3TVIA

Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
435
structure length
429
Chain Sequence
b'IVVTKFGGSSLADSNQFKKVKGIIDSDANRKYIIPSAPGKRTNKDYKITDLLYLCNAHVKNGIPFDDVFKLISQRYTEIVSELNIDMDIAYYLEKVKKNIENGASSDYAASRGEYLNGVILAKYLNAEFIDAAEVIFFDKCFDEKKSYEKIKEKVLSCNKAVIPGFYGSSFNGDVKTFSRGGSDVTGSIISAGVNADLYENWTDVSGFLMADPRIVENPKTISKISYKELRELSYMLHEEAIFPVKDSGIPINIKNTNKPSDPGTLILSDTHKEINLGTITGIAGKKNFTVIAIEKALLNSEVGFCRKILSILEMYGVSFEHMPSGVDSVSLVIEDCKLDGKCDKIIEEIKKQCNPDSIEIHPNMALVATVGTGMAKTKGIANKIFTALSKENVNIRMIDQGSSEINVIVGVETVDFEKAVKSIYNAFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartokinase
publication title Crystal structure of Clostridium acetobutylicum Aspartate kinase (CaAK): An important allosteric enzyme for amino acids production.
pubmed doi rcsb
source organism Clostridium acetobutylicum
molecule tags Transferase
total genus 128
structure length 429
sequence length 435
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 3tviA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3tviA01
2E9YA 2BRIA 4AXSA 4A7WA 4JZ7A 4NDQB 3EK6A 2OGXB 2AP9A 3QURA 1E19A 3WWMA 3S6KA 4NDOB 3LKKA 3AB2A 3AB4A 2BNDA 3QUNA 1GS5A 2WXBA 4F6TA 3B8GA 2W21A 3K4OA 2J0XA 2VA1A 3K4YA 2V5HA 3D2PA 3ZZIA 3QVHA 3AAWA 4OLCA 4AB7A 3S6GA 4A7XA 4USJA 2BNFA 2HMFA 3ZZHA 1Z9DA 2J4LA 2BTYA 3K56A 4JZ9A 3NWYA 3U6UA 4Q1TA 2F06A 3C1NA 2WE4A 3KZFA 2J5TA 1B7BA 4NDPA 2J4JA 2BRXA 4NDRB 4JZ8A 2AKOA 2A1FA 3TVIA 2BMUA 2X2WA 2CDQA 3D40A 3ZZFA 2J4KA 3EK5A 2OGXA 3K52A 4KZTA 3D2MA 3T7BA 2JJXA 4NDOA 3L76A 3QVFA 2J5VA 4F6TB 3L86A 2WE5A 3S6HA 1OHAA 1ZVPA 3WWNA 3D41A 3LL5A 1ZHVA 4I49A 1OHBA 2J0WA 2R8VA 3C20A 4NDQA 2BNEA 3QUOA 2V4YA 2JI5A 2JJ4A 1YBDA 2R98A 3LL9A 3ZZGA 2RD5A 4NDPB 4NDRA 2BUFA 2IJ9A 1GSJA 3C1MA 1OH9A
chains in the Genus database with same CATH superfamily
2E9YA 2BRIA 4KR7A 4AXSA 4A7WA 4JZ7A 4NDQB 3EK6A 2OGXB 2AP9A 3QURA 1E19A 3WWMA 3S6KA 4NDOB 3TMAA 3LKKA 3AB2A 3AB4A 2BNDA 3QUNA 1GS5A 2WXBA 4F6TA 3B8GA 2W21A 3K4OA 2J0XA 2VA1A 3K4YA 2V5HA 3V8VA 3D2PA 3K0BA 3ZZIA 3QVHA 3AAWA 4OLCA 4AB7A 3S6GA 4A7XA 4USJA 3TM4A 2BNFA 2HMFA 2C5SA 3ZZHA 1Z9DA 2J4LA 2BTYA 3LDGA 3K56A 4JZ9A 4KR9A 3NWYA 3U6UA 4Q1TA 2F06A 3C1NA 2WE4A 3KZFA 2J5TA 1B7BA 4NDPA 2J4JA 2BRXA 4NDRB 4JZ8A 2AKOA 2A1FA 3TVIA 2BMUA 2X2WA 2CDQA 3D40A 3ZZFA 4KR6A 2J4KA 3EK5A 2OGXA 3K52A 4KZTA 3D2MA 3T7BA 2JJXA 4NDOA 3L76A 3V97A 2J5VA 3QVFA 4F6TB 3L86A 2WE5A 3S6HA 1OHAA 1ZVPA 3WWNA 3TM5A 3LDUA 3D41A 3LL5A 1ZHVA 4I49A 1OHBA 2J0WA 2R8VA 3C20A 4NDQA 2BNEA 3QUOA 2V4YA 2JI5A 2JJ4A 1YBDA 2R98A 3LL9A 3ZZGA 2RD5A 3TLJA 4NDPB 4NDRA 2BUFA 2IJ9A 1GSJA 3C1MA 1OH9A
chains in the Genus database with same CATH topology
2E9YA 2BRIA 4KR7A 4AXSA 4A7WA 4JZ7A 4NDQB 3EK6A 2OGXB 2AP9A 3QURA 1E19A 3WWMA 3S6KA 4NDOB 3TMAA 3LKKA 3AB2A 3AB4A 2BNDA 3QUNA 1GS5A 2WXBA 4F6TA 3B8GA 2W21A 3K4OA 2J0XA 2VA1A 3K4YA 2V5HA 3V8VA 3D2PA 3K0BA 3ZZIA 3QVHA 3AAWA 4OLCA 4AB7A 3S6GA 4A7XA 4USJA 3TM4A 2BNFA 2HMFA 2C5SA 3ZZHA 1Z9DA 2J4LA 2BTYA 3LDGA 3K56A 4JZ9A 4KR9A 3NWYA 3U6UA 4Q1TA 2F06A 3C1NA 2WE4A 3KZFA 2J5TA 1B7BA 4NDPA 2J4JA 2BRXA 4NDRB 4JZ8A 2AKOA 2A1FA 3TVIA 2BMUA 2X2WA 2CDQA 3D40A 3ZZFA 4KR6A 2J4KA 3EK5A 2OGXA 3K52A 4KZTA 3D2MA 3T7BA 2JJXA 4NDOA 3L76A 3V97A 2J5VA 3QVFA 4F6TB 3L86A 2WE5A 3S6HA 1OHAA 1ZVPA 3WWNA 3TM5A 3LDUA 3D41A 3LL5A 1ZHVA 4I49A 1OHBA 2J0WA 2R8VA 3C20A 4NDQA 2BNEA 3QUOA 2V4YA 2JI5A 2JJ4A 1YBDA 2R98A 3LL9A 3ZZGA 2RD5A 3TLJA 4NDPB 4NDRA 2BUFA 2IJ9A 1GSJA 3C1MA 1OH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9Y A;  2BRI A;  4AXS A;  4A7W A;  4JZ7 A;  4NDQ B;  3EK6 A;  2OGX B;  2AP9 A;  3QUR A;  1E19 A;  3WWM A;  3S6K A;  4NDO B;  3LKK A;  3AB2 A;  3AB4 A;  2BND A;  3QUN A;  1GS5 A;  2WXB A;  4F6T A;  3B8G A;  2W21 A;  3K4O A;  2J0X A;  2VA1 A;  3K4Y A;  2V5H A;  3D2P A;  3ZZI A;  3QVH A;  3AAW A;  4OLC A;  4AB7 A;  3S6G A;  4A7X A;  4USJ A;  2BNF A;  2HMF A;  3ZZH A;  1Z9D A;  2J4L A;  2BTY A;  3K56 A;  4JZ9 A;  3NWY A;  3U6U A;  4Q1T A;  2F06 A;  3C1N A;  2WE4 A;  3KZF A;  2J5T A;  1B7B A;  4NDP A;  2J4J A;  2BRX A;  4NDR B;  4JZ8 A;  2AKO A;  2A1F A;  3TVI A;  2BMU A;  2X2W A;  2CDQ A;  3D40 A;  3ZZF A;  2J4K A;  3EK5 A;  2OGX A;  3K52 A;  4KZT A;  3D2M A;  3T7B A;  2JJX A;  4NDO A;  3L76 A;  3QVF A;  2J5V A;  4F6T B;  3L86 A;  2WE5 A;  3S6H A;  1OHA A;  1ZVP A;  3WWN A;  3D41 A;  3LL5 A;  1ZHV A;  4I49 A;  1OHB A;  2J0W A;  2R8V A;  3C20 A;  4NDQ A;  2BNE A;  3QUO A;  2V4Y A;  2JI5 A;  2JJ4 A;  1YBD A;  2R98 A;  3LL9 A;  3ZZG A;  2RD5 A;  4NDP B;  4NDR A;  2BUF A;  2IJ9 A;  1GSJ A;  3C1M A;  1OH9 A; 
#chains in the Genus database with same CATH topology
 2E9Y A;  2BRI A;  4KR7 A;  4AXS A;  4A7W A;  4JZ7 A;  4NDQ B;  3EK6 A;  2OGX B;  2AP9 A;  3QUR A;  1E19 A;  3WWM A;  3S6K A;  4NDO B;  3TMA A;  3LKK A;  3AB2 A;  3AB4 A;  2BND A;  3QUN A;  1GS5 A;  2WXB A;  4F6T A;  3B8G A;  2W21 A;  3K4O A;  2J0X A;  2VA1 A;  3K4Y A;  2V5H A;  3V8V A;  3D2P A;  3K0B A;  3ZZI A;  3QVH A;  3AAW A;  4OLC A;  4AB7 A;  3S6G A;  4A7X A;  4USJ A;  3TM4 A;  2BNF A;  2HMF A;  2C5S A;  3ZZH A;  1Z9D A;  2J4L A;  2BTY A;  3LDG A;  3K56 A;  4JZ9 A;  4KR9 A;  3NWY A;  3U6U A;  4Q1T A;  2F06 A;  3C1N A;  2WE4 A;  3KZF A;  2J5T A;  1B7B A;  4NDP A;  2J4J A;  2BRX A;  4NDR B;  4JZ8 A;  2AKO A;  2A1F A;  3TVI A;  2BMU A;  2X2W A;  2CDQ A;  3D40 A;  3ZZF A;  4KR6 A;  2J4K A;  3EK5 A;  2OGX A;  3K52 A;  4KZT A;  3D2M A;  3T7B A;  2JJX A;  4NDO A;  3L76 A;  3V97 A;  2J5V A;  3QVF A;  4F6T B;  3L86 A;  2WE5 A;  3S6H A;  1OHA A;  1ZVP A;  3WWN A;  3TM5 A;  3LDU A;  3D41 A;  3LL5 A;  1ZHV A;  4I49 A;  1OHB A;  2J0W A;  2R8V A;  3C20 A;  4NDQ A;  2BNE A;  3QUO A;  2V4Y A;  2JI5 A;  2JJ4 A;  1YBD A;  2R98 A;  3LL9 A;  3ZZG A;  2RD5 A;  3TLJ A;  4NDP B;  4NDR A;  2BUF A;  2IJ9 A;  1GSJ A;  3C1M A;  1OH9 A; 
#chains in the Genus database with same CATH homology
 2E9Y A;  2BRI A;  4KR7 A;  4AXS A;  4A7W A;  4JZ7 A;  4NDQ B;  3EK6 A;  2OGX B;  2AP9 A;  3QUR A;  1E19 A;  3WWM A;  3S6K A;  4NDO B;  3TMA A;  3LKK A;  3AB2 A;  3AB4 A;  2BND A;  3QUN A;  1GS5 A;  2WXB A;  4F6T A;  3B8G A;  2W21 A;  3K4O A;  2J0X A;  2VA1 A;  3K4Y A;  2V5H A;  3V8V A;  3D2P A;  3K0B A;  3ZZI A;  3QVH A;  3AAW A;  4OLC A;  4AB7 A;  3S6G A;  4A7X A;  4USJ A;  3TM4 A;  2BNF A;  2HMF A;  2C5S A;  3ZZH A;  1Z9D A;  2J4L A;  2BTY A;  3LDG A;  3K56 A;  4JZ9 A;  4KR9 A;  3NWY A;  3U6U A;  4Q1T A;  2F06 A;  3C1N A;  2WE4 A;  3KZF A;  2J5T A;  1B7B A;  4NDP A;  2J4J A;  2BRX A;  4NDR B;  4JZ8 A;  2AKO A;  2A1F A;  3TVI A;  2BMU A;  2X2W A;  2CDQ A;  3D40 A;  3ZZF A;  4KR6 A;  2J4K A;  3EK5 A;  2OGX A;  3K52 A;  4KZT A;  3D2M A;  3T7B A;  2JJX A;  4NDO A;  3L76 A;  3V97 A;  2J5V A;  3QVF A;  4F6T B;  3L86 A;  2WE5 A;  3S6H A;  1OHA A;  1ZVP A;  3WWN A;  3TM5 A;  3LDU A;  3D41 A;  3LL5 A;  1ZHV A;  4I49 A;  1OHB A;  2J0W A;  2R8V A;  3C20 A;  4NDQ A;  2BNE A;  3QUO A;  2V4Y A;  2JI5 A;  2JJ4 A;  1YBD A;  2R98 A;  3LL9 A;  3ZZG A;  2RD5 A;  3TLJ A;  4NDP B;  4NDR A;  2BUF A;  2IJ9 A;  1GSJ A;  3C1M A;  1OH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...