3C1MA

Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
469
structure length
465
Chain Sequence
b'TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable aspartokinase
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 160
structure length 465
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c1mA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c1mA01
1ZVPA 1OHAA 3QVHA 4Q1TA 1GS5A 2AKOA 3T7BA 2V4YA 4JZ8A 3LL5A 4USJA 4F6TB 2J4JA 3NWYA 3AAWA 3C1NA 4NDPA 1B7BA 3EK5A 4JZ9A 4JZ7A 3K4YA 4A7XA 3K56A 4NDRA 3ZZFA 1OHBA 2A1FA 2IJ9A 2AP9A 2WE5A 3EK6A 3C1MA 1Z9DA 3QURA 3LL9A 3WWMA 3QUOA 1ZHVA 3D2PA 2BUFA 3KZFA 3QVFA 3B8GA 4NDPB 4OLCA 4A7WA 3D40A 2BRIA 2OGXA 4NDQA 4AXSA 4NDRB 2J5VA 2V5HA 3L86A 4NDOA 2J4KA 2J0XA 3AB2A 3ZZHA 1GSJA 4I49A 3WWNA 3D41A 2HMFA 3QUNA 2CDQA 3U6UA 1E19A 2VA1A 3S6KA 2WXBA 2JI5A 2OGXB 4NDQB 2JJ4A 3LKKA 3L76A 1YBDA 3C20A 1OH9A 4NDOB 2BNFA 2W21A 3D2MA 3S6HA 2F06A 2WE4A 3ZZGA 2BNDA 3ZZIA 2BMUA 4AB7A 3K4OA 2RD5A 2R8VA 2BRXA 4F6TA 2J4LA 2BTYA 2E9YA 2X2WA 3S6GA 3AB4A 3K52A 2J5TA 2J0WA 2JJXA 2R98A 4KZTA 3TVIA 2BNEA
chains in the Genus database with same CATH superfamily
1ZVPA 1OHAA 3QVHA 4Q1TA 1GS5A 4KR7A 2AKOA 3T7BA 2V4YA 4JZ8A 3LL5A 4USJA 4KR6A 4F6TB 3TLJA 2J4JA 3NWYA 3AAWA 3C1NA 4NDPA 1B7BA 3EK5A 4JZ9A 4JZ7A 3K4YA 4A7XA 3K56A 4NDRA 3ZZFA 1OHBA 2A1FA 2IJ9A 2AP9A 2WE5A 4KR9A 3EK6A 3C1MA 1Z9DA 3QURA 3LL9A 3WWMA 3QUOA 1ZHVA 3D2PA 2BUFA 3KZFA 3QVFA 3B8GA 4NDPB 4OLCA 4A7WA 3D40A 2BRIA 2OGXA 4NDQA 4AXSA 4NDRB 2J5VA 2V5HA 3L86A 4NDOA 2J4KA 2J0XA 3AB2A 3ZZHA 3TMAA 1GSJA 4I49A 2C5SA 3TM5A 3V8VA 3WWNA 3LDUA 3D41A 2HMFA 3QUNA 2CDQA 3U6UA 1E19A 2VA1A 3S6KA 2WXBA 2JI5A 2OGXB 4NDQB 2JJ4A 3LKKA 3L76A 3V97A 1YBDA 3C20A 1OH9A 4NDOB 2BNFA 2W21A 3D2MA 3S6HA 2F06A 2WE4A 3ZZGA 2BNDA 3ZZIA 2BMUA 4AB7A 3K4OA 2RD5A 2R8VA 2BRXA 4F6TA 2J4LA 2BTYA 2E9YA 2X2WA 3S6GA 3TM4A 3AB4A 3K0BA 3K52A 2J5TA 2J0WA 2JJXA 2R98A 4KZTA 3TVIA 3LDGA 2BNEA
chains in the Genus database with same CATH topology
1ZVPA 1OHAA 3QVHA 4Q1TA 1GS5A 4KR7A 2AKOA 3T7BA 2V4YA 4JZ8A 3LL5A 4USJA 4KR6A 4F6TB 3TLJA 2J4JA 3NWYA 3AAWA 3C1NA 4NDPA 1B7BA 3EK5A 4JZ9A 4JZ7A 3K4YA 4A7XA 3K56A 4NDRA 3ZZFA 1OHBA 2A1FA 2IJ9A 2AP9A 2WE5A 4KR9A 3EK6A 3C1MA 1Z9DA 3QURA 3LL9A 3WWMA 3QUOA 1ZHVA 3D2PA 2BUFA 3KZFA 3QVFA 3B8GA 4NDPB 4OLCA 4A7WA 3D40A 2BRIA 2OGXA 4NDQA 4AXSA 4NDRB 2J5VA 2V5HA 3L86A 4NDOA 2J4KA 2J0XA 3AB2A 3ZZHA 3TMAA 1GSJA 4I49A 2C5SA 3TM5A 3V8VA 3WWNA 3LDUA 3D41A 2HMFA 3QUNA 2CDQA 3U6UA 1E19A 2VA1A 3S6KA 2WXBA 2JI5A 2OGXB 4NDQB 2JJ4A 3LKKA 3L76A 3V97A 1YBDA 3C20A 1OH9A 4NDOB 2BNFA 2W21A 3D2MA 3S6HA 2F06A 2WE4A 3ZZGA 2BNDA 3ZZIA 2BMUA 4AB7A 3K4OA 2RD5A 2R8VA 2BRXA 4F6TA 2J4LA 2BTYA 2E9YA 2X2WA 3S6GA 3TM4A 3AB4A 3K0BA 3K52A 2J5TA 2J0WA 2JJXA 2R98A 4KZTA 3TVIA 3LDGA 2BNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVP A;  1OHA A;  3QVH A;  4Q1T A;  1GS5 A;  2AKO A;  3T7B A;  2V4Y A;  4JZ8 A;  3LL5 A;  4USJ A;  4F6T B;  2J4J A;  3NWY A;  3AAW A;  3C1N A;  4NDP A;  1B7B A;  3EK5 A;  4JZ9 A;  4JZ7 A;  3K4Y A;  4A7X A;  3K56 A;  4NDR A;  3ZZF A;  1OHB A;  2A1F A;  2IJ9 A;  2AP9 A;  2WE5 A;  3EK6 A;  3C1M A;  1Z9D A;  3QUR A;  3LL9 A;  3WWM A;  3QUO A;  1ZHV A;  3D2P A;  2BUF A;  3KZF A;  3QVF A;  3B8G A;  4NDP B;  4OLC A;  4A7W A;  3D40 A;  2BRI A;  2OGX A;  4NDQ A;  4AXS A;  4NDR B;  2J5V A;  2V5H A;  3L86 A;  4NDO A;  2J4K A;  2J0X A;  3AB2 A;  3ZZH A;  1GSJ A;  4I49 A;  3WWN A;  3D41 A;  2HMF A;  3QUN A;  2CDQ A;  3U6U A;  1E19 A;  2VA1 A;  3S6K A;  2WXB A;  2JI5 A;  2OGX B;  4NDQ B;  2JJ4 A;  3LKK A;  3L76 A;  1YBD A;  3C20 A;  1OH9 A;  4NDO B;  2BNF A;  2W21 A;  3D2M A;  3S6H A;  2F06 A;  2WE4 A;  3ZZG A;  2BND A;  3ZZI A;  2BMU A;  4AB7 A;  3K4O A;  2RD5 A;  2R8V A;  2BRX A;  4F6T A;  2J4L A;  2BTY A;  2E9Y A;  2X2W A;  3S6G A;  3AB4 A;  3K52 A;  2J5T A;  2J0W A;  2JJX A;  2R98 A;  4KZT A;  3TVI A;  2BNE A; 
#chains in the Genus database with same CATH topology
 1ZVP A;  1OHA A;  3QVH A;  4Q1T A;  1GS5 A;  4KR7 A;  2AKO A;  3T7B A;  2V4Y A;  4JZ8 A;  3LL5 A;  4USJ A;  4KR6 A;  4F6T B;  3TLJ A;  2J4J A;  3NWY A;  3AAW A;  3C1N A;  4NDP A;  1B7B A;  3EK5 A;  4JZ9 A;  4JZ7 A;  3K4Y A;  4A7X A;  3K56 A;  4NDR A;  3ZZF A;  1OHB A;  2A1F A;  2IJ9 A;  2AP9 A;  2WE5 A;  4KR9 A;  3EK6 A;  3C1M A;  1Z9D A;  3QUR A;  3LL9 A;  3WWM A;  3QUO A;  1ZHV A;  3D2P A;  2BUF A;  3KZF A;  3QVF A;  3B8G A;  4NDP B;  4OLC A;  4A7W A;  3D40 A;  2BRI A;  2OGX A;  4NDQ A;  4AXS A;  4NDR B;  2J5V A;  2V5H A;  3L86 A;  4NDO A;  2J4K A;  2J0X A;  3AB2 A;  3ZZH A;  3TMA A;  1GSJ A;  4I49 A;  2C5S A;  3TM5 A;  3V8V A;  3WWN A;  3LDU A;  3D41 A;  2HMF A;  3QUN A;  2CDQ A;  3U6U A;  1E19 A;  2VA1 A;  3S6K A;  2WXB A;  2JI5 A;  2OGX B;  4NDQ B;  2JJ4 A;  3LKK A;  3L76 A;  3V97 A;  1YBD A;  3C20 A;  1OH9 A;  4NDO B;  2BNF A;  2W21 A;  3D2M A;  3S6H A;  2F06 A;  2WE4 A;  3ZZG A;  2BND A;  3ZZI A;  2BMU A;  4AB7 A;  3K4O A;  2RD5 A;  2R8V A;  2BRX A;  4F6T A;  2J4L A;  2BTY A;  2E9Y A;  2X2W A;  3S6G A;  3TM4 A;  3AB4 A;  3K0B A;  3K52 A;  2J5T A;  2J0W A;  2JJX A;  2R98 A;  4KZT A;  3TVI A;  3LDG A;  2BNE A; 
#chains in the Genus database with same CATH homology
 1ZVP A;  1OHA A;  3QVH A;  4Q1T A;  1GS5 A;  4KR7 A;  2AKO A;  3T7B A;  2V4Y A;  4JZ8 A;  3LL5 A;  4USJ A;  4KR6 A;  4F6T B;  3TLJ A;  2J4J A;  3NWY A;  3AAW A;  3C1N A;  4NDP A;  1B7B A;  3EK5 A;  4JZ9 A;  4JZ7 A;  3K4Y A;  4A7X A;  3K56 A;  4NDR A;  3ZZF A;  1OHB A;  2A1F A;  2IJ9 A;  2AP9 A;  2WE5 A;  4KR9 A;  3EK6 A;  3C1M A;  1Z9D A;  3QUR A;  3LL9 A;  3WWM A;  3QUO A;  1ZHV A;  3D2P A;  2BUF A;  3KZF A;  3QVF A;  3B8G A;  4NDP B;  4OLC A;  4A7W A;  3D40 A;  2BRI A;  2OGX A;  4NDQ A;  4AXS A;  4NDR B;  2J5V A;  2V5H A;  3L86 A;  4NDO A;  2J4K A;  2J0X A;  3AB2 A;  3ZZH A;  3TMA A;  1GSJ A;  4I49 A;  2C5S A;  3TM5 A;  3V8V A;  3WWN A;  3LDU A;  3D41 A;  2HMF A;  3QUN A;  2CDQ A;  3U6U A;  1E19 A;  2VA1 A;  3S6K A;  2WXB A;  2JI5 A;  2OGX B;  4NDQ B;  2JJ4 A;  3LKK A;  3L76 A;  3V97 A;  1YBD A;  3C20 A;  1OH9 A;  4NDO B;  2BNF A;  2W21 A;  3D2M A;  3S6H A;  2F06 A;  2WE4 A;  3ZZG A;  2BND A;  3ZZI A;  2BMU A;  4AB7 A;  3K4O A;  2RD5 A;  2R8V A;  2BRX A;  4F6T A;  2J4L A;  2BTY A;  2E9Y A;  2X2W A;  3S6G A;  3TM4 A;  3AB4 A;  3K0B A;  3K52 A;  2J5T A;  2J0W A;  2JJX A;  2R98 A;  4KZT A;  3TVI A;  3LDG A;  2BNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...