3C20A

Crystal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with l-aspartate
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
469
structure length
465
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Probable aspartokinase
total genus 154
structure length 465
sequence length 469
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c20A02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c20A01
3AAWA 2HMFA 4F6TA 4USJA 4NDRB 2F06A 2R8VA 3C1MA 3K4OA 2X2WA 4Q1TA 3S6GA 2CDQA 2J4KA 3LL5A 3QUOA 1OHAA 1YBDA 4JZ7A 2OGXA 2V5HA 1OHBA 3LL9A 2RD5A 2WE5A 3ZZFA 2VA1A 2JJ4A 2BNDA 1B7BA 1OH9A 2AP9A 3K52A 3ZZGA 3L76A 1Z9DA 3AB2A 3QVFA 2BMUA 4I49A 3ZZHA 2W21A 3AB4A 3EK5A 2BRXA 3WWMA 4JZ9A 3C20A 2JI5A 3C1NA 2A1FA 3QVHA 3L86A 2BNEA 2J5VA 3K56A 2V4YA 3B8GA 3QUNA 3KZFA 2OGXB 3ZZIA 4NDPB 3WWNA 1E19A 2R98A 1GSJA 3T7BA 4NDPA 3D2MA 4NDQA 4KZTA 2BUFA 3D41A 2J0WA 4A7XA 2J5TA 4NDQB 4AXSA 4AB7A 1ZVPA 4A7WA 4NDOA 3U6UA 3D40A 4NDRA 3S6KA 3TVIA 2BRIA 2J0XA 1GS5A 3NWYA 4JZ8A 4NDOB 1ZHVA 3D2PA 2WE4A 2E9YA 2J4JA 2AKOA 2J4LA 2WXBA 2IJ9A 2BNFA 2BTYA 3QURA 2JJXA 3EK6A 4F6TB 3S6HA 3LKKA 4OLCA 3K4YA
chains in the Genus database with same CATH superfamily
3AAWA 2HMFA 4F6TA 3LDGA 4USJA 4NDRB 2F06A 3TMAA 2R8VA 3C1MA 3K4OA 4KR9A 2X2WA 4Q1TA 3TM5A 3S6GA 2CDQA 2J4KA 3LL5A 3QUOA 1OHAA 1YBDA 4JZ7A 2OGXA 2V5HA 1OHBA 3LL9A 2RD5A 2WE5A 3ZZFA 2VA1A 2JJ4A 2BNDA 1B7BA 3TM4A 1OH9A 2AP9A 3LDUA 3K52A 2C5SA 3ZZGA 3L76A 1Z9DA 3AB2A 3QVFA 2BMUA 4I49A 3K0BA 3ZZHA 2W21A 3AB4A 3EK5A 2BRXA 3WWMA 4JZ9A 3C20A 2JI5A 3C1NA 2A1FA 3QVHA 3L86A 2BNEA 2J5VA 3K56A 2V4YA 3B8GA 3QUNA 3TLJA 3KZFA 2OGXB 3ZZIA 4NDPB 3WWNA 1E19A 2R98A 1GSJA 3T7BA 4NDPA 3D2MA 4NDQA 4KZTA 2BUFA 3D41A 2J0WA 4KR6A 4A7XA 2J5TA 4NDQB 4AXSA 4AB7A 1ZVPA 4A7WA 4NDOA 3U6UA 3D40A 3V97A 4NDRA 3S6KA 3TVIA 2BRIA 2J0XA 1GS5A 3NWYA 4JZ8A 4NDOB 1ZHVA 3D2PA 2WE4A 2E9YA 4KR7A 2J4JA 2AKOA 3V8VA 2J4LA 2WXBA 2IJ9A 2BNFA 2BTYA 3QURA 2JJXA 3EK6A 4F6TB 3S6HA 3LKKA 4OLCA 3K4YA
chains in the Genus database with same CATH topology
3AAWA 2HMFA 4F6TA 3LDGA 4USJA 4NDRB 2F06A 3TMAA 2R8VA 3C1MA 3K4OA 4KR9A 2X2WA 4Q1TA 3TM5A 3S6GA 2CDQA 2J4KA 3LL5A 3QUOA 1OHAA 1YBDA 4JZ7A 2OGXA 2V5HA 1OHBA 3LL9A 2RD5A 2WE5A 3ZZFA 2VA1A 2JJ4A 2BNDA 1B7BA 3TM4A 1OH9A 2AP9A 3LDUA 3K52A 2C5SA 3ZZGA 3L76A 1Z9DA 3AB2A 3QVFA 2BMUA 4I49A 3K0BA 3ZZHA 2W21A 3AB4A 3EK5A 2BRXA 3WWMA 4JZ9A 3C20A 2JI5A 3C1NA 2A1FA 3QVHA 3L86A 2BNEA 2J5VA 3K56A 2V4YA 3B8GA 3QUNA 3TLJA 3KZFA 2OGXB 3ZZIA 4NDPB 3WWNA 1E19A 2R98A 1GSJA 3T7BA 4NDPA 3D2MA 4NDQA 4KZTA 2BUFA 3D41A 2J0WA 4KR6A 4A7XA 2J5TA 4NDQB 4AXSA 4AB7A 1ZVPA 4A7WA 4NDOA 3U6UA 3D40A 3V97A 4NDRA 3S6KA 3TVIA 2BRIA 2J0XA 1GS5A 3NWYA 4JZ8A 4NDOB 1ZHVA 3D2PA 2WE4A 2E9YA 4KR7A 2J4JA 2AKOA 3V8VA 2J4LA 2WXBA 2IJ9A 2BNFA 2BTYA 3QURA 2JJXA 3EK6A 4F6TB 3S6HA 3LKKA 4OLCA 3K4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAW A;  2HMF A;  4F6T A;  4USJ A;  4NDR B;  2F06 A;  2R8V A;  3C1M A;  3K4O A;  2X2W A;  4Q1T A;  3S6G A;  2CDQ A;  2J4K A;  3LL5 A;  3QUO A;  1OHA A;  1YBD A;  4JZ7 A;  2OGX A;  2V5H A;  1OHB A;  3LL9 A;  2RD5 A;  2WE5 A;  3ZZF A;  2VA1 A;  2JJ4 A;  2BND A;  1B7B A;  1OH9 A;  2AP9 A;  3K52 A;  3ZZG A;  3L76 A;  1Z9D A;  3AB2 A;  3QVF A;  2BMU A;  4I49 A;  3ZZH A;  2W21 A;  3AB4 A;  3EK5 A;  2BRX A;  3WWM A;  4JZ9 A;  3C20 A;  2JI5 A;  3C1N A;  2A1F A;  3QVH A;  3L86 A;  2BNE A;  2J5V A;  3K56 A;  2V4Y A;  3B8G A;  3QUN A;  3KZF A;  2OGX B;  3ZZI A;  4NDP B;  3WWN A;  1E19 A;  2R98 A;  1GSJ A;  3T7B A;  4NDP A;  3D2M A;  4NDQ A;  4KZT A;  2BUF A;  3D41 A;  2J0W A;  4A7X A;  2J5T A;  4NDQ B;  4AXS A;  4AB7 A;  1ZVP A;  4A7W A;  4NDO A;  3U6U A;  3D40 A;  4NDR A;  3S6K A;  3TVI A;  2BRI A;  2J0X A;  1GS5 A;  3NWY A;  4JZ8 A;  4NDO B;  1ZHV A;  3D2P A;  2WE4 A;  2E9Y A;  2J4J A;  2AKO A;  2J4L A;  2WXB A;  2IJ9 A;  2BNF A;  2BTY A;  3QUR A;  2JJX A;  3EK6 A;  4F6T B;  3S6H A;  3LKK A;  4OLC A;  3K4Y A; 
#chains in the Genus database with same CATH topology
 3AAW A;  2HMF A;  4F6T A;  3LDG A;  4USJ A;  4NDR B;  2F06 A;  3TMA A;  2R8V A;  3C1M A;  3K4O A;  4KR9 A;  2X2W A;  4Q1T A;  3TM5 A;  3S6G A;  2CDQ A;  2J4K A;  3LL5 A;  3QUO A;  1OHA A;  1YBD A;  4JZ7 A;  2OGX A;  2V5H A;  1OHB A;  3LL9 A;  2RD5 A;  2WE5 A;  3ZZF A;  2VA1 A;  2JJ4 A;  2BND A;  1B7B A;  3TM4 A;  1OH9 A;  2AP9 A;  3LDU A;  3K52 A;  2C5S A;  3ZZG A;  3L76 A;  1Z9D A;  3AB2 A;  3QVF A;  2BMU A;  4I49 A;  3K0B A;  3ZZH A;  2W21 A;  3AB4 A;  3EK5 A;  2BRX A;  3WWM A;  4JZ9 A;  3C20 A;  2JI5 A;  3C1N A;  2A1F A;  3QVH A;  3L86 A;  2BNE A;  2J5V A;  3K56 A;  2V4Y A;  3B8G A;  3QUN A;  3TLJ A;  3KZF A;  2OGX B;  3ZZI A;  4NDP B;  3WWN A;  1E19 A;  2R98 A;  1GSJ A;  3T7B A;  4NDP A;  3D2M A;  4NDQ A;  4KZT A;  2BUF A;  3D41 A;  2J0W A;  4KR6 A;  4A7X A;  2J5T A;  4NDQ B;  4AXS A;  4AB7 A;  1ZVP A;  4A7W A;  4NDO A;  3U6U A;  3D40 A;  3V97 A;  4NDR A;  3S6K A;  3TVI A;  2BRI A;  2J0X A;  1GS5 A;  3NWY A;  4JZ8 A;  4NDO B;  1ZHV A;  3D2P A;  2WE4 A;  2E9Y A;  4KR7 A;  2J4J A;  2AKO A;  3V8V A;  2J4L A;  2WXB A;  2IJ9 A;  2BNF A;  2BTY A;  3QUR A;  2JJX A;  3EK6 A;  4F6T B;  3S6H A;  3LKK A;  4OLC A;  3K4Y A; 
#chains in the Genus database with same CATH homology
 3AAW A;  2HMF A;  4F6T A;  3LDG A;  4USJ A;  4NDR B;  2F06 A;  3TMA A;  2R8V A;  3C1M A;  3K4O A;  4KR9 A;  2X2W A;  4Q1T A;  3TM5 A;  3S6G A;  2CDQ A;  2J4K A;  3LL5 A;  3QUO A;  1OHA A;  1YBD A;  4JZ7 A;  2OGX A;  2V5H A;  1OHB A;  3LL9 A;  2RD5 A;  2WE5 A;  3ZZF A;  2VA1 A;  2JJ4 A;  2BND A;  1B7B A;  3TM4 A;  1OH9 A;  2AP9 A;  3LDU A;  3K52 A;  2C5S A;  3ZZG A;  3L76 A;  1Z9D A;  3AB2 A;  3QVF A;  2BMU A;  4I49 A;  3K0B A;  3ZZH A;  2W21 A;  3AB4 A;  3EK5 A;  2BRX A;  3WWM A;  4JZ9 A;  3C20 A;  2JI5 A;  3C1N A;  2A1F A;  3QVH A;  3L86 A;  2BNE A;  2J5V A;  3K56 A;  2V4Y A;  3B8G A;  3QUN A;  3TLJ A;  3KZF A;  2OGX B;  3ZZI A;  4NDP B;  3WWN A;  1E19 A;  2R98 A;  1GSJ A;  3T7B A;  4NDP A;  3D2M A;  4NDQ A;  4KZT A;  2BUF A;  3D41 A;  2J0W A;  4KR6 A;  4A7X A;  2J5T A;  4NDQ B;  4AXS A;  4AB7 A;  1ZVP A;  4A7W A;  4NDO A;  3U6U A;  3D40 A;  3V97 A;  4NDR A;  3S6K A;  3TVI A;  2BRI A;  2J0X A;  1GS5 A;  3NWY A;  4JZ8 A;  4NDO B;  1ZHV A;  3D2P A;  2WE4 A;  2E9Y A;  4KR7 A;  2J4J A;  2AKO A;  3V8V A;  2J4L A;  2WXB A;  2IJ9 A;  2BNF A;  2BTY A;  3QUR A;  2JJX A;  3EK6 A;  4F6T B;  3S6H A;  3LKK A;  4OLC A;  3K4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...