3TVIA

Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
435
structure length
429
Chain Sequence
IVVTKFGGSSLADSNQFKKVKGIIDSDANRKYIIPSAPGKRTNKDYKITDLLYLCNAHVKNGIPFDDVFKLISQRYTEIVSELNIDMDIAYYLEKVKKNIENGASSDYAASRGEYLNGVILAKYLNAEFIDAAEVIFFDKCFDEKKSYEKIKEKVLSCNKAVIPGFYGSSFNGDVKTFSRGGSDVTGSIISAGVNADLYENWTDVSGFLMADPRIVENPKTISKISYKELRELSYMLHEEAIFPVKDSGIPINIKNTNKPSDPGTLILSDTHKEINLGTITGIAGKKNFTVIAIEKALLNSEVGFCRKILSILEMYGVSFEHMPSGVDSVSLVIEDCKLDGKCDKIIEEIKKQCNPDSIEIHPNMALVATVGTGMAKTKGIANKIFTALSKENVNIRMIDQGSSEINVIVGVETVDFEKAVKSIYNAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aspartokinase
publication title Crystal structure of Clostridium acetobutylicum Aspartate kinase (CaAK): An important allosteric enzyme for amino acids production.
pubmed doi rcsb
source organism Clostridium acetobutylicum
total genus 128
structure length 429
sequence length 435
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3tviA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3tviA01
2R8VA 2AKOA 3L86A 1E19A 3ZZHA 4AB7A 4I49A 2BRXA 2J0XA 3ZZIA 4USJA 4KZTA 1OH9A 3K4OA 3WWNA 4NDOA 2BNFA 1YBDA 4JZ7A 2OGXA 2BMUA 1GS5A 2RD5A 3EK5A 2J0WA 2A1FA 2V5HA 2F06A 1Z9DA 2E9YA 3EK6A 3NWYA 2IJ9A 2X2WA 2VA1A 3U6UA 2BNEA 3K56A 3AB4A 2WXBA 3D41A 3QUNA 2HMFA 3AAWA 2WE4A 4A7XA 4F6TA 2J4KA 4NDQB 2CDQA 3TVIA 4NDRA 3S6GA 3LKKA 2W21A 3QURA 4NDPA 4Q1TA 3D2MA 3K52A 3C20A 2V4YA 2R98A 3ZZFA 2AP9A 3C1MA 1OHBA 3D2PA 2J4LA 3QUOA 2BUFA 3B8GA 3T7BA 2BTYA 3QVHA 1B7BA 2JJ4A 3WWMA 2J5VA 4NDOB 3S6HA 1ZVPA 3ZZGA 1ZHVA 3KZFA 2OGXB 2J5TA 3L76A 4NDQA 2BRIA 4JZ8A 4OLCA 3C1NA 2BNDA 3S6KA 4JZ9A 2JI5A 4A7WA 1OHAA 2J4JA 3D40A 1GSJA 2JJXA 4F6TB 3QVFA 2WE5A 3LL9A 4NDRB 3AB2A 4NDPB 4AXSA 3K4YA 3LL5A
chains in the Genus database with same CATH superfamily
2R8VA 2AKOA 3L86A 1E19A 3ZZHA 4AB7A 4I49A 2BRXA 2J0XA 3ZZIA 4USJA 4KZTA 1OH9A 3K4OA 3WWNA 4NDOA 2BNFA 1YBDA 4JZ7A 2OGXA 2BMUA 1GS5A 2RD5A 3EK5A 2J0WA 2A1FA 2V5HA 3K0BA 2F06A 1Z9DA 2E9YA 3TM5A 3EK6A 3NWYA 2IJ9A 2X2WA 2VA1A 3U6UA 2BNEA 3K56A 3AB4A 2WXBA 3D41A 3LDUA 2HMFA 3QUNA 3AAWA 2WE4A 4A7XA 4F6TA 2J4KA 4NDQB 2CDQA 3TVIA 4NDRA 3S6GA 3LKKA 2W21A 3QURA 4NDPA 4Q1TA 3D2MA 3K52A 3C20A 2V4YA 2R98A 3ZZFA 2AP9A 3C1MA 1OHBA 3D2PA 2J4LA 3QUOA 2BUFA 3B8GA 3T7BA 3V8VA 2BTYA 3QVHA 1B7BA 2JJ4A 3WWMA 3TLJA 2J5VA 4NDOB 3S6HA 1ZVPA 3ZZGA 1ZHVA 3KZFA 2OGXB 2J5TA 3L76A 3TMAA 4KR7A 4NDQA 2BRIA 4JZ8A 4OLCA 3C1NA 4KR9A 2BNDA 3S6KA 4JZ9A 3V97A 2JI5A 4A7WA 1OHAA 2J4JA 3D40A 1GSJA 2JJXA 4F6TB 3QVFA 2WE5A 3LL9A 3TM4A 4NDRB 3AB2A 4NDPB 3LDGA 4KR6A 4AXSA 3K4YA 3LL5A 2C5SA
chains in the Genus database with same CATH topology
2R8VA 2AKOA 3L86A 1E19A 3ZZHA 4AB7A 4I49A 2BRXA 2J0XA 3ZZIA 4USJA 4KZTA 1OH9A 3K4OA 3WWNA 4NDOA 2BNFA 1YBDA 4JZ7A 2OGXA 2BMUA 1GS5A 2RD5A 3EK5A 2J0WA 2A1FA 2V5HA 3K0BA 2F06A 1Z9DA 2E9YA 3TM5A 3EK6A 3NWYA 2IJ9A 2X2WA 2VA1A 3U6UA 2BNEA 3K56A 3AB4A 2WXBA 3D41A 3LDUA 2HMFA 3QUNA 3AAWA 2WE4A 4A7XA 4F6TA 2J4KA 4NDQB 2CDQA 3TVIA 4NDRA 3S6GA 3LKKA 2W21A 3QURA 4NDPA 4Q1TA 3D2MA 3K52A 3C20A 2V4YA 2R98A 3ZZFA 2AP9A 3C1MA 1OHBA 3D2PA 2J4LA 3QUOA 2BUFA 3B8GA 3T7BA 3V8VA 2BTYA 3QVHA 1B7BA 2JJ4A 3WWMA 3TLJA 2J5VA 4NDOB 3S6HA 1ZVPA 3ZZGA 1ZHVA 3KZFA 2OGXB 2J5TA 3L76A 3TMAA 4KR7A 4NDQA 2BRIA 4JZ8A 4OLCA 3C1NA 4KR9A 2BNDA 3S6KA 4JZ9A 3V97A 2JI5A 4A7WA 1OHAA 2J4JA 3D40A 1GSJA 2JJXA 4F6TB 3QVFA 2WE5A 3LL9A 3TM4A 4NDRB 3AB2A 4NDPB 3LDGA 4KR6A 4AXSA 3K4YA 3LL5A 2C5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8V A;  2AKO A;  3L86 A;  1E19 A;  3ZZH A;  4AB7 A;  4I49 A;  2BRX A;  2J0X A;  3ZZI A;  4USJ A;  4KZT A;  1OH9 A;  3K4O A;  3WWN A;  4NDO A;  2BNF A;  1YBD A;  4JZ7 A;  2OGX A;  2BMU A;  1GS5 A;  2RD5 A;  3EK5 A;  2J0W A;  2A1F A;  2V5H A;  2F06 A;  1Z9D A;  2E9Y A;  3EK6 A;  3NWY A;  2IJ9 A;  2X2W A;  2VA1 A;  3U6U A;  2BNE A;  3K56 A;  3AB4 A;  2WXB A;  3D41 A;  3QUN A;  2HMF A;  3AAW A;  2WE4 A;  4A7X A;  4F6T A;  2J4K A;  4NDQ B;  2CDQ A;  3TVI A;  4NDR A;  3S6G A;  3LKK A;  2W21 A;  3QUR A;  4NDP A;  4Q1T A;  3D2M A;  3K52 A;  3C20 A;  2V4Y A;  2R98 A;  3ZZF A;  2AP9 A;  3C1M A;  1OHB A;  3D2P A;  2J4L A;  3QUO A;  2BUF A;  3B8G A;  3T7B A;  2BTY A;  3QVH A;  1B7B A;  2JJ4 A;  3WWM A;  2J5V A;  4NDO B;  3S6H A;  1ZVP A;  3ZZG A;  1ZHV A;  3KZF A;  2OGX B;  2J5T A;  3L76 A;  4NDQ A;  2BRI A;  4JZ8 A;  4OLC A;  3C1N A;  2BND A;  3S6K A;  4JZ9 A;  2JI5 A;  4A7W A;  1OHA A;  2J4J A;  3D40 A;  1GSJ A;  2JJX A;  4F6T B;  3QVF A;  2WE5 A;  3LL9 A;  4NDR B;  3AB2 A;  4NDP B;  4AXS A;  3K4Y A;  3LL5 A; 
#chains in the Genus database with same CATH topology
 2R8V A;  2AKO A;  3L86 A;  1E19 A;  3ZZH A;  4AB7 A;  4I49 A;  2BRX A;  2J0X A;  3ZZI A;  4USJ A;  4KZT A;  1OH9 A;  3K4O A;  3WWN A;  4NDO A;  2BNF A;  1YBD A;  4JZ7 A;  2OGX A;  2BMU A;  1GS5 A;  2RD5 A;  3EK5 A;  2J0W A;  2A1F A;  2V5H A;  3K0B A;  2F06 A;  1Z9D A;  2E9Y A;  3TM5 A;  3EK6 A;  3NWY A;  2IJ9 A;  2X2W A;  2VA1 A;  3U6U A;  2BNE A;  3K56 A;  3AB4 A;  2WXB A;  3D41 A;  3LDU A;  2HMF A;  3QUN A;  3AAW A;  2WE4 A;  4A7X A;  4F6T A;  2J4K A;  4NDQ B;  2CDQ A;  3TVI A;  4NDR A;  3S6G A;  3LKK A;  2W21 A;  3QUR A;  4NDP A;  4Q1T A;  3D2M A;  3K52 A;  3C20 A;  2V4Y A;  2R98 A;  3ZZF A;  2AP9 A;  3C1M A;  1OHB A;  3D2P A;  2J4L A;  3QUO A;  2BUF A;  3B8G A;  3T7B A;  3V8V A;  2BTY A;  3QVH A;  1B7B A;  2JJ4 A;  3WWM A;  3TLJ A;  2J5V A;  4NDO B;  3S6H A;  1ZVP A;  3ZZG A;  1ZHV A;  3KZF A;  2OGX B;  2J5T A;  3L76 A;  3TMA A;  4KR7 A;  4NDQ A;  2BRI A;  4JZ8 A;  4OLC A;  3C1N A;  4KR9 A;  2BND A;  3S6K A;  4JZ9 A;  3V97 A;  2JI5 A;  4A7W A;  1OHA A;  2J4J A;  3D40 A;  1GSJ A;  2JJX A;  4F6T B;  3QVF A;  2WE5 A;  3LL9 A;  3TM4 A;  4NDR B;  3AB2 A;  4NDP B;  3LDG A;  4KR6 A;  4AXS A;  3K4Y A;  3LL5 A;  2C5S A; 
#chains in the Genus database with same CATH homology
 2R8V A;  2AKO A;  3L86 A;  1E19 A;  3ZZH A;  4AB7 A;  4I49 A;  2BRX A;  2J0X A;  3ZZI A;  4USJ A;  4KZT A;  1OH9 A;  3K4O A;  3WWN A;  4NDO A;  2BNF A;  1YBD A;  4JZ7 A;  2OGX A;  2BMU A;  1GS5 A;  2RD5 A;  3EK5 A;  2J0W A;  2A1F A;  2V5H A;  3K0B A;  2F06 A;  1Z9D A;  2E9Y A;  3TM5 A;  3EK6 A;  3NWY A;  2IJ9 A;  2X2W A;  2VA1 A;  3U6U A;  2BNE A;  3K56 A;  3AB4 A;  2WXB A;  3D41 A;  3LDU A;  2HMF A;  3QUN A;  3AAW A;  2WE4 A;  4A7X A;  4F6T A;  2J4K A;  4NDQ B;  2CDQ A;  3TVI A;  4NDR A;  3S6G A;  3LKK A;  2W21 A;  3QUR A;  4NDP A;  4Q1T A;  3D2M A;  3K52 A;  3C20 A;  2V4Y A;  2R98 A;  3ZZF A;  2AP9 A;  3C1M A;  1OHB A;  3D2P A;  2J4L A;  3QUO A;  2BUF A;  3B8G A;  3T7B A;  3V8V A;  2BTY A;  3QVH A;  1B7B A;  2JJ4 A;  3WWM A;  3TLJ A;  2J5V A;  4NDO B;  3S6H A;  1ZVP A;  3ZZG A;  1ZHV A;  3KZF A;  2OGX B;  2J5T A;  3L76 A;  3TMA A;  4KR7 A;  4NDQ A;  2BRI A;  4JZ8 A;  4OLC A;  3C1N A;  4KR9 A;  2BND A;  3S6K A;  4JZ9 A;  3V97 A;  2JI5 A;  4A7W A;  1OHA A;  2J4J A;  3D40 A;  1GSJ A;  2JJX A;  4F6T B;  3QVF A;  2WE5 A;  3LL9 A;  3TM4 A;  4NDR B;  3AB2 A;  4NDP B;  3LDG A;  4KR6 A;  4AXS A;  3K4Y A;  3LL5 A;  2C5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...