3TVIA

Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
435
structure length
429
Chain Sequence
IVVTKFGGSSLADSNQFKKVKGIIDSDANRKYIIPSAPGKRTNKDYKITDLLYLCNAHVKNGIPFDDVFKLISQRYTEIVSELNIDMDIAYYLEKVKKNIENGASSDYAASRGEYLNGVILAKYLNAEFIDAAEVIFFDKCFDEKKSYEKIKEKVLSCNKAVIPGFYGSSFNGDVKTFSRGGSDVTGSIISAGVNADLYENWTDVSGFLMADPRIVENPKTISKISYKELRELSYMLHEEAIFPVKDSGIPINIKNTNKPSDPGTLILSDTHKEINLGTITGIAGKKNFTVIAIEKALLNSEVGFCRKILSILEMYGVSFEHMPSGVDSVSLVIEDCKLDGKCDKIIEEIKKQCNPDSIEIHPNMALVATVGTGMAKTKGIANKIFTALSKENVNIRMIDQGSSEINVIVGVETVDFEKAVKSIYNAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartokinase
publication title Crystal structure of Clostridium acetobutylicum Aspartate kinase (CaAK): An important allosteric enzyme for amino acids production.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Transferase
total genus 128
structure length 429
sequence length 435
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3tviA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3tviA01
2R8VA 3LL5A 2BNDA 1ZVPA 2J5VA 3QVFA 2AP9A 3D40A 3C20A 3L76A 2J0WA 1B7BA 3WWMA 2A1FA 4A7XA 3QVHA 3QUNA 3WWNA 4Q1TA 3NWYA 3ZZHA 3AB4A 2BNFA 2BRIA 2WE5A 3C1NA 1YBDA 2CDQA 3D41A 3D2MA 2BMUA 2J5TA 1OHBA 2RD5A 2J0XA 2OGXB 3T7BA 4USJA 3QURA 4NDOB 2OGXA 4JZ9A 4NDOA 3K4OA 4NDRB 4OLCA 4NDPB 1E19A 2VA1A 4AXSA 2R98A 4NDRA 3AB2A 3C1MA 2BNEA 3LL9A 3U6UA 2JJXA 4NDQB 3KZFA 2JJ4A 2BUFA 2J4KA 2X2WA 4KZTA 4NDQA 4I49A 3EK5A 2AKOA 1OH9A 2E9YA 2WXBA 1ZHVA 3B8GA 3S6KA 3D2PA 3EK6A 2BRXA 3S6GA 1Z9DA 3ZZIA 3K56A 2V5HA 4AB7A 4A7WA 3K52A 4NDPA 1GS5A 2HMFA 2F06A 3TVIA 3QUOA 2BTYA 2J4LA 2JI5A 3S6HA 2IJ9A 3ZZFA 4F6TB 2J4JA 3ZZGA 4F6TA 3K4YA 4JZ8A 1OHAA 3LKKA 2W21A 3AAWA 1GSJA 2V4YA 2WE4A 3L86A 4JZ7A
chains in the Genus database with same CATH superfamily
3TMAA 2R8VA 3LL5A 2BNDA 1ZVPA 2J5VA 3TM5A 3QVFA 2AP9A 3D40A 3V8VA 3LDUA 3C20A 4KR9A 3L76A 2J0WA 1B7BA 3WWMA 2A1FA 4A7XA 3QVHA 3QUNA 3WWNA 4Q1TA 3V97A 4KR7A 3NWYA 3ZZHA 3AB4A 2BNFA 2BRIA 2WE5A 3C1NA 1YBDA 2CDQA 3D41A 3D2MA 2BMUA 2J5TA 1OHBA 2RD5A 2J0XA 2OGXB 3T7BA 4USJA 3QURA 2C5SA 3K0BA 4KR6A 4NDOB 2OGXA 4JZ9A 4NDOA 3K4OA 4NDRB 4OLCA 4NDPB 1E19A 2VA1A 4AXSA 2R98A 4NDRA 3AB2A 3C1MA 2BNEA 3LL9A 3U6UA 2JJXA 4NDQB 3KZFA 3TLJA 2JJ4A 2BUFA 2J4KA 2X2WA 3LDGA 4KZTA 4NDQA 4I49A 3EK5A 2AKOA 1OH9A 2E9YA 2WXBA 1ZHVA 3B8GA 3S6KA 3D2PA 3EK6A 3TM4A 2BRXA 3S6GA 1Z9DA 3ZZIA 3K56A 2V5HA 4AB7A 4A7WA 3K52A 4NDPA 1GS5A 2HMFA 2F06A 3TVIA 3QUOA 2BTYA 2J4LA 2JI5A 3S6HA 2IJ9A 3ZZFA 4F6TB 2J4JA 3ZZGA 4F6TA 3K4YA 4JZ8A 1OHAA 3LKKA 2W21A 3AAWA 1GSJA 2V4YA 2WE4A 3L86A 4JZ7A
chains in the Genus database with same CATH topology
3TMAA 2R8VA 3LL5A 2BNDA 1ZVPA 2J5VA 3TM5A 3QVFA 2AP9A 3D40A 3V8VA 3LDUA 3C20A 4KR9A 3L76A 2J0WA 1B7BA 3WWMA 2A1FA 4A7XA 3QVHA 3QUNA 3WWNA 4Q1TA 3V97A 4KR7A 3NWYA 3ZZHA 3AB4A 2BNFA 2BRIA 2WE5A 3C1NA 1YBDA 2CDQA 3D41A 3D2MA 2BMUA 2J5TA 1OHBA 2RD5A 2J0XA 2OGXB 3T7BA 4USJA 3QURA 2C5SA 3K0BA 4KR6A 4NDOB 2OGXA 4JZ9A 4NDOA 3K4OA 4NDRB 4OLCA 4NDPB 1E19A 2VA1A 4AXSA 2R98A 4NDRA 3AB2A 3C1MA 2BNEA 3LL9A 3U6UA 2JJXA 4NDQB 3KZFA 3TLJA 2JJ4A 2BUFA 2J4KA 2X2WA 3LDGA 4KZTA 4NDQA 4I49A 3EK5A 2AKOA 1OH9A 2E9YA 2WXBA 1ZHVA 3B8GA 3S6KA 3D2PA 3EK6A 3TM4A 2BRXA 3S6GA 1Z9DA 3ZZIA 3K56A 2V5HA 4AB7A 4A7WA 3K52A 4NDPA 1GS5A 2HMFA 2F06A 3TVIA 3QUOA 2BTYA 2J4LA 2JI5A 3S6HA 2IJ9A 3ZZFA 4F6TB 2J4JA 3ZZGA 4F6TA 3K4YA 4JZ8A 1OHAA 3LKKA 2W21A 3AAWA 1GSJA 2V4YA 2WE4A 3L86A 4JZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8V A;  3LL5 A;  2BND A;  1ZVP A;  2J5V A;  3QVF A;  2AP9 A;  3D40 A;  3C20 A;  3L76 A;  2J0W A;  1B7B A;  3WWM A;  2A1F A;  4A7X A;  3QVH A;  3QUN A;  3WWN A;  4Q1T A;  3NWY A;  3ZZH A;  3AB4 A;  2BNF A;  2BRI A;  2WE5 A;  3C1N A;  1YBD A;  2CDQ A;  3D41 A;  3D2M A;  2BMU A;  2J5T A;  1OHB A;  2RD5 A;  2J0X A;  2OGX B;  3T7B A;  4USJ A;  3QUR A;  4NDO B;  2OGX A;  4JZ9 A;  4NDO A;  3K4O A;  4NDR B;  4OLC A;  4NDP B;  1E19 A;  2VA1 A;  4AXS A;  2R98 A;  4NDR A;  3AB2 A;  3C1M A;  2BNE A;  3LL9 A;  3U6U A;  2JJX A;  4NDQ B;  3KZF A;  2JJ4 A;  2BUF A;  2J4K A;  2X2W A;  4KZT A;  4NDQ A;  4I49 A;  3EK5 A;  2AKO A;  1OH9 A;  2E9Y A;  2WXB A;  1ZHV A;  3B8G A;  3S6K A;  3D2P A;  3EK6 A;  2BRX A;  3S6G A;  1Z9D A;  3ZZI A;  3K56 A;  2V5H A;  4AB7 A;  4A7W A;  3K52 A;  4NDP A;  1GS5 A;  2HMF A;  2F06 A;  3TVI A;  3QUO A;  2BTY A;  2J4L A;  2JI5 A;  3S6H A;  2IJ9 A;  3ZZF A;  4F6T B;  2J4J A;  3ZZG A;  4F6T A;  3K4Y A;  4JZ8 A;  1OHA A;  3LKK A;  2W21 A;  3AAW A;  1GSJ A;  2V4Y A;  2WE4 A;  3L86 A;  4JZ7 A; 
#chains in the Genus database with same CATH topology
 3TMA A;  2R8V A;  3LL5 A;  2BND A;  1ZVP A;  2J5V A;  3TM5 A;  3QVF A;  2AP9 A;  3D40 A;  3V8V A;  3LDU A;  3C20 A;  4KR9 A;  3L76 A;  2J0W A;  1B7B A;  3WWM A;  2A1F A;  4A7X A;  3QVH A;  3QUN A;  3WWN A;  4Q1T A;  3V97 A;  4KR7 A;  3NWY A;  3ZZH A;  3AB4 A;  2BNF A;  2BRI A;  2WE5 A;  3C1N A;  1YBD A;  2CDQ A;  3D41 A;  3D2M A;  2BMU A;  2J5T A;  1OHB A;  2RD5 A;  2J0X A;  2OGX B;  3T7B A;  4USJ A;  3QUR A;  2C5S A;  3K0B A;  4KR6 A;  4NDO B;  2OGX A;  4JZ9 A;  4NDO A;  3K4O A;  4NDR B;  4OLC A;  4NDP B;  1E19 A;  2VA1 A;  4AXS A;  2R98 A;  4NDR A;  3AB2 A;  3C1M A;  2BNE A;  3LL9 A;  3U6U A;  2JJX A;  4NDQ B;  3KZF A;  3TLJ A;  2JJ4 A;  2BUF A;  2J4K A;  2X2W A;  3LDG A;  4KZT A;  4NDQ A;  4I49 A;  3EK5 A;  2AKO A;  1OH9 A;  2E9Y A;  2WXB A;  1ZHV A;  3B8G A;  3S6K A;  3D2P A;  3EK6 A;  3TM4 A;  2BRX A;  3S6G A;  1Z9D A;  3ZZI A;  3K56 A;  2V5H A;  4AB7 A;  4A7W A;  3K52 A;  4NDP A;  1GS5 A;  2HMF A;  2F06 A;  3TVI A;  3QUO A;  2BTY A;  2J4L A;  2JI5 A;  3S6H A;  2IJ9 A;  3ZZF A;  4F6T B;  2J4J A;  3ZZG A;  4F6T A;  3K4Y A;  4JZ8 A;  1OHA A;  3LKK A;  2W21 A;  3AAW A;  1GSJ A;  2V4Y A;  2WE4 A;  3L86 A;  4JZ7 A; 
#chains in the Genus database with same CATH homology
 3TMA A;  2R8V A;  3LL5 A;  2BND A;  1ZVP A;  2J5V A;  3TM5 A;  3QVF A;  2AP9 A;  3D40 A;  3V8V A;  3LDU A;  3C20 A;  4KR9 A;  3L76 A;  2J0W A;  1B7B A;  3WWM A;  2A1F A;  4A7X A;  3QVH A;  3QUN A;  3WWN A;  4Q1T A;  3V97 A;  4KR7 A;  3NWY A;  3ZZH A;  3AB4 A;  2BNF A;  2BRI A;  2WE5 A;  3C1N A;  1YBD A;  2CDQ A;  3D41 A;  3D2M A;  2BMU A;  2J5T A;  1OHB A;  2RD5 A;  2J0X A;  2OGX B;  3T7B A;  4USJ A;  3QUR A;  2C5S A;  3K0B A;  4KR6 A;  4NDO B;  2OGX A;  4JZ9 A;  4NDO A;  3K4O A;  4NDR B;  4OLC A;  4NDP B;  1E19 A;  2VA1 A;  4AXS A;  2R98 A;  4NDR A;  3AB2 A;  3C1M A;  2BNE A;  3LL9 A;  3U6U A;  2JJX A;  4NDQ B;  3KZF A;  3TLJ A;  2JJ4 A;  2BUF A;  2J4K A;  2X2W A;  3LDG A;  4KZT A;  4NDQ A;  4I49 A;  3EK5 A;  2AKO A;  1OH9 A;  2E9Y A;  2WXB A;  1ZHV A;  3B8G A;  3S6K A;  3D2P A;  3EK6 A;  3TM4 A;  2BRX A;  3S6G A;  1Z9D A;  3ZZI A;  3K56 A;  2V5H A;  4AB7 A;  4A7W A;  3K52 A;  4NDP A;  1GS5 A;  2HMF A;  2F06 A;  3TVI A;  3QUO A;  2BTY A;  2J4L A;  2JI5 A;  3S6H A;  2IJ9 A;  3ZZF A;  4F6T B;  2J4J A;  3ZZG A;  4F6T A;  3K4Y A;  4JZ8 A;  1OHA A;  3LKK A;  2W21 A;  3AAW A;  1GSJ A;  2V4Y A;  2WE4 A;  3L86 A;  4JZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...