3C20A

Crystal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with l-aspartate
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
469
structure length
465
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable aspartokinase
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 154
structure length 465
sequence length 469
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c20A02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c20A01
1OH9A 3D41A 1B7BA 2J0WA 2V5HA 1OHBA 4JZ7A 2W21A 3AB2A 4NDOB 2AP9A 4NDQB 3LL9A 3C20A 3LKKA 3NWYA 4F6TB 2AKOA 2J5VA 3T7BA 3C1NA 2WE5A 3K4OA 4Q1TA 3WWMA 4AB7A 3S6KA 4NDRA 3QVHA 4NDPB 3WWNA 2BTYA 1E19A 2OGXA 4JZ8A 1YBDA 3U6UA 2BMUA 3TVIA 2E9YA 3S6HA 2F06A 2OGXB 3B8GA 2J4JA 3EK5A 3QUOA 3QURA 4AXSA 4I49A 2V4YA 1OHAA 4USJA 3ZZIA 2BRXA 2RD5A 3ZZHA 1GSJA 2HMFA 2WXBA 1ZHVA 4KZTA 3D2MA 2JJ4A 3D40A 3LL5A 3EK6A 2J0XA 4NDRB 2BNFA 3AAWA 2A1FA 3S6GA 1ZVPA 4JZ9A 4OLCA 2J4KA 2CDQA 3L76A 1Z9DA 3K52A 2X2WA 3L86A 4A7WA 4NDQA 3ZZGA 3AB4A 4F6TA 2J4LA 3QUNA 1GS5A 2BRIA 2BUFA 2JI5A 3K4YA 3ZZFA 2WE4A 2BNDA 3C1MA 4NDPA 4A7XA 2JJXA 2J5TA 2VA1A 2BNEA 3K56A 3D2PA 2IJ9A 3KZFA 2R8VA 3QVFA 2R98A 4NDOA
chains in the Genus database with same CATH superfamily
1OH9A 3D41A 1B7BA 2J0WA 3V8VA 2V5HA 1OHBA 4JZ7A 2W21A 2C5SA 3AB2A 4NDOB 2AP9A 4NDQB 3LL9A 3C20A 3LKKA 3NWYA 4F6TB 2AKOA 2J5VA 3T7BA 3C1NA 2WE5A 3K4OA 4Q1TA 4KR9A 3WWMA 4AB7A 3S6KA 4NDRA 3QVHA 4NDPB 3WWNA 2BTYA 1E19A 2OGXA 4JZ8A 1YBDA 3LDGA 3U6UA 2BMUA 3TVIA 2E9YA 3S6HA 2F06A 2OGXB 3B8GA 2J4JA 3EK5A 3TM4A 3K0BA 3QUOA 3QURA 4AXSA 4I49A 2V4YA 1OHAA 4USJA 3ZZIA 2BRXA 2RD5A 3ZZHA 3TM5A 2HMFA 1GSJA 2WXBA 3TLJA 1ZHVA 4KZTA 3D2MA 2JJ4A 3D40A 3LL5A 3V97A 3EK6A 2J0XA 4NDRB 2BNFA 3AAWA 2A1FA 3LDUA 3S6GA 1ZVPA 4JZ9A 4OLCA 2J4KA 4KR6A 2CDQA 3L76A 1Z9DA 3K52A 2X2WA 3L86A 4A7WA 4NDQA 3ZZGA 3TMAA 3AB4A 4F6TA 4KR7A 2J4LA 3QUNA 1GS5A 2BRIA 2BUFA 2JI5A 3K4YA 3ZZFA 2WE4A 2BNDA 3C1MA 4NDPA 4A7XA 2JJXA 2J5TA 2VA1A 2BNEA 3K56A 3D2PA 2IJ9A 3KZFA 2R8VA 3QVFA 2R98A 4NDOA
chains in the Genus database with same CATH topology
1OH9A 3D41A 1B7BA 2J0WA 3V8VA 2V5HA 1OHBA 4JZ7A 2W21A 2C5SA 3AB2A 4NDOB 2AP9A 4NDQB 3LL9A 3C20A 3LKKA 3NWYA 4F6TB 2AKOA 2J5VA 3T7BA 3C1NA 2WE5A 3K4OA 4Q1TA 4KR9A 3WWMA 4AB7A 3S6KA 4NDRA 3QVHA 4NDPB 3WWNA 2BTYA 1E19A 2OGXA 4JZ8A 1YBDA 3LDGA 3U6UA 2BMUA 3TVIA 2E9YA 3S6HA 2F06A 2OGXB 3B8GA 2J4JA 3EK5A 3TM4A 3K0BA 3QUOA 3QURA 4AXSA 4I49A 2V4YA 1OHAA 4USJA 3ZZIA 2BRXA 2RD5A 3ZZHA 3TM5A 2HMFA 1GSJA 2WXBA 3TLJA 1ZHVA 4KZTA 3D2MA 2JJ4A 3D40A 3LL5A 3V97A 3EK6A 2J0XA 4NDRB 2BNFA 3AAWA 2A1FA 3LDUA 3S6GA 1ZVPA 4JZ9A 4OLCA 2J4KA 4KR6A 2CDQA 3L76A 1Z9DA 3K52A 2X2WA 3L86A 4A7WA 4NDQA 3ZZGA 3TMAA 3AB4A 4F6TA 4KR7A 2J4LA 3QUNA 1GS5A 2BRIA 2BUFA 2JI5A 3K4YA 3ZZFA 2WE4A 2BNDA 3C1MA 4NDPA 4A7XA 2JJXA 2J5TA 2VA1A 2BNEA 3K56A 3D2PA 2IJ9A 3KZFA 2R8VA 3QVFA 2R98A 4NDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OH9 A;  3D41 A;  1B7B A;  2J0W A;  2V5H A;  1OHB A;  4JZ7 A;  2W21 A;  3AB2 A;  4NDO B;  2AP9 A;  4NDQ B;  3LL9 A;  3C20 A;  3LKK A;  3NWY A;  4F6T B;  2AKO A;  2J5V A;  3T7B A;  3C1N A;  2WE5 A;  3K4O A;  4Q1T A;  3WWM A;  4AB7 A;  3S6K A;  4NDR A;  3QVH A;  4NDP B;  3WWN A;  2BTY A;  1E19 A;  2OGX A;  4JZ8 A;  1YBD A;  3U6U A;  2BMU A;  3TVI A;  2E9Y A;  3S6H A;  2F06 A;  2OGX B;  3B8G A;  2J4J A;  3EK5 A;  3QUO A;  3QUR A;  4AXS A;  4I49 A;  2V4Y A;  1OHA A;  4USJ A;  3ZZI A;  2BRX A;  2RD5 A;  3ZZH A;  1GSJ A;  2HMF A;  2WXB A;  1ZHV A;  4KZT A;  3D2M A;  2JJ4 A;  3D40 A;  3LL5 A;  3EK6 A;  2J0X A;  4NDR B;  2BNF A;  3AAW A;  2A1F A;  3S6G A;  1ZVP A;  4JZ9 A;  4OLC A;  2J4K A;  2CDQ A;  3L76 A;  1Z9D A;  3K52 A;  2X2W A;  3L86 A;  4A7W A;  4NDQ A;  3ZZG A;  3AB4 A;  4F6T A;  2J4L A;  3QUN A;  1GS5 A;  2BRI A;  2BUF A;  2JI5 A;  3K4Y A;  3ZZF A;  2WE4 A;  2BND A;  3C1M A;  4NDP A;  4A7X A;  2JJX A;  2J5T A;  2VA1 A;  2BNE A;  3K56 A;  3D2P A;  2IJ9 A;  3KZF A;  2R8V A;  3QVF A;  2R98 A;  4NDO A; 
#chains in the Genus database with same CATH topology
 1OH9 A;  3D41 A;  1B7B A;  2J0W A;  3V8V A;  2V5H A;  1OHB A;  4JZ7 A;  2W21 A;  2C5S A;  3AB2 A;  4NDO B;  2AP9 A;  4NDQ B;  3LL9 A;  3C20 A;  3LKK A;  3NWY A;  4F6T B;  2AKO A;  2J5V A;  3T7B A;  3C1N A;  2WE5 A;  3K4O A;  4Q1T A;  4KR9 A;  3WWM A;  4AB7 A;  3S6K A;  4NDR A;  3QVH A;  4NDP B;  3WWN A;  2BTY A;  1E19 A;  2OGX A;  4JZ8 A;  1YBD A;  3LDG A;  3U6U A;  2BMU A;  3TVI A;  2E9Y A;  3S6H A;  2F06 A;  2OGX B;  3B8G A;  2J4J A;  3EK5 A;  3TM4 A;  3K0B A;  3QUO A;  3QUR A;  4AXS A;  4I49 A;  2V4Y A;  1OHA A;  4USJ A;  3ZZI A;  2BRX A;  2RD5 A;  3ZZH A;  3TM5 A;  2HMF A;  1GSJ A;  2WXB A;  3TLJ A;  1ZHV A;  4KZT A;  3D2M A;  2JJ4 A;  3D40 A;  3LL5 A;  3V97 A;  3EK6 A;  2J0X A;  4NDR B;  2BNF A;  3AAW A;  2A1F A;  3LDU A;  3S6G A;  1ZVP A;  4JZ9 A;  4OLC A;  2J4K A;  4KR6 A;  2CDQ A;  3L76 A;  1Z9D A;  3K52 A;  2X2W A;  3L86 A;  4A7W A;  4NDQ A;  3ZZG A;  3TMA A;  3AB4 A;  4F6T A;  4KR7 A;  2J4L A;  3QUN A;  1GS5 A;  2BRI A;  2BUF A;  2JI5 A;  3K4Y A;  3ZZF A;  2WE4 A;  2BND A;  3C1M A;  4NDP A;  4A7X A;  2JJX A;  2J5T A;  2VA1 A;  2BNE A;  3K56 A;  3D2P A;  2IJ9 A;  3KZF A;  2R8V A;  3QVF A;  2R98 A;  4NDO A; 
#chains in the Genus database with same CATH homology
 1OH9 A;  3D41 A;  1B7B A;  2J0W A;  3V8V A;  2V5H A;  1OHB A;  4JZ7 A;  2W21 A;  2C5S A;  3AB2 A;  4NDO B;  2AP9 A;  4NDQ B;  3LL9 A;  3C20 A;  3LKK A;  3NWY A;  4F6T B;  2AKO A;  2J5V A;  3T7B A;  3C1N A;  2WE5 A;  3K4O A;  4Q1T A;  4KR9 A;  3WWM A;  4AB7 A;  3S6K A;  4NDR A;  3QVH A;  4NDP B;  3WWN A;  2BTY A;  1E19 A;  2OGX A;  4JZ8 A;  1YBD A;  3LDG A;  3U6U A;  2BMU A;  3TVI A;  2E9Y A;  3S6H A;  2F06 A;  2OGX B;  3B8G A;  2J4J A;  3EK5 A;  3TM4 A;  3K0B A;  3QUO A;  3QUR A;  4AXS A;  4I49 A;  2V4Y A;  1OHA A;  4USJ A;  3ZZI A;  2BRX A;  2RD5 A;  3ZZH A;  3TM5 A;  2HMF A;  1GSJ A;  2WXB A;  3TLJ A;  1ZHV A;  4KZT A;  3D2M A;  2JJ4 A;  3D40 A;  3LL5 A;  3V97 A;  3EK6 A;  2J0X A;  4NDR B;  2BNF A;  3AAW A;  2A1F A;  3LDU A;  3S6G A;  1ZVP A;  4JZ9 A;  4OLC A;  2J4K A;  4KR6 A;  2CDQ A;  3L76 A;  1Z9D A;  3K52 A;  2X2W A;  3L86 A;  4A7W A;  4NDQ A;  3ZZG A;  3TMA A;  3AB4 A;  4F6T A;  4KR7 A;  2J4L A;  3QUN A;  1GS5 A;  2BRI A;  2BUF A;  2JI5 A;  3K4Y A;  3ZZF A;  2WE4 A;  2BND A;  3C1M A;  4NDP A;  4A7X A;  2JJX A;  2J5T A;  2VA1 A;  2BNE A;  3K56 A;  3D2P A;  2IJ9 A;  3KZF A;  2R8V A;  3QVF A;  2R98 A;  4NDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...