3TVIA

Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
435
structure length
429
Chain Sequence
IVVTKFGGSSLADSNQFKKVKGIIDSDANRKYIIPSAPGKRTNKDYKITDLLYLCNAHVKNGIPFDDVFKLISQRYTEIVSELNIDMDIAYYLEKVKKNIENGASSDYAASRGEYLNGVILAKYLNAEFIDAAEVIFFDKCFDEKKSYEKIKEKVLSCNKAVIPGFYGSSFNGDVKTFSRGGSDVTGSIISAGVNADLYENWTDVSGFLMADPRIVENPKTISKISYKELRELSYMLHEEAIFPVKDSGIPINIKNTNKPSDPGTLILSDTHKEINLGTITGIAGKKNFTVIAIEKALLNSEVGFCRKILSILEMYGVSFEHMPSGVDSVSLVIEDCKLDGKCDKIIEEIKKQCNPDSIEIHPNMALVATVGTGMAKTKGIANKIFTALSKENVNIRMIDQGSSEINVIVGVETVDFEKAVKSIYNAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Clostridium acetobutylicum Aspartate kinase (CaAK): An important allosteric enzyme for amino acids production.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Transferase
molecule keywords Aspartokinase
total genus 128
structure length 429
sequence length 435
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3tviA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3tviA01
3K52A 4A7WA 2BNFA 4F6TA 3C1NA 2JJXA 4NDQA 4OLCA 1OH9A 3L86A 2BTYA 3L76A 4NDPA 2IJ9A 2BUFA 2J4LA 3EK6A 3K4OA 2CDQA 4F6TB 2A1FA 3ZZGA 2BMUA 2JI5A 4KZTA 2J5TA 3U6UA 2J0XA 3QVHA 1B7BA 3KZFA 3D2MA 3D41A 1YBDA 3D2PA 2R8VA 3AB4A 2HMFA 1OHAA 2W21A 2V5HA 3EK5A 4NDRB 2JJ4A 2OGXA 3QURA 2BRXA 2OGXB 3ZZFA 4NDRA 4NDOA 3QUNA 4Q1TA 3ZZIA 3C20A 3WWNA 2WE4A 2RD5A 2J0WA 2BNEA 4NDOB 4I49A 3WWMA 3S6HA 3C1MA 2BRIA 2J5VA 3LL5A 1ZHVA 2VA1A 2J4JA 4JZ8A 2E9YA 3ZZHA 4AB7A 3AB2A 2AP9A 3S6KA 1E19A 1GS5A 2F06A 1OHBA 3LL9A 2BNDA 4A7XA 4JZ7A 2X2WA 3TVIA 2WE5A 2V4YA 2AKOA 2R98A 3T7BA 2WXBA 3QUOA 3S6GA 1ZVPA 1Z9DA 4AXSA 3QVFA 3NWYA 3K4YA 3LKKA 3D40A 1GSJA 4NDQB 4JZ9A 2J4KA 3B8GA 3K56A 3AAWA 4NDPB 4USJA
chains in the Genus database with same CATH superfamily
3V97A 3K52A 4A7WA 3TMAA 3LDGA 2BNFA 4F6TA 3C1NA 2JJXA 4NDQA 4OLCA 1OH9A 3L86A 2BTYA 3L76A 4NDPA 2IJ9A 2BUFA 2J4LA 3EK6A 3K4OA 2CDQA 4F6TB 2A1FA 3ZZGA 3V8VA 2BMUA 2JI5A 4KZTA 2J5TA 3U6UA 2J0XA 3QVHA 3LDUA 1B7BA 3KZFA 3D2MA 3D41A 2C5SA 1YBDA 3D2PA 2R8VA 3AB4A 2HMFA 1OHAA 2W21A 2V5HA 3EK5A 4KR6A 3TLJA 4NDRB 2JJ4A 2OGXA 3QURA 2BRXA 2OGXB 3ZZFA 4NDRA 4NDOA 3QUNA 4Q1TA 3ZZIA 3C20A 3WWNA 2WE4A 3TM4A 4KR9A 2RD5A 4KR7A 2J0WA 2BNEA 4NDOB 4I49A 3WWMA 3S6HA 3C1MA 2BRIA 2J5VA 3LL5A 1ZHVA 2VA1A 2J4JA 4JZ8A 2E9YA 3ZZHA 4AB7A 3AB2A 2AP9A 3TM5A 3S6KA 1E19A 1GS5A 2F06A 1OHBA 3LL9A 2BNDA 4A7XA 4JZ7A 2X2WA 3TVIA 2WE5A 2V4YA 2AKOA 2R98A 3T7BA 2WXBA 3QUOA 3S6GA 1ZVPA 1Z9DA 4AXSA 3QVFA 3NWYA 3K4YA 3LKKA 3D40A 1GSJA 4NDQB 4JZ9A 2J4KA 3B8GA 3K56A 3AAWA 4NDPB 4USJA 3K0BA
chains in the Genus database with same CATH topology
3V97A 3K52A 4A7WA 3TMAA 3LDGA 2BNFA 4F6TA 3C1NA 2JJXA 4NDQA 4OLCA 1OH9A 3L86A 2BTYA 3L76A 4NDPA 2IJ9A 2BUFA 2J4LA 3EK6A 3K4OA 2CDQA 4F6TB 2A1FA 3ZZGA 3V8VA 2BMUA 2JI5A 4KZTA 2J5TA 3U6UA 2J0XA 3QVHA 3LDUA 1B7BA 3KZFA 3D2MA 3D41A 2C5SA 1YBDA 3D2PA 2R8VA 3AB4A 2HMFA 1OHAA 2W21A 2V5HA 3EK5A 4KR6A 3TLJA 4NDRB 2JJ4A 2OGXA 3QURA 2BRXA 2OGXB 3ZZFA 4NDRA 4NDOA 3QUNA 4Q1TA 3ZZIA 3C20A 3WWNA 2WE4A 3TM4A 4KR9A 2RD5A 4KR7A 2J0WA 2BNEA 4NDOB 4I49A 3WWMA 3S6HA 3C1MA 2BRIA 2J5VA 3LL5A 1ZHVA 2VA1A 2J4JA 4JZ8A 2E9YA 3ZZHA 4AB7A 3AB2A 2AP9A 3TM5A 3S6KA 1E19A 1GS5A 2F06A 1OHBA 3LL9A 2BNDA 4A7XA 4JZ7A 2X2WA 3TVIA 2WE5A 2V4YA 2AKOA 2R98A 3T7BA 2WXBA 3QUOA 3S6GA 1ZVPA 1Z9DA 4AXSA 3QVFA 3NWYA 3K4YA 3LKKA 3D40A 1GSJA 4NDQB 4JZ9A 2J4KA 3B8GA 3K56A 3AAWA 4NDPB 4USJA 3K0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K52 A;  4A7W A;  2BNF A;  4F6T A;  3C1N A;  2JJX A;  4NDQ A;  4OLC A;  1OH9 A;  3L86 A;  2BTY A;  3L76 A;  4NDP A;  2IJ9 A;  2BUF A;  2J4L A;  3EK6 A;  3K4O A;  2CDQ A;  4F6T B;  2A1F A;  3ZZG A;  2BMU A;  2JI5 A;  4KZT A;  2J5T A;  3U6U A;  2J0X A;  3QVH A;  1B7B A;  3KZF A;  3D2M A;  3D41 A;  1YBD A;  3D2P A;  2R8V A;  3AB4 A;  2HMF A;  1OHA A;  2W21 A;  2V5H A;  3EK5 A;  4NDR B;  2JJ4 A;  2OGX A;  3QUR A;  2BRX A;  2OGX B;  3ZZF A;  4NDR A;  4NDO A;  3QUN A;  4Q1T A;  3ZZI A;  3C20 A;  3WWN A;  2WE4 A;  2RD5 A;  2J0W A;  2BNE A;  4NDO B;  4I49 A;  3WWM A;  3S6H A;  3C1M A;  2BRI A;  2J5V A;  3LL5 A;  1ZHV A;  2VA1 A;  2J4J A;  4JZ8 A;  2E9Y A;  3ZZH A;  4AB7 A;  3AB2 A;  2AP9 A;  3S6K A;  1E19 A;  1GS5 A;  2F06 A;  1OHB A;  3LL9 A;  2BND A;  4A7X A;  4JZ7 A;  2X2W A;  3TVI A;  2WE5 A;  2V4Y A;  2AKO A;  2R98 A;  3T7B A;  2WXB A;  3QUO A;  3S6G A;  1ZVP A;  1Z9D A;  4AXS A;  3QVF A;  3NWY A;  3K4Y A;  3LKK A;  3D40 A;  1GSJ A;  4NDQ B;  4JZ9 A;  2J4K A;  3B8G A;  3K56 A;  3AAW A;  4NDP B;  4USJ A; 
#chains in the Genus database with same CATH topology
 3V97 A;  3K52 A;  4A7W A;  3TMA A;  3LDG A;  2BNF A;  4F6T A;  3C1N A;  2JJX A;  4NDQ A;  4OLC A;  1OH9 A;  3L86 A;  2BTY A;  3L76 A;  4NDP A;  2IJ9 A;  2BUF A;  2J4L A;  3EK6 A;  3K4O A;  2CDQ A;  4F6T B;  2A1F A;  3ZZG A;  3V8V A;  2BMU A;  2JI5 A;  4KZT A;  2J5T A;  3U6U A;  2J0X A;  3QVH A;  3LDU A;  1B7B A;  3KZF A;  3D2M A;  3D41 A;  2C5S A;  1YBD A;  3D2P A;  2R8V A;  3AB4 A;  2HMF A;  1OHA A;  2W21 A;  2V5H A;  3EK5 A;  4KR6 A;  3TLJ A;  4NDR B;  2JJ4 A;  2OGX A;  3QUR A;  2BRX A;  2OGX B;  3ZZF A;  4NDR A;  4NDO A;  3QUN A;  4Q1T A;  3ZZI A;  3C20 A;  3WWN A;  2WE4 A;  3TM4 A;  4KR9 A;  2RD5 A;  4KR7 A;  2J0W A;  2BNE A;  4NDO B;  4I49 A;  3WWM A;  3S6H A;  3C1M A;  2BRI A;  2J5V A;  3LL5 A;  1ZHV A;  2VA1 A;  2J4J A;  4JZ8 A;  2E9Y A;  3ZZH A;  4AB7 A;  3AB2 A;  2AP9 A;  3TM5 A;  3S6K A;  1E19 A;  1GS5 A;  2F06 A;  1OHB A;  3LL9 A;  2BND A;  4A7X A;  4JZ7 A;  2X2W A;  3TVI A;  2WE5 A;  2V4Y A;  2AKO A;  2R98 A;  3T7B A;  2WXB A;  3QUO A;  3S6G A;  1ZVP A;  1Z9D A;  4AXS A;  3QVF A;  3NWY A;  3K4Y A;  3LKK A;  3D40 A;  1GSJ A;  4NDQ B;  4JZ9 A;  2J4K A;  3B8G A;  3K56 A;  3AAW A;  4NDP B;  4USJ A;  3K0B A; 
#chains in the Genus database with same CATH homology
 3V97 A;  3K52 A;  4A7W A;  3TMA A;  3LDG A;  2BNF A;  4F6T A;  3C1N A;  2JJX A;  4NDQ A;  4OLC A;  1OH9 A;  3L86 A;  2BTY A;  3L76 A;  4NDP A;  2IJ9 A;  2BUF A;  2J4L A;  3EK6 A;  3K4O A;  2CDQ A;  4F6T B;  2A1F A;  3ZZG A;  3V8V A;  2BMU A;  2JI5 A;  4KZT A;  2J5T A;  3U6U A;  2J0X A;  3QVH A;  3LDU A;  1B7B A;  3KZF A;  3D2M A;  3D41 A;  2C5S A;  1YBD A;  3D2P A;  2R8V A;  3AB4 A;  2HMF A;  1OHA A;  2W21 A;  2V5H A;  3EK5 A;  4KR6 A;  3TLJ A;  4NDR B;  2JJ4 A;  2OGX A;  3QUR A;  2BRX A;  2OGX B;  3ZZF A;  4NDR A;  4NDO A;  3QUN A;  4Q1T A;  3ZZI A;  3C20 A;  3WWN A;  2WE4 A;  3TM4 A;  4KR9 A;  2RD5 A;  4KR7 A;  2J0W A;  2BNE A;  4NDO B;  4I49 A;  3WWM A;  3S6H A;  3C1M A;  2BRI A;  2J5V A;  3LL5 A;  1ZHV A;  2VA1 A;  2J4J A;  4JZ8 A;  2E9Y A;  3ZZH A;  4AB7 A;  3AB2 A;  2AP9 A;  3TM5 A;  3S6K A;  1E19 A;  1GS5 A;  2F06 A;  1OHB A;  3LL9 A;  2BND A;  4A7X A;  4JZ7 A;  2X2W A;  3TVI A;  2WE5 A;  2V4Y A;  2AKO A;  2R98 A;  3T7B A;  2WXB A;  3QUO A;  3S6G A;  1ZVP A;  1Z9D A;  4AXS A;  3QVF A;  3NWY A;  3K4Y A;  3LKK A;  3D40 A;  1GSJ A;  4NDQ B;  4JZ9 A;  2J4K A;  3B8G A;  3K56 A;  3AAW A;  4NDP B;  4USJ A;  3K0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...