 3LL5A 3S6KA 2BNDA 4NDRA 4KR9A 2HMFA 2J5TA 4JZ8A 3V97A 1GSJA 1YBDA 4KZTA 4NDQB 3V8VA 2BUFA 2J0XA 2X2WA 3K4OA 3C1MA 2RD5A 3ZZFA 3K52A 4NDQA 3ZZHA 4KR6A 4A7XA 2J0WA 3WWNA 1GS5A 3NWYA 2J4KA 2VA1A 2E9YA 2W21A 4I49A 3TMAA 3EK5A 4AB7A 3D41A 4JZ7A 3LDGA 2JI5A 2AP9A 3WWMA 3TVIA 3AAWA 3S6HA 1OH9A 3K0BA 2IJ9A 1B7BA 3ZZIA 3TM5A 4JZ9A 3LDUA 3L86A 1ZVPA 2OGXB 3TM4A 3QVHA 2BRXA
chains in the Genus database with same CATH topology
4KR7A 3LKKA 3T7BA 3L76A 2BMUA 3QUNA 2J5VA 1ZHVA 2CDQA 4F6TB 2OGXA 2R8VA 4NDOB 2WXBA 2BRIA 2BTYA 2WE5A 1E19A 3C1NA 3QURA 1Z9DA 3D2MA 4F6TA 3EK6A 3LL9A 1OHAA 3TLJA 4OLCA 2J4LA 2V5HA 3QVFA 3KZFA 3QUOA 3S6GA 2AKOA 3ZZGA 4A7WA 3U6UA 3AB4A 3D40A 2BNEA 2V4YA 4NDPA 3B8GA 4Q1TA 3K56A 3K4YA 3AB2A 2A1FA 4AXSA 1OHBA 4NDRB 2F06A 3C20A 2J4JA 2BNFA 3D2PA 2JJ4A 2C5SA 2R98A 4NDOA 2WE4A 2JJXA 4USJA 4NDPB 3LL5A 3S6KA 2BNDA 4NDRA 4KR9A 2HMFA 2J5TA 4JZ8A 3V97A 1GSJA 1YBDA 4KZTA 4NDQB 3V8VA 2BUFA 2J0XA 2X2WA 3K4OA 3C1MA 2RD5A 3ZZFA 3K52A 4NDQA 3ZZHA 4KR6A 4A7XA 2J0WA 3WWNA 1GS5A 3NWYA 2J4KA 2VA1A 2E9YA 2W21A 4I49A 3TMAA 3EK5A 4AB7A 3D41A 4JZ7A 3LDGA 2JI5A 2AP9A 3WWMA 3TVIA 3AAWA 3S6HA 1OH9A 3K0BA 2IJ9A 1B7BA 3ZZIA 3TM5A 4JZ9A 3LDUA 3L86A 1ZVPA 2OGXB 3TM4A 3QVHA 2BRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKK A;  3T7B A;  3L76 A;  2BMU A;  3QUN A;  2J5V A;  1ZHV A;  2CDQ A;  4F6T B;  2OGX A;  2R8V A;  4NDO B;  2WXB A;  2BRI A;  2BTY A;  2WE5 A;  1E19 A;  3C1N A;  3QUR A;  1Z9D A;  3D2M A;  4F6T A;  3EK6 A;  3LL9 A;  1OHA A;  4OLC A;  2J4L A;  2V5H A;  3QVF A;  3KZF A;  3QUO A;  3S6G A;  2AKO A;  3ZZG A;  4A7W A;  3U6U A;  3AB4 A;  3D40 A;  2BNE A;  2V4Y A;  4NDP A;  3B8G A;  4Q1T A;  3K56 A;  3K4Y A;  3AB2 A;  2A1F A;  4AXS A;  1OHB A;  4NDR B;  2F06 A;  3C20 A;  2J4J A;  2BNF A;  3D2P A;  2JJ4 A;  2R98 A;  4NDO A;  2WE4 A;  2JJX A;  4USJ A;  4NDP B;  3LL5 A;  3S6K A;  2BND A;  4NDR A;  2HMF A;  2J5T A;  4JZ8 A;  1GSJ A;  1YBD A;  4KZT A;  4NDQ B;  2BUF A;  2J0X A;  2X2W A;  3K4O A;  3C1M A;  2RD5 A;  3ZZF A;  3K52 A;  4NDQ A;  3ZZH A;  4A7X A;  2J0W A;  3WWN A;  1GS5 A;  3NWY A;  2J4K A;  2VA1 A;  2E9Y A;  2W21 A;  4I49 A;  3EK5 A;  4AB7 A;  3D41 A;  4JZ7 A;  2JI5 A;  2AP9 A;  3WWM A;  3TVI A;  3AAW A;  3S6H A;  1OH9 A;  2IJ9 A;  1B7B A;  3ZZI A;  4JZ9 A;  3L86 A;  1ZVP A;  2OGX B;  3QVH A;  2BRX A; 
#chains in the Genus database with same CATH topology
 4KR7 A;  3LKK A;  3T7B A;  3L76 A;  2BMU A;  3QUN A;  2J5V A;  1ZHV A;  2CDQ A;  4F6T B;  2OGX A;  2R8V A;  4NDO B;  2WXB A;  2BRI A;  2BTY A;  2WE5 A;  1E19 A;  3C1N A;  3QUR A;  1Z9D A;  3D2M A;  4F6T A;  3EK6 A;  3LL9 A;  1OHA A;  3TLJ A;  4OLC A;  2J4L A;  2V5H A;  3QVF A;  3KZF A;  3QUO A;  3S6G A;  2AKO A;  3ZZG A;  4A7W A;  3U6U A;  3AB4 A;  3D40 A;  2BNE A;  2V4Y A;  4NDP A;  3B8G A;  4Q1T A;  3K56 A;  3K4Y A;  3AB2 A;  2A1F A;  4AXS A;  1OHB A;  4NDR B;  2F06 A;  3C20 A;  2J4J A;  2BNF A;  3D2P A;  2JJ4 A;  2C5S A;  2R98 A;  4NDO A;  2WE4 A;  2JJX A;  4USJ A;  4NDP B;  3LL5 A;  3S6K A;  2BND A;  4NDR A;  4KR9 A;  2HMF A;  2J5T A;  4JZ8 A;  3V97 A;  1GSJ A;  1YBD A;  4KZT A;  4NDQ B;  3V8V A;  2BUF A;  2J0X A;  2X2W A;  3K4O A;  3C1M A;  2RD5 A;  3ZZF A;  3K52 A;  4NDQ A;  3ZZH A;  4KR6 A;  4A7X A;  2J0W A;  3WWN A;  1GS5 A;  3NWY A;  2J4K A;  2VA1 A;  2E9Y A;  2W21 A;  4I49 A;  3TMA A;  3EK5 A;  4AB7 A;  3D41 A;  4JZ7 A;  3LDG A;  2JI5 A;  2AP9 A;  3WWM A;  3TVI A;  3AAW A;  3S6H A;  1OH9 A;  3K0B A;  2IJ9 A;  1B7B A;  3ZZI A;  3TM5 A;  4JZ9 A;  3LDU A;  3L86 A;  1ZVP A;  2OGX B;  3TM4 A;  3QVH A;  2BRX A; 
#chains in the Genus database with same CATH homology
 4KR7 A;  3LKK A;  3T7B A;  3L76 A;  2BMU A;  3QUN A;  2J5V A;  1ZHV A;  2CDQ A;  4F6T B;  2OGX A;  2R8V A;  4NDO B;  2WXB A;  2BRI A;  2BTY A;  2WE5 A;  1E19 A;  3C1N A;  3QUR A;  1Z9D A;  3D2M A;  4F6T A;  3EK6 A;  3LL9 A;  1OHA A;  3TLJ A;  4OLC A;  2J4L A;  2V5H A;  3QVF A;  3KZF A;  3QUO A;  3S6G A;  2AKO A;  3ZZG A;  4A7W A;  3U6U A;  3AB4 A;  3D40 A;  2BNE A;  2V4Y A;  4NDP A;  3B8G A;  4Q1T A;  3K56 A;  3K4Y A;  3AB2 A;  2A1F A;  4AXS A;  1OHB A;  4NDR B;  2F06 A;  3C20 A;  2J4J A;  2BNF A;  3D2P A;  2JJ4 A;  2C5S A;  2R98 A;  4NDO A;  2WE4 A;  2JJX A;  4USJ A;  4NDP B;  3LL5 A;  3S6K A;  2BND A;  4NDR A;  4KR9 A;  2HMF A;  2J5T A;  4JZ8 A;  3V97 A;  1GSJ A;  1YBD A;  4KZT A;  4NDQ B;  3V8V A;  2BUF A;  2J0X A;  2X2W A;  3K4O A;  3C1M A;  2RD5 A;  3ZZF A;  3K52 A;  4NDQ A;  3ZZH A;  4KR6 A;  4A7X A;  2J0W A;  3WWN A;  1GS5 A;  3NWY A;  2J4K A;  2VA1 A;  2E9Y A;  2W21 A;  4I49 A;  3TMA A;  3EK5 A;  4AB7 A;  3D41 A;  4JZ7 A;  3LDG A;  2JI5 A;  2AP9 A;  3WWM A;  3TVI A;  3AAW A;  3S6H A;  1OH9 A;  3K0B A;  2IJ9 A;  1B7B A;  3ZZI A;  3TM5 A;  4JZ9 A;  3LDU A;  3L86 A;  1ZVP A;  2OGX B;  3TM4 A;  3QVH A;  2BRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...