3C1MA

Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
469
structure length
465
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Probable aspartokinase
total genus 160
structure length 465
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c1mA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c1mA01
3TVIA 3ZZGA 1GSJA 2J5VA 4NDQA 4OLCA 4F6TB 2X2WA 3LL5A 4KZTA 3LL9A 1ZHVA 3K4OA 4AB7A 3S6HA 3S6GA 4JZ7A 3AAWA 3QUNA 1OHAA 2E9YA 4NDPB 2J0WA 2WE4A 2J0XA 3C20A 2R8VA 3LKKA 2BRXA 2CDQA 4NDOA 4NDPA 1GS5A 4F6TA 4Q1TA 4NDQB 4NDRB 2AKOA 1B7BA 1OH9A 2J4JA 2J4KA 3D41A 3WWMA 3QVFA 4NDRA 2BRIA 2BUFA 2OGXB 4NDOB 3D2MA 3S6KA 4I49A 3C1NA 3AB2A 1Z9DA 3ZZHA 1OHBA 3D2PA 3WWNA 3C1MA 2J4LA 3AB4A 3K56A 4JZ9A 3QURA 2F06A 3EK5A 4USJA 2IJ9A 2V5HA 3K4YA 3L76A 3U6UA 1E19A 3D40A 3T7BA 3NWYA 3QUOA 2WXBA 2JJ4A 4A7WA 2J5TA 3QVHA 2V4YA 3L86A 2WE5A 2HMFA 4JZ8A 2JJXA 1YBDA 2AP9A 2BNDA 3ZZIA 2BNEA 2W21A 3K52A 2RD5A 2BMUA 2BTYA 4AXSA 2JI5A 4A7XA 2A1FA 3ZZFA 3B8GA 3EK6A 1ZVPA 2OGXA 2VA1A 3KZFA 2R98A 2BNFA
chains in the Genus database with same CATH superfamily
3TVIA 3ZZGA 1GSJA 2J5VA 4NDQA 4OLCA 4F6TB 2X2WA 3LL5A 4KR6A 3TM4A 3K0BA 4KZTA 3LL9A 3V8VA 1ZHVA 3K4OA 4AB7A 3S6HA 3S6GA 4JZ7A 3AAWA 3QUNA 1OHAA 2E9YA 4NDPB 2C5SA 2J0WA 2WE4A 2J0XA 3C20A 2R8VA 3LKKA 2BRXA 2CDQA 4NDOA 4NDPA 3LDUA 1GS5A 4F6TA 4Q1TA 4NDQB 4NDRB 2AKOA 1B7BA 3LDGA 1OH9A 2J4JA 2J4KA 3D41A 3WWMA 3QVFA 4NDRA 3TMAA 2BRIA 2BUFA 2OGXB 4NDOB 3D2MA 3S6KA 4I49A 3C1NA 3AB2A 1Z9DA 3ZZHA 1OHBA 3D2PA 3WWNA 3C1MA 2J4LA 3AB4A 3K56A 4JZ9A 2F06A 3EK5A 3QURA 4USJA 2IJ9A 2V5HA 3K4YA 3L76A 3U6UA 1E19A 3D40A 3T7BA 3NWYA 3QUOA 2WXBA 2JJ4A 4A7WA 2J5TA 3QVHA 2V4YA 3TLJA 3L86A 2WE5A 2HMFA 4JZ8A 3V97A 2JJXA 4KR7A 1YBDA 2AP9A 2BNDA 3ZZIA 2BNEA 2W21A 3K52A 2RD5A 2BMUA 2BTYA 4AXSA 2JI5A 4A7XA 2A1FA 3ZZFA 3B8GA 3TM5A 4KR9A 3EK6A 1ZVPA 2OGXA 2VA1A 3KZFA 2R98A 2BNFA
chains in the Genus database with same CATH topology
3TVIA 3ZZGA 1GSJA 2J5VA 4NDQA 4OLCA 4F6TB 2X2WA 3LL5A 4KR6A 3TM4A 3K0BA 4KZTA 3LL9A 3V8VA 1ZHVA 3K4OA 4AB7A 3S6HA 3S6GA 4JZ7A 3AAWA 3QUNA 1OHAA 2E9YA 4NDPB 2C5SA 2J0WA 2WE4A 2J0XA 3C20A 2R8VA 3LKKA 2BRXA 2CDQA 4NDOA 4NDPA 3LDUA 1GS5A 4F6TA 4Q1TA 4NDQB 4NDRB 2AKOA 1B7BA 3LDGA 1OH9A 2J4JA 2J4KA 3D41A 3WWMA 3QVFA 4NDRA 3TMAA 2BRIA 2BUFA 2OGXB 4NDOB 3D2MA 3S6KA 4I49A 3C1NA 3AB2A 1Z9DA 3ZZHA 1OHBA 3D2PA 3WWNA 3C1MA 2J4LA 3AB4A 3K56A 4JZ9A 2F06A 3EK5A 3QURA 4USJA 2IJ9A 2V5HA 3K4YA 3L76A 3U6UA 1E19A 3D40A 3T7BA 3NWYA 3QUOA 2WXBA 2JJ4A 4A7WA 2J5TA 3QVHA 2V4YA 3TLJA 3L86A 2WE5A 2HMFA 4JZ8A 3V97A 2JJXA 4KR7A 1YBDA 2AP9A 2BNDA 3ZZIA 2BNEA 2W21A 3K52A 2RD5A 2BMUA 2BTYA 4AXSA 2JI5A 4A7XA 2A1FA 3ZZFA 3B8GA 3TM5A 4KR9A 3EK6A 1ZVPA 2OGXA 2VA1A 3KZFA 2R98A 2BNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVI A;  3ZZG A;  1GSJ A;  2J5V A;  4NDQ A;  4OLC A;  4F6T B;  2X2W A;  3LL5 A;  4KZT A;  3LL9 A;  1ZHV A;  3K4O A;  4AB7 A;  3S6H A;  3S6G A;  4JZ7 A;  3AAW A;  3QUN A;  1OHA A;  2E9Y A;  4NDP B;  2J0W A;  2WE4 A;  2J0X A;  3C20 A;  2R8V A;  3LKK A;  2BRX A;  2CDQ A;  4NDO A;  4NDP A;  1GS5 A;  4F6T A;  4Q1T A;  4NDQ B;  4NDR B;  2AKO A;  1B7B A;  1OH9 A;  2J4J A;  2J4K A;  3D41 A;  3WWM A;  3QVF A;  4NDR A;  2BRI A;  2BUF A;  2OGX B;  4NDO B;  3D2M A;  3S6K A;  4I49 A;  3C1N A;  3AB2 A;  1Z9D A;  3ZZH A;  1OHB A;  3D2P A;  3WWN A;  3C1M A;  2J4L A;  3AB4 A;  3K56 A;  4JZ9 A;  3QUR A;  2F06 A;  3EK5 A;  4USJ A;  2IJ9 A;  2V5H A;  3K4Y A;  3L76 A;  3U6U A;  1E19 A;  3D40 A;  3T7B A;  3NWY A;  3QUO A;  2WXB A;  2JJ4 A;  4A7W A;  2J5T A;  3QVH A;  2V4Y A;  3L86 A;  2WE5 A;  2HMF A;  4JZ8 A;  2JJX A;  1YBD A;  2AP9 A;  2BND A;  3ZZI A;  2BNE A;  2W21 A;  3K52 A;  2RD5 A;  2BMU A;  2BTY A;  4AXS A;  2JI5 A;  4A7X A;  2A1F A;  3ZZF A;  3B8G A;  3EK6 A;  1ZVP A;  2OGX A;  2VA1 A;  3KZF A;  2R98 A;  2BNF A; 
#chains in the Genus database with same CATH topology
 3TVI A;  3ZZG A;  1GSJ A;  2J5V A;  4NDQ A;  4OLC A;  4F6T B;  2X2W A;  3LL5 A;  4KR6 A;  3TM4 A;  3K0B A;  4KZT A;  3LL9 A;  3V8V A;  1ZHV A;  3K4O A;  4AB7 A;  3S6H A;  3S6G A;  4JZ7 A;  3AAW A;  3QUN A;  1OHA A;  2E9Y A;  4NDP B;  2C5S A;  2J0W A;  2WE4 A;  2J0X A;  3C20 A;  2R8V A;  3LKK A;  2BRX A;  2CDQ A;  4NDO A;  4NDP A;  3LDU A;  1GS5 A;  4F6T A;  4Q1T A;  4NDQ B;  4NDR B;  2AKO A;  1B7B A;  3LDG A;  1OH9 A;  2J4J A;  2J4K A;  3D41 A;  3WWM A;  3QVF A;  4NDR A;  3TMA A;  2BRI A;  2BUF A;  2OGX B;  4NDO B;  3D2M A;  3S6K A;  4I49 A;  3C1N A;  3AB2 A;  1Z9D A;  3ZZH A;  1OHB A;  3D2P A;  3WWN A;  3C1M A;  2J4L A;  3AB4 A;  3K56 A;  4JZ9 A;  2F06 A;  3EK5 A;  3QUR A;  4USJ A;  2IJ9 A;  2V5H A;  3K4Y A;  3L76 A;  3U6U A;  1E19 A;  3D40 A;  3T7B A;  3NWY A;  3QUO A;  2WXB A;  2JJ4 A;  4A7W A;  2J5T A;  3QVH A;  2V4Y A;  3TLJ A;  3L86 A;  2WE5 A;  2HMF A;  4JZ8 A;  3V97 A;  2JJX A;  4KR7 A;  1YBD A;  2AP9 A;  2BND A;  3ZZI A;  2BNE A;  2W21 A;  3K52 A;  2RD5 A;  2BMU A;  2BTY A;  4AXS A;  2JI5 A;  4A7X A;  2A1F A;  3ZZF A;  3B8G A;  3TM5 A;  4KR9 A;  3EK6 A;  1ZVP A;  2OGX A;  2VA1 A;  3KZF A;  2R98 A;  2BNF A; 
#chains in the Genus database with same CATH homology
 3TVI A;  3ZZG A;  1GSJ A;  2J5V A;  4NDQ A;  4OLC A;  4F6T B;  2X2W A;  3LL5 A;  4KR6 A;  3TM4 A;  3K0B A;  4KZT A;  3LL9 A;  3V8V A;  1ZHV A;  3K4O A;  4AB7 A;  3S6H A;  3S6G A;  4JZ7 A;  3AAW A;  3QUN A;  1OHA A;  2E9Y A;  4NDP B;  2C5S A;  2J0W A;  2WE4 A;  2J0X A;  3C20 A;  2R8V A;  3LKK A;  2BRX A;  2CDQ A;  4NDO A;  4NDP A;  3LDU A;  1GS5 A;  4F6T A;  4Q1T A;  4NDQ B;  4NDR B;  2AKO A;  1B7B A;  3LDG A;  1OH9 A;  2J4J A;  2J4K A;  3D41 A;  3WWM A;  3QVF A;  4NDR A;  3TMA A;  2BRI A;  2BUF A;  2OGX B;  4NDO B;  3D2M A;  3S6K A;  4I49 A;  3C1N A;  3AB2 A;  1Z9D A;  3ZZH A;  1OHB A;  3D2P A;  3WWN A;  3C1M A;  2J4L A;  3AB4 A;  3K56 A;  4JZ9 A;  2F06 A;  3EK5 A;  3QUR A;  4USJ A;  2IJ9 A;  2V5H A;  3K4Y A;  3L76 A;  3U6U A;  1E19 A;  3D40 A;  3T7B A;  3NWY A;  3QUO A;  2WXB A;  2JJ4 A;  4A7W A;  2J5T A;  3QVH A;  2V4Y A;  3TLJ A;  3L86 A;  2WE5 A;  2HMF A;  4JZ8 A;  3V97 A;  2JJX A;  4KR7 A;  1YBD A;  2AP9 A;  2BND A;  3ZZI A;  2BNE A;  2W21 A;  3K52 A;  2RD5 A;  2BMU A;  2BTY A;  4AXS A;  2JI5 A;  4A7X A;  2A1F A;  3ZZF A;  3B8G A;  3TM5 A;  4KR9 A;  3EK6 A;  1ZVP A;  2OGX A;  2VA1 A;  3KZF A;  2R98 A;  2BNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...