3C1MA

Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
469
structure length
465
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable aspartokinase
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 160
structure length 465
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c1mA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c1mA01
4NDOA 2BRXA 2BNEA 3LKKA 2X2WA 3QURA 2BNDA 1OHAA 3AB4A 2BMUA 2IJ9A 2J0WA 3K52A 1GSJA 3ZZFA 2WE5A 3AB2A 2J5TA 3AAWA 2WXBA 4NDPA 3ZZHA 1YBDA 4OLCA 2BUFA 2AP9A 2R98A 4F6TA 4JZ8A 3D41A 3U6UA 2VA1A 2R8VA 4NDQB 4NDOB 3K4YA 2OGXA 1OH9A 3D40A 2BRIA 4KZTA 3TVIA 3LL5A 1B7BA 3S6HA 2V4YA 3K56A 4Q1TA 2J0XA 3L76A 4F6TB 3K4OA 2JI5A 2CDQA 4AXSA 3QUOA 3C1MA 4I49A 2OGXB 3LL9A 2F06A 3WWNA 4JZ9A 1ZVPA 3EK5A 3ZZGA 3B8GA 3NWYA 3QVHA 3T7BA 2V5HA 2J4KA 4NDRA 1E19A 2A1FA 4NDPB 2J4JA 3S6KA 3L86A 3D2PA 2J5VA 4JZ7A 1Z9DA 3C20A 2HMFA 1GS5A 1OHBA 3WWMA 2J4LA 3D2MA 2BNFA 3EK6A 2JJXA 2BTYA 3KZFA 4NDQA 2W21A 2AKOA 3S6GA 4A7XA 3ZZIA 4NDRB 2E9YA 3C1NA 4USJA 4A7WA 2WE4A 4AB7A 1ZHVA 2JJ4A 3QVFA 2RD5A 3QUNA
chains in the Genus database with same CATH superfamily
4NDOA 2BRXA 2BNEA 3LKKA 2X2WA 3QURA 2BNDA 3TLJA 3AB4A 1OHAA 2BMUA 2IJ9A 2J0WA 3K52A 1GSJA 3ZZFA 2WE5A 3AB2A 2J5TA 3AAWA 2WXBA 4NDPA 3ZZHA 4KR6A 1YBDA 4OLCA 2BUFA 2AP9A 2R98A 4F6TA 4JZ8A 3D41A 3U6UA 2VA1A 2R8VA 4NDQB 4NDOB 2OGXA 3K4YA 4KR7A 1OH9A 3D40A 2BRIA 4KZTA 3TVIA 3LL5A 1B7BA 3S6HA 2V4YA 3K56A 4Q1TA 2J0XA 3L76A 2C5SA 4F6TB 3K4OA 2JI5A 2CDQA 4AXSA 3QUOA 3C1MA 4I49A 3V97A 2OGXB 3LL9A 3TMAA 2F06A 3WWNA 4JZ9A 3TM5A 1ZVPA 3EK5A 3ZZGA 3B8GA 3NWYA 3QVHA 3T7BA 2V5HA 2J4KA 3TM4A 4NDRA 1E19A 2A1FA 4NDPB 2J4JA 3S6KA 3L86A 3D2PA 2J5VA 4JZ7A 1Z9DA 3C20A 2HMFA 1GS5A 1OHBA 3WWMA 4KR9A 2J4LA 3D2MA 2BNFA 3EK6A 2JJXA 2BTYA 3KZFA 4NDQA 2W21A 2AKOA 3V8VA 3S6GA 4A7XA 3ZZIA 4NDRB 2E9YA 3C1NA 4USJA 4A7WA 2WE4A 3K0BA 4AB7A 1ZHVA 2JJ4A 3QVFA 3LDUA 3LDGA 2RD5A 3QUNA
chains in the Genus database with same CATH topology
4NDOA 2BRXA 2BNEA 3LKKA 2X2WA 3QURA 2BNDA 3TLJA 3AB4A 1OHAA 2BMUA 2IJ9A 2J0WA 3K52A 1GSJA 3ZZFA 2WE5A 3AB2A 2J5TA 3AAWA 2WXBA 4NDPA 3ZZHA 4KR6A 1YBDA 4OLCA 2BUFA 2AP9A 2R98A 4F6TA 4JZ8A 3D41A 3U6UA 2VA1A 2R8VA 4NDQB 4NDOB 2OGXA 3K4YA 4KR7A 1OH9A 3D40A 2BRIA 4KZTA 3TVIA 3LL5A 1B7BA 3S6HA 2V4YA 3K56A 4Q1TA 2J0XA 3L76A 2C5SA 4F6TB 3K4OA 2JI5A 2CDQA 4AXSA 3QUOA 3C1MA 4I49A 3V97A 2OGXB 3LL9A 3TMAA 2F06A 3WWNA 4JZ9A 3TM5A 1ZVPA 3EK5A 3ZZGA 3B8GA 3NWYA 3QVHA 3T7BA 2V5HA 2J4KA 3TM4A 4NDRA 1E19A 2A1FA 4NDPB 2J4JA 3S6KA 3L86A 3D2PA 2J5VA 4JZ7A 1Z9DA 3C20A 2HMFA 1GS5A 1OHBA 3WWMA 4KR9A 2J4LA 3D2MA 2BNFA 3EK6A 2JJXA 2BTYA 3KZFA 4NDQA 2W21A 2AKOA 3V8VA 3S6GA 4A7XA 3ZZIA 4NDRB 2E9YA 3C1NA 4USJA 4A7WA 2WE4A 3K0BA 4AB7A 1ZHVA 2JJ4A 3QVFA 3LDUA 3LDGA 2RD5A 3QUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDO A;  2BRX A;  2BNE A;  3LKK A;  2X2W A;  3QUR A;  2BND A;  1OHA A;  3AB4 A;  2BMU A;  2IJ9 A;  2J0W A;  3K52 A;  1GSJ A;  3ZZF A;  2WE5 A;  3AB2 A;  2J5T A;  3AAW A;  2WXB A;  4NDP A;  3ZZH A;  1YBD A;  4OLC A;  2BUF A;  2AP9 A;  2R98 A;  4F6T A;  4JZ8 A;  3D41 A;  3U6U A;  2VA1 A;  2R8V A;  4NDQ B;  4NDO B;  3K4Y A;  2OGX A;  1OH9 A;  3D40 A;  2BRI A;  4KZT A;  3TVI A;  3LL5 A;  1B7B A;  3S6H A;  2V4Y A;  3K56 A;  4Q1T A;  2J0X A;  3L76 A;  4F6T B;  3K4O A;  2JI5 A;  2CDQ A;  4AXS A;  3QUO A;  3C1M A;  4I49 A;  2OGX B;  3LL9 A;  2F06 A;  3WWN A;  4JZ9 A;  1ZVP A;  3EK5 A;  3ZZG A;  3B8G A;  3NWY A;  3QVH A;  3T7B A;  2V5H A;  2J4K A;  4NDR A;  1E19 A;  2A1F A;  4NDP B;  2J4J A;  3S6K A;  3L86 A;  3D2P A;  2J5V A;  4JZ7 A;  1Z9D A;  3C20 A;  2HMF A;  1GS5 A;  1OHB A;  3WWM A;  2J4L A;  3D2M A;  2BNF A;  3EK6 A;  2JJX A;  2BTY A;  3KZF A;  4NDQ A;  2W21 A;  2AKO A;  3S6G A;  4A7X A;  3ZZI A;  4NDR B;  2E9Y A;  3C1N A;  4USJ A;  4A7W A;  2WE4 A;  4AB7 A;  1ZHV A;  2JJ4 A;  3QVF A;  2RD5 A;  3QUN A; 
#chains in the Genus database with same CATH topology
 4NDO A;  2BRX A;  2BNE A;  3LKK A;  2X2W A;  3QUR A;  2BND A;  3TLJ A;  3AB4 A;  1OHA A;  2BMU A;  2IJ9 A;  2J0W A;  3K52 A;  1GSJ A;  3ZZF A;  2WE5 A;  3AB2 A;  2J5T A;  3AAW A;  2WXB A;  4NDP A;  3ZZH A;  4KR6 A;  1YBD A;  4OLC A;  2BUF A;  2AP9 A;  2R98 A;  4F6T A;  4JZ8 A;  3D41 A;  3U6U A;  2VA1 A;  2R8V A;  4NDQ B;  4NDO B;  2OGX A;  3K4Y A;  4KR7 A;  1OH9 A;  3D40 A;  2BRI A;  4KZT A;  3TVI A;  3LL5 A;  1B7B A;  3S6H A;  2V4Y A;  3K56 A;  4Q1T A;  2J0X A;  3L76 A;  2C5S A;  4F6T B;  3K4O A;  2JI5 A;  2CDQ A;  4AXS A;  3QUO A;  3C1M A;  4I49 A;  3V97 A;  2OGX B;  3LL9 A;  3TMA A;  2F06 A;  3WWN A;  4JZ9 A;  3TM5 A;  1ZVP A;  3EK5 A;  3ZZG A;  3B8G A;  3NWY A;  3QVH A;  3T7B A;  2V5H A;  2J4K A;  3TM4 A;  4NDR A;  1E19 A;  2A1F A;  4NDP B;  2J4J A;  3S6K A;  3L86 A;  3D2P A;  2J5V A;  4JZ7 A;  1Z9D A;  3C20 A;  2HMF A;  1GS5 A;  1OHB A;  3WWM A;  4KR9 A;  2J4L A;  3D2M A;  2BNF A;  3EK6 A;  2JJX A;  2BTY A;  3KZF A;  4NDQ A;  2W21 A;  2AKO A;  3V8V A;  3S6G A;  4A7X A;  3ZZI A;  4NDR B;  2E9Y A;  3C1N A;  4USJ A;  4A7W A;  2WE4 A;  3K0B A;  4AB7 A;  1ZHV A;  2JJ4 A;  3QVF A;  3LDU A;  3LDG A;  2RD5 A;  3QUN A; 
#chains in the Genus database with same CATH homology
 4NDO A;  2BRX A;  2BNE A;  3LKK A;  2X2W A;  3QUR A;  2BND A;  3TLJ A;  3AB4 A;  1OHA A;  2BMU A;  2IJ9 A;  2J0W A;  3K52 A;  1GSJ A;  3ZZF A;  2WE5 A;  3AB2 A;  2J5T A;  3AAW A;  2WXB A;  4NDP A;  3ZZH A;  4KR6 A;  1YBD A;  4OLC A;  2BUF A;  2AP9 A;  2R98 A;  4F6T A;  4JZ8 A;  3D41 A;  3U6U A;  2VA1 A;  2R8V A;  4NDQ B;  4NDO B;  2OGX A;  3K4Y A;  4KR7 A;  1OH9 A;  3D40 A;  2BRI A;  4KZT A;  3TVI A;  3LL5 A;  1B7B A;  3S6H A;  2V4Y A;  3K56 A;  4Q1T A;  2J0X A;  3L76 A;  2C5S A;  4F6T B;  3K4O A;  2JI5 A;  2CDQ A;  4AXS A;  3QUO A;  3C1M A;  4I49 A;  3V97 A;  2OGX B;  3LL9 A;  3TMA A;  2F06 A;  3WWN A;  4JZ9 A;  3TM5 A;  1ZVP A;  3EK5 A;  3ZZG A;  3B8G A;  3NWY A;  3QVH A;  3T7B A;  2V5H A;  2J4K A;  3TM4 A;  4NDR A;  1E19 A;  2A1F A;  4NDP B;  2J4J A;  3S6K A;  3L86 A;  3D2P A;  2J5V A;  4JZ7 A;  1Z9D A;  3C20 A;  2HMF A;  1GS5 A;  1OHB A;  3WWM A;  4KR9 A;  2J4L A;  3D2M A;  2BNF A;  3EK6 A;  2JJX A;  2BTY A;  3KZF A;  4NDQ A;  2W21 A;  2AKO A;  3V8V A;  3S6G A;  4A7X A;  3ZZI A;  4NDR B;  2E9Y A;  3C1N A;  4USJ A;  4A7W A;  2WE4 A;  3K0B A;  4AB7 A;  1ZHV A;  2JJ4 A;  3QVF A;  3LDU A;  3LDG A;  2RD5 A;  3QUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...