3C1MA

Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
469
structure length
465
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDSFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable aspartokinase
publication title The Structural Basis for Allosteric Inhibition of a Threonine-sensitive Aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 160
structure length 465
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3c1mA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3c1mA01
2F06A 3K52A 4USJA 3U6UA 2WXBA 3QUNA 2BNFA 1ZVPA 3B8GA 3ZZHA 4JZ7A 3ZZGA 1B7BA 1ZHVA 1E19A 4NDPA 3D41A 1GS5A 2E9YA 2OGXB 2BUFA 2BMUA 3LL5A 3ZZIA 3WWNA 2A1FA 3K4YA 2WE5A 2J4JA 4F6TB 4KZTA 4A7WA 2JI5A 2JJ4A 2V5HA 1GSJA 2VA1A 4OLCA 2J5TA 4A7XA 4I49A 4NDQA 2J0WA 3QURA 2R98A 3LKKA 2RD5A 3QVHA 2R8VA 3C1MA 2X2WA 2HMFA 2J4LA 1OHAA 2AP9A 4NDPB 4NDRA 4AXSA 2BTYA 3K4OA 3QVFA 2IJ9A 3TVIA 1OHBA 4NDOA 3D2MA 3S6GA 4JZ9A 3C20A 1Z9DA 1OH9A 3QUOA 3EK5A 2WE4A 2J5VA 3S6HA 3C1NA 4NDQB 2J0XA 3ZZFA 2BNEA 3D40A 3AB4A 2JJXA 3L86A 2BNDA 2BRIA 4NDRB 3D2PA 3WWMA 2J4KA 3EK6A 3S6KA 3AAWA 4NDOB 2OGXA 2BRXA 3KZFA 3NWYA 4Q1TA 4AB7A 3T7BA 2W21A 3AB2A 2CDQA 3L76A 3LL9A 2V4YA 4F6TA 2AKOA 3K56A 4JZ8A 1YBDA
chains in the Genus database with same CATH superfamily
2F06A 3K52A 4USJA 4KR7A 3U6UA 2WXBA 3QUNA 2BNFA 1ZVPA 3B8GA 3ZZHA 4JZ7A 3ZZGA 1B7BA 1ZHVA 1E19A 4NDPA 3D41A 1GS5A 2E9YA 2OGXB 2BUFA 3TMAA 4KR9A 2BMUA 3LL5A 3ZZIA 3WWNA 2A1FA 3K4YA 2WE5A 2J4JA 4F6TB 4KZTA 4A7WA 2JI5A 2JJ4A 2V5HA 1GSJA 2VA1A 4OLCA 2J5TA 4A7XA 4I49A 4NDQA 2J0WA 3QURA 2R98A 3LKKA 2RD5A 3QVHA 2R8VA 3C1MA 2X2WA 2HMFA 2J4LA 3V8VA 3LDUA 4KR6A 1OHAA 2AP9A 4NDPB 4NDRA 4AXSA 2BTYA 3K4OA 3QVFA 2IJ9A 3TVIA 1OHBA 4NDOA 3D2MA 3S6GA 4JZ9A 3C20A 1Z9DA 1OH9A 3QUOA 3EK5A 2WE4A 2J5VA 3S6HA 3C1NA 3K0BA 4NDQB 2J0XA 3ZZFA 2BNEA 3D40A 3AB4A 2JJXA 3V97A 3L86A 2BNDA 2BRIA 4NDRB 3D2PA 3WWMA 3TLJA 2J4KA 3EK6A 3S6KA 2C5SA 3AAWA 4NDOB 2OGXA 3LDGA 2BRXA 3KZFA 3NWYA 4Q1TA 4AB7A 3T7BA 2W21A 3AB2A 2CDQA 3TM4A 3L76A 3LL9A 2V4YA 3TM5A 4F6TA 2AKOA 3K56A 4JZ8A 1YBDA
chains in the Genus database with same CATH topology
2F06A 3K52A 4USJA 4KR7A 3U6UA 2WXBA 3QUNA 2BNFA 1ZVPA 3B8GA 3ZZHA 4JZ7A 3ZZGA 1B7BA 1ZHVA 1E19A 4NDPA 3D41A 1GS5A 2E9YA 2OGXB 2BUFA 3TMAA 4KR9A 2BMUA 3LL5A 3ZZIA 3WWNA 2A1FA 3K4YA 2WE5A 2J4JA 4F6TB 4KZTA 4A7WA 2JI5A 2JJ4A 2V5HA 1GSJA 2VA1A 4OLCA 2J5TA 4A7XA 4I49A 4NDQA 2J0WA 3QURA 2R98A 3LKKA 2RD5A 3QVHA 2R8VA 3C1MA 2X2WA 2HMFA 2J4LA 3V8VA 3LDUA 4KR6A 1OHAA 2AP9A 4NDPB 4NDRA 4AXSA 2BTYA 3K4OA 3QVFA 2IJ9A 3TVIA 1OHBA 4NDOA 3D2MA 3S6GA 4JZ9A 3C20A 1Z9DA 1OH9A 3QUOA 3EK5A 2WE4A 2J5VA 3S6HA 3C1NA 3K0BA 4NDQB 2J0XA 3ZZFA 2BNEA 3D40A 3AB4A 2JJXA 3V97A 3L86A 2BNDA 2BRIA 4NDRB 3D2PA 3WWMA 3TLJA 2J4KA 3EK6A 3S6KA 2C5SA 3AAWA 4NDOB 2OGXA 3LDGA 2BRXA 3KZFA 3NWYA 4Q1TA 4AB7A 3T7BA 2W21A 3AB2A 2CDQA 3TM4A 3L76A 3LL9A 2V4YA 3TM5A 4F6TA 2AKOA 3K56A 4JZ8A 1YBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F06 A;  3K52 A;  4USJ A;  3U6U A;  2WXB A;  3QUN A;  2BNF A;  1ZVP A;  3B8G A;  3ZZH A;  4JZ7 A;  3ZZG A;  1B7B A;  1ZHV A;  1E19 A;  4NDP A;  3D41 A;  1GS5 A;  2E9Y A;  2OGX B;  2BUF A;  2BMU A;  3LL5 A;  3ZZI A;  3WWN A;  2A1F A;  3K4Y A;  2WE5 A;  2J4J A;  4F6T B;  4KZT A;  4A7W A;  2JI5 A;  2JJ4 A;  2V5H A;  1GSJ A;  2VA1 A;  4OLC A;  2J5T A;  4A7X A;  4I49 A;  4NDQ A;  2J0W A;  3QUR A;  2R98 A;  3LKK A;  2RD5 A;  3QVH A;  2R8V A;  3C1M A;  2X2W A;  2HMF A;  2J4L A;  1OHA A;  2AP9 A;  4NDP B;  4NDR A;  4AXS A;  2BTY A;  3K4O A;  3QVF A;  2IJ9 A;  3TVI A;  1OHB A;  4NDO A;  3D2M A;  3S6G A;  4JZ9 A;  3C20 A;  1Z9D A;  1OH9 A;  3QUO A;  3EK5 A;  2WE4 A;  2J5V A;  3S6H A;  3C1N A;  4NDQ B;  2J0X A;  3ZZF A;  2BNE A;  3D40 A;  3AB4 A;  2JJX A;  3L86 A;  2BND A;  2BRI A;  4NDR B;  3D2P A;  3WWM A;  2J4K A;  3EK6 A;  3S6K A;  3AAW A;  4NDO B;  2OGX A;  2BRX A;  3KZF A;  3NWY A;  4Q1T A;  4AB7 A;  3T7B A;  2W21 A;  3AB2 A;  2CDQ A;  3L76 A;  3LL9 A;  2V4Y A;  4F6T A;  2AKO A;  3K56 A;  4JZ8 A;  1YBD A; 
#chains in the Genus database with same CATH topology
 2F06 A;  3K52 A;  4USJ A;  4KR7 A;  3U6U A;  2WXB A;  3QUN A;  2BNF A;  1ZVP A;  3B8G A;  3ZZH A;  4JZ7 A;  3ZZG A;  1B7B A;  1ZHV A;  1E19 A;  4NDP A;  3D41 A;  1GS5 A;  2E9Y A;  2OGX B;  2BUF A;  3TMA A;  4KR9 A;  2BMU A;  3LL5 A;  3ZZI A;  3WWN A;  2A1F A;  3K4Y A;  2WE5 A;  2J4J A;  4F6T B;  4KZT A;  4A7W A;  2JI5 A;  2JJ4 A;  2V5H A;  1GSJ A;  2VA1 A;  4OLC A;  2J5T A;  4A7X A;  4I49 A;  4NDQ A;  2J0W A;  3QUR A;  2R98 A;  3LKK A;  2RD5 A;  3QVH A;  2R8V A;  3C1M A;  2X2W A;  2HMF A;  2J4L A;  3V8V A;  3LDU A;  4KR6 A;  1OHA A;  2AP9 A;  4NDP B;  4NDR A;  4AXS A;  2BTY A;  3K4O A;  3QVF A;  2IJ9 A;  3TVI A;  1OHB A;  4NDO A;  3D2M A;  3S6G A;  4JZ9 A;  3C20 A;  1Z9D A;  1OH9 A;  3QUO A;  3EK5 A;  2WE4 A;  2J5V A;  3S6H A;  3C1N A;  3K0B A;  4NDQ B;  2J0X A;  3ZZF A;  2BNE A;  3D40 A;  3AB4 A;  2JJX A;  3V97 A;  3L86 A;  2BND A;  2BRI A;  4NDR B;  3D2P A;  3WWM A;  3TLJ A;  2J4K A;  3EK6 A;  3S6K A;  2C5S A;  3AAW A;  4NDO B;  2OGX A;  3LDG A;  2BRX A;  3KZF A;  3NWY A;  4Q1T A;  4AB7 A;  3T7B A;  2W21 A;  3AB2 A;  2CDQ A;  3TM4 A;  3L76 A;  3LL9 A;  2V4Y A;  3TM5 A;  4F6T A;  2AKO A;  3K56 A;  4JZ8 A;  1YBD A; 
#chains in the Genus database with same CATH homology
 2F06 A;  3K52 A;  4USJ A;  4KR7 A;  3U6U A;  2WXB A;  3QUN A;  2BNF A;  1ZVP A;  3B8G A;  3ZZH A;  4JZ7 A;  3ZZG A;  1B7B A;  1ZHV A;  1E19 A;  4NDP A;  3D41 A;  1GS5 A;  2E9Y A;  2OGX B;  2BUF A;  3TMA A;  4KR9 A;  2BMU A;  3LL5 A;  3ZZI A;  3WWN A;  2A1F A;  3K4Y A;  2WE5 A;  2J4J A;  4F6T B;  4KZT A;  4A7W A;  2JI5 A;  2JJ4 A;  2V5H A;  1GSJ A;  2VA1 A;  4OLC A;  2J5T A;  4A7X A;  4I49 A;  4NDQ A;  2J0W A;  3QUR A;  2R98 A;  3LKK A;  2RD5 A;  3QVH A;  2R8V A;  3C1M A;  2X2W A;  2HMF A;  2J4L A;  3V8V A;  3LDU A;  4KR6 A;  1OHA A;  2AP9 A;  4NDP B;  4NDR A;  4AXS A;  2BTY A;  3K4O A;  3QVF A;  2IJ9 A;  3TVI A;  1OHB A;  4NDO A;  3D2M A;  3S6G A;  4JZ9 A;  3C20 A;  1Z9D A;  1OH9 A;  3QUO A;  3EK5 A;  2WE4 A;  2J5V A;  3S6H A;  3C1N A;  3K0B A;  4NDQ B;  2J0X A;  3ZZF A;  2BNE A;  3D40 A;  3AB4 A;  2JJX A;  3V97 A;  3L86 A;  2BND A;  2BRI A;  4NDR B;  3D2P A;  3WWM A;  3TLJ A;  2J4K A;  3EK6 A;  3S6K A;  2C5S A;  3AAW A;  4NDO B;  2OGX A;  3LDG A;  2BRX A;  3KZF A;  3NWY A;  4Q1T A;  4AB7 A;  3T7B A;  2W21 A;  3AB2 A;  2CDQ A;  3TM4 A;  3L76 A;  3LL9 A;  2V4Y A;  3TM5 A;  4F6T A;  2AKO A;  3K56 A;  4JZ8 A;  1YBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...