3C1MA

Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
469
structure length
465
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable aspartokinase
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 160
structure length 465
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c1mA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c1mA01
3QUOA 2WXBA 2J0XA 2J4LA 3NWYA 1OHBA 2W21A 3QVFA 3ZZHA 3D41A 4NDQA 3ZZFA 4USJA 3QVHA 1GS5A 4F6TA 3AAWA 3D40A 4OLCA 2JI5A 2RD5A 4NDPA 2BTYA 3U6UA 2BNDA 3C1NA 4NDRA 4I49A 3K4OA 3TVIA 2BRXA 3C20A 1GSJA 3LL5A 4AXSA 3QUNA 2AKOA 2OGXB 4JZ9A 1ZVPA 3KZFA 4F6TB 1Z9DA 3EK5A 3S6HA 2V4YA 1OH9A 4JZ8A 3B8GA 2BNFA 2AP9A 2X2WA 4NDPB 3L86A 1ZHVA 2A1FA 4NDRB 3L76A 4AB7A 3K56A 2CDQA 2BUFA 2VA1A 2R8VA 3K4YA 2BMUA 2J5VA 3ZZIA 3D2MA 2BNEA 3S6GA 2E9YA 4NDOA 4NDQB 2J4JA 3WWMA 3QURA 1YBDA 2J0WA 4A7XA 2JJXA 2F06A 4JZ7A 2J4KA 2BRIA 2WE5A 2JJ4A 3LL9A 3AB4A 4Q1TA 3ZZGA 1OHAA 3EK6A 1E19A 2OGXA 4KZTA 2HMFA 2WE4A 3K52A 3AB2A 2R98A 3D2PA 3S6KA 3C1MA 2IJ9A 3LKKA 4NDOB 2V5HA 3WWNA 1B7BA 2J5TA 3T7BA 4A7WA
chains in the Genus database with same CATH superfamily
3LDGA 3QUOA 2WXBA 2J0XA 2J4LA 3NWYA 1OHBA 2W21A 3QVFA 3ZZHA 3D41A 4NDQA 3ZZFA 4USJA 3QVHA 1GS5A 4F6TA 3AAWA 3D40A 4OLCA 2JI5A 2RD5A 4NDPA 2BTYA 3U6UA 2BNDA 3C1NA 4NDRA 4I49A 3TLJA 3K4OA 4KR6A 3TVIA 2BRXA 3C20A 3TM5A 3TMAA 3V97A 1GSJA 3LL5A 4AXSA 3QUNA 2AKOA 2OGXB 4JZ9A 1ZVPA 3KZFA 4F6TB 1Z9DA 3EK5A 3S6HA 2V4YA 1OH9A 2C5SA 4JZ8A 3B8GA 2BNFA 2AP9A 2X2WA 4NDPB 3L86A 1ZHVA 2A1FA 4NDRB 3L76A 4AB7A 3K56A 2CDQA 2BUFA 2VA1A 2R8VA 3K4YA 2BMUA 2J5VA 3ZZIA 3D2MA 2BNEA 3V8VA 3S6GA 2E9YA 4NDOA 4NDQB 2J4JA 3WWMA 3QURA 3TM4A 1YBDA 4KR9A 2J0WA 4A7XA 2JJXA 2F06A 4JZ7A 2J4KA 2BRIA 2WE5A 3K0BA 2JJ4A 3LL9A 3AB4A 4Q1TA 3ZZGA 1OHAA 3EK6A 1E19A 2OGXA 4KZTA 2HMFA 2WE4A 3K52A 3AB2A 2R98A 3D2PA 3S6KA 3C1MA 2IJ9A 3LKKA 3LDUA 4NDOB 2V5HA 3WWNA 1B7BA 4KR7A 2J5TA 3T7BA 4A7WA
chains in the Genus database with same CATH topology
3LDGA 3QUOA 2WXBA 2J0XA 2J4LA 3NWYA 1OHBA 2W21A 3QVFA 3ZZHA 3D41A 4NDQA 3ZZFA 4USJA 3QVHA 1GS5A 4F6TA 3AAWA 3D40A 4OLCA 2JI5A 2RD5A 4NDPA 2BTYA 3U6UA 2BNDA 3C1NA 4NDRA 4I49A 3TLJA 3K4OA 4KR6A 3TVIA 2BRXA 3C20A 3TM5A 3TMAA 3V97A 1GSJA 3LL5A 4AXSA 3QUNA 2AKOA 2OGXB 4JZ9A 1ZVPA 3KZFA 4F6TB 1Z9DA 3EK5A 3S6HA 2V4YA 1OH9A 2C5SA 4JZ8A 3B8GA 2BNFA 2AP9A 2X2WA 4NDPB 3L86A 1ZHVA 2A1FA 4NDRB 3L76A 4AB7A 3K56A 2CDQA 2BUFA 2VA1A 2R8VA 3K4YA 2BMUA 2J5VA 3ZZIA 3D2MA 2BNEA 3V8VA 3S6GA 2E9YA 4NDOA 4NDQB 2J4JA 3WWMA 3QURA 3TM4A 1YBDA 4KR9A 2J0WA 4A7XA 2JJXA 2F06A 4JZ7A 2J4KA 2BRIA 2WE5A 3K0BA 2JJ4A 3LL9A 3AB4A 4Q1TA 3ZZGA 1OHAA 3EK6A 1E19A 2OGXA 4KZTA 2HMFA 2WE4A 3K52A 3AB2A 2R98A 3D2PA 3S6KA 3C1MA 2IJ9A 3LKKA 3LDUA 4NDOB 2V5HA 3WWNA 1B7BA 4KR7A 2J5TA 3T7BA 4A7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QUO A;  2WXB A;  2J0X A;  2J4L A;  3NWY A;  1OHB A;  2W21 A;  3QVF A;  3ZZH A;  3D41 A;  4NDQ A;  3ZZF A;  4USJ A;  3QVH A;  1GS5 A;  4F6T A;  3AAW A;  3D40 A;  4OLC A;  2JI5 A;  2RD5 A;  4NDP A;  2BTY A;  3U6U A;  2BND A;  3C1N A;  4NDR A;  4I49 A;  3K4O A;  3TVI A;  2BRX A;  3C20 A;  1GSJ A;  3LL5 A;  4AXS A;  3QUN A;  2AKO A;  2OGX B;  4JZ9 A;  1ZVP A;  3KZF A;  4F6T B;  1Z9D A;  3EK5 A;  3S6H A;  2V4Y A;  1OH9 A;  4JZ8 A;  3B8G A;  2BNF A;  2AP9 A;  2X2W A;  4NDP B;  3L86 A;  1ZHV A;  2A1F A;  4NDR B;  3L76 A;  4AB7 A;  3K56 A;  2CDQ A;  2BUF A;  2VA1 A;  2R8V A;  3K4Y A;  2BMU A;  2J5V A;  3ZZI A;  3D2M A;  2BNE A;  3S6G A;  2E9Y A;  4NDO A;  4NDQ B;  2J4J A;  3WWM A;  3QUR A;  1YBD A;  2J0W A;  4A7X A;  2JJX A;  2F06 A;  4JZ7 A;  2J4K A;  2BRI A;  2WE5 A;  2JJ4 A;  3LL9 A;  3AB4 A;  4Q1T A;  3ZZG A;  1OHA A;  3EK6 A;  1E19 A;  2OGX A;  4KZT A;  2HMF A;  2WE4 A;  3K52 A;  3AB2 A;  2R98 A;  3D2P A;  3S6K A;  3C1M A;  2IJ9 A;  3LKK A;  4NDO B;  2V5H A;  3WWN A;  1B7B A;  2J5T A;  3T7B A;  4A7W A; 
#chains in the Genus database with same CATH topology
 3LDG A;  3QUO A;  2WXB A;  2J0X A;  2J4L A;  3NWY A;  1OHB A;  2W21 A;  3QVF A;  3ZZH A;  3D41 A;  4NDQ A;  3ZZF A;  4USJ A;  3QVH A;  1GS5 A;  4F6T A;  3AAW A;  3D40 A;  4OLC A;  2JI5 A;  2RD5 A;  4NDP A;  2BTY A;  3U6U A;  2BND A;  3C1N A;  4NDR A;  4I49 A;  3TLJ A;  3K4O A;  4KR6 A;  3TVI A;  2BRX A;  3C20 A;  3TM5 A;  3TMA A;  3V97 A;  1GSJ A;  3LL5 A;  4AXS A;  3QUN A;  2AKO A;  2OGX B;  4JZ9 A;  1ZVP A;  3KZF A;  4F6T B;  1Z9D A;  3EK5 A;  3S6H A;  2V4Y A;  1OH9 A;  2C5S A;  4JZ8 A;  3B8G A;  2BNF A;  2AP9 A;  2X2W A;  4NDP B;  3L86 A;  1ZHV A;  2A1F A;  4NDR B;  3L76 A;  4AB7 A;  3K56 A;  2CDQ A;  2BUF A;  2VA1 A;  2R8V A;  3K4Y A;  2BMU A;  2J5V A;  3ZZI A;  3D2M A;  2BNE A;  3V8V A;  3S6G A;  2E9Y A;  4NDO A;  4NDQ B;  2J4J A;  3WWM A;  3QUR A;  3TM4 A;  1YBD A;  4KR9 A;  2J0W A;  4A7X A;  2JJX A;  2F06 A;  4JZ7 A;  2J4K A;  2BRI A;  2WE5 A;  3K0B A;  2JJ4 A;  3LL9 A;  3AB4 A;  4Q1T A;  3ZZG A;  1OHA A;  3EK6 A;  1E19 A;  2OGX A;  4KZT A;  2HMF A;  2WE4 A;  3K52 A;  3AB2 A;  2R98 A;  3D2P A;  3S6K A;  3C1M A;  2IJ9 A;  3LKK A;  3LDU A;  4NDO B;  2V5H A;  3WWN A;  1B7B A;  4KR7 A;  2J5T A;  3T7B A;  4A7W A; 
#chains in the Genus database with same CATH homology
 3LDG A;  3QUO A;  2WXB A;  2J0X A;  2J4L A;  3NWY A;  1OHB A;  2W21 A;  3QVF A;  3ZZH A;  3D41 A;  4NDQ A;  3ZZF A;  4USJ A;  3QVH A;  1GS5 A;  4F6T A;  3AAW A;  3D40 A;  4OLC A;  2JI5 A;  2RD5 A;  4NDP A;  2BTY A;  3U6U A;  2BND A;  3C1N A;  4NDR A;  4I49 A;  3TLJ A;  3K4O A;  4KR6 A;  3TVI A;  2BRX A;  3C20 A;  3TM5 A;  3TMA A;  3V97 A;  1GSJ A;  3LL5 A;  4AXS A;  3QUN A;  2AKO A;  2OGX B;  4JZ9 A;  1ZVP A;  3KZF A;  4F6T B;  1Z9D A;  3EK5 A;  3S6H A;  2V4Y A;  1OH9 A;  2C5S A;  4JZ8 A;  3B8G A;  2BNF A;  2AP9 A;  2X2W A;  4NDP B;  3L86 A;  1ZHV A;  2A1F A;  4NDR B;  3L76 A;  4AB7 A;  3K56 A;  2CDQ A;  2BUF A;  2VA1 A;  2R8V A;  3K4Y A;  2BMU A;  2J5V A;  3ZZI A;  3D2M A;  2BNE A;  3V8V A;  3S6G A;  2E9Y A;  4NDO A;  4NDQ B;  2J4J A;  3WWM A;  3QUR A;  3TM4 A;  1YBD A;  4KR9 A;  2J0W A;  4A7X A;  2JJX A;  2F06 A;  4JZ7 A;  2J4K A;  2BRI A;  2WE5 A;  3K0B A;  2JJ4 A;  3LL9 A;  3AB4 A;  4Q1T A;  3ZZG A;  1OHA A;  3EK6 A;  1E19 A;  2OGX A;  4KZT A;  2HMF A;  2WE4 A;  3K52 A;  3AB2 A;  2R98 A;  3D2P A;  3S6K A;  3C1M A;  2IJ9 A;  3LKK A;  3LDU A;  4NDO B;  2V5H A;  3WWN A;  1B7B A;  4KR7 A;  2J5T A;  3T7B A;  4A7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...