2HMFA

Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
469
structure length
464
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable aspartokinase
publication title The initial step in the archaeal aspartate biosynthetic pathway catalyzed by a monofunctional aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 162
structure length 464
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 2hmfA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2hmfA01
1ZVPA 3QVHA 2BNDA 2VA1A 3D2MA 4F6TB 3LL5A 3QUNA 3U6UA 2IJ9A 2BNEA 4AB7A 3TVIA 3AB2A 3S6KA 2BUFA 3NWYA 4NDRA 4A7WA 4A7XA 2X2WA 4JZ7A 3D40A 2OGXA 3LKKA 1OH9A 3ZZGA 2CDQA 3S6GA 1Z9DA 4NDPB 3L86A 2J4LA 4NDPA 2J0WA 4KZTA 2AKOA 2JJXA 4F6TA 3AB4A 4NDQB 1OHAA 3B8GA 3S6HA 2A1FA 3ZZHA 3QUOA 4JZ9A 3L76A 1ZHVA 3KZFA 1GS5A 2R8VA 4AXSA 2J5VA 3WWNA 2V4YA 3K4OA 4USJA 2AP9A 2V5HA 3AAWA 3QURA 4JZ8A 2F06A 4NDQA 2BNFA 2BMUA 3WWMA 1YBDA 3C1MA 2R98A 4Q1TA 3D2PA 2BRXA 3T7BA 3EK6A 2WXBA 3K52A 3K4YA 4NDOB 3QVFA 4NDOA 2JJ4A 3C20A 2J4KA 3EK5A 2RD5A 2WE4A 4OLCA 1GSJA 1E19A 2HMFA 2JI5A 3D41A 2J0XA 2BTYA 2WE5A 4NDRB 3ZZIA 1OHBA 4I49A 3LL9A 2J4JA 2J5TA 3C1NA 1B7BA 2OGXB 3K56A 2W21A 2BRIA 3ZZFA 2E9YA
chains in the Genus database with same CATH superfamily
1ZVPA 3QVHA 2BNDA 2VA1A 3D2MA 4F6TB 3LL5A 3QUNA 3U6UA 4KR7A 2BNEA 2IJ9A 4AB7A 3TVIA 4KR9A 3AB2A 3S6KA 3TM5A 2BUFA 3NWYA 4NDRA 4A7WA 4A7XA 2X2WA 2C5SA 4JZ7A 3D40A 3V8VA 2OGXA 3LKKA 1OH9A 3TLJA 3ZZGA 2CDQA 3S6GA 1Z9DA 4NDPB 3L86A 2J4LA 4NDPA 2J0WA 4KZTA 2AKOA 2JJXA 4F6TA 3AB4A 4NDQB 1OHAA 3B8GA 3S6HA 2A1FA 3ZZHA 3QUOA 4JZ9A 3L76A 1ZHVA 3KZFA 1GS5A 2R8VA 4AXSA 2J5VA 3WWNA 2V4YA 3K4OA 3TMAA 4USJA 2AP9A 2V5HA 3AAWA 3QURA 3LDGA 4JZ8A 2F06A 4NDQA 2BNFA 2BMUA 3WWMA 1YBDA 3C1MA 2R98A 4Q1TA 3D2PA 2BRXA 3T7BA 3EK6A 2WXBA 3K52A 3K4YA 4NDOB 3QVFA 4NDOA 2JJ4A 3C20A 2J4KA 3EK5A 2RD5A 4KR6A 2WE4A 4OLCA 1GSJA 3V97A 1E19A 2HMFA 2JI5A 3D41A 2J0XA 3LDUA 2BTYA 2WE5A 4NDRB 3ZZIA 1OHBA 4I49A 3LL9A 2J4JA 2J5TA 3C1NA 1B7BA 3TM4A 2OGXB 3K56A 2W21A 3K0BA 2BRIA 3ZZFA 2E9YA
chains in the Genus database with same CATH topology
1ZVPA 3QVHA 2BNDA 2VA1A 3D2MA 4F6TB 3LL5A 3QUNA 3U6UA 4KR7A 2BNEA 2IJ9A 4AB7A 3TVIA 4KR9A 3AB2A 3S6KA 3TM5A 2BUFA 3NWYA 4NDRA 4A7WA 4A7XA 2X2WA 2C5SA 4JZ7A 3D40A 3V8VA 2OGXA 3LKKA 1OH9A 3TLJA 3ZZGA 2CDQA 3S6GA 1Z9DA 4NDPB 3L86A 2J4LA 4NDPA 2J0WA 4KZTA 2AKOA 2JJXA 4F6TA 3AB4A 4NDQB 1OHAA 3B8GA 3S6HA 2A1FA 3ZZHA 3QUOA 4JZ9A 3L76A 1ZHVA 3KZFA 1GS5A 2R8VA 4AXSA 2J5VA 3WWNA 2V4YA 3K4OA 3TMAA 4USJA 2AP9A 2V5HA 3AAWA 3QURA 3LDGA 4JZ8A 2F06A 4NDQA 2BNFA 2BMUA 3WWMA 1YBDA 3C1MA 2R98A 4Q1TA 3D2PA 2BRXA 3T7BA 3EK6A 2WXBA 3K52A 3K4YA 4NDOB 3QVFA 4NDOA 2JJ4A 3C20A 2J4KA 3EK5A 2RD5A 4KR6A 2WE4A 4OLCA 1GSJA 3V97A 1E19A 2HMFA 2JI5A 3D41A 2J0XA 3LDUA 2BTYA 2WE5A 4NDRB 3ZZIA 1OHBA 4I49A 3LL9A 2J4JA 2J5TA 3C1NA 1B7BA 3TM4A 2OGXB 3K56A 2W21A 3K0BA 2BRIA 3ZZFA 2E9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVP A;  3QVH A;  2BND A;  2VA1 A;  3D2M A;  4F6T B;  3LL5 A;  3QUN A;  3U6U A;  2IJ9 A;  2BNE A;  4AB7 A;  3TVI A;  3AB2 A;  3S6K A;  2BUF A;  3NWY A;  4NDR A;  4A7W A;  4A7X A;  2X2W A;  4JZ7 A;  3D40 A;  2OGX A;  3LKK A;  1OH9 A;  3ZZG A;  2CDQ A;  3S6G A;  1Z9D A;  4NDP B;  3L86 A;  2J4L A;  4NDP A;  2J0W A;  4KZT A;  2AKO A;  2JJX A;  4F6T A;  3AB4 A;  4NDQ B;  1OHA A;  3B8G A;  3S6H A;  2A1F A;  3ZZH A;  3QUO A;  4JZ9 A;  3L76 A;  1ZHV A;  3KZF A;  1GS5 A;  2R8V A;  4AXS A;  2J5V A;  3WWN A;  2V4Y A;  3K4O A;  4USJ A;  2AP9 A;  2V5H A;  3AAW A;  3QUR A;  4JZ8 A;  2F06 A;  4NDQ A;  2BNF A;  2BMU A;  3WWM A;  1YBD A;  3C1M A;  2R98 A;  4Q1T A;  3D2P A;  2BRX A;  3T7B A;  3EK6 A;  2WXB A;  3K52 A;  3K4Y A;  4NDO B;  3QVF A;  4NDO A;  2JJ4 A;  3C20 A;  2J4K A;  3EK5 A;  2RD5 A;  2WE4 A;  4OLC A;  1GSJ A;  1E19 A;  2HMF A;  2JI5 A;  3D41 A;  2J0X A;  2BTY A;  2WE5 A;  4NDR B;  3ZZI A;  1OHB A;  4I49 A;  3LL9 A;  2J4J A;  2J5T A;  3C1N A;  1B7B A;  2OGX B;  3K56 A;  2W21 A;  2BRI A;  3ZZF A;  2E9Y A; 
#chains in the Genus database with same CATH topology
 1ZVP A;  3QVH A;  2BND A;  2VA1 A;  3D2M A;  4F6T B;  3LL5 A;  3QUN A;  3U6U A;  4KR7 A;  2BNE A;  2IJ9 A;  4AB7 A;  3TVI A;  4KR9 A;  3AB2 A;  3S6K A;  3TM5 A;  2BUF A;  3NWY A;  4NDR A;  4A7W A;  4A7X A;  2X2W A;  2C5S A;  4JZ7 A;  3D40 A;  3V8V A;  2OGX A;  3LKK A;  1OH9 A;  3TLJ A;  3ZZG A;  2CDQ A;  3S6G A;  1Z9D A;  4NDP B;  3L86 A;  2J4L A;  4NDP A;  2J0W A;  4KZT A;  2AKO A;  2JJX A;  4F6T A;  3AB4 A;  4NDQ B;  1OHA A;  3B8G A;  3S6H A;  2A1F A;  3ZZH A;  3QUO A;  4JZ9 A;  3L76 A;  1ZHV A;  3KZF A;  1GS5 A;  2R8V A;  4AXS A;  2J5V A;  3WWN A;  2V4Y A;  3K4O A;  3TMA A;  4USJ A;  2AP9 A;  2V5H A;  3AAW A;  3QUR A;  3LDG A;  4JZ8 A;  2F06 A;  4NDQ A;  2BNF A;  2BMU A;  3WWM A;  1YBD A;  3C1M A;  2R98 A;  4Q1T A;  3D2P A;  2BRX A;  3T7B A;  3EK6 A;  2WXB A;  3K52 A;  3K4Y A;  4NDO B;  3QVF A;  4NDO A;  2JJ4 A;  3C20 A;  2J4K A;  3EK5 A;  2RD5 A;  4KR6 A;  2WE4 A;  4OLC A;  1GSJ A;  3V97 A;  1E19 A;  2HMF A;  2JI5 A;  3D41 A;  2J0X A;  3LDU A;  2BTY A;  2WE5 A;  4NDR B;  3ZZI A;  1OHB A;  4I49 A;  3LL9 A;  2J4J A;  2J5T A;  3C1N A;  1B7B A;  3TM4 A;  2OGX B;  3K56 A;  2W21 A;  3K0B A;  2BRI A;  3ZZF A;  2E9Y A; 
#chains in the Genus database with same CATH homology
 1ZVP A;  3QVH A;  2BND A;  2VA1 A;  3D2M A;  4F6T B;  3LL5 A;  3QUN A;  3U6U A;  4KR7 A;  2BNE A;  2IJ9 A;  4AB7 A;  3TVI A;  4KR9 A;  3AB2 A;  3S6K A;  3TM5 A;  2BUF A;  3NWY A;  4NDR A;  4A7W A;  4A7X A;  2X2W A;  2C5S A;  4JZ7 A;  3D40 A;  3V8V A;  2OGX A;  3LKK A;  1OH9 A;  3TLJ A;  3ZZG A;  2CDQ A;  3S6G A;  1Z9D A;  4NDP B;  3L86 A;  2J4L A;  4NDP A;  2J0W A;  4KZT A;  2AKO A;  2JJX A;  4F6T A;  3AB4 A;  4NDQ B;  1OHA A;  3B8G A;  3S6H A;  2A1F A;  3ZZH A;  3QUO A;  4JZ9 A;  3L76 A;  1ZHV A;  3KZF A;  1GS5 A;  2R8V A;  4AXS A;  2J5V A;  3WWN A;  2V4Y A;  3K4O A;  3TMA A;  4USJ A;  2AP9 A;  2V5H A;  3AAW A;  3QUR A;  3LDG A;  4JZ8 A;  2F06 A;  4NDQ A;  2BNF A;  2BMU A;  3WWM A;  1YBD A;  3C1M A;  2R98 A;  4Q1T A;  3D2P A;  2BRX A;  3T7B A;  3EK6 A;  2WXB A;  3K52 A;  3K4Y A;  4NDO B;  3QVF A;  4NDO A;  2JJ4 A;  3C20 A;  2J4K A;  3EK5 A;  2RD5 A;  4KR6 A;  2WE4 A;  4OLC A;  1GSJ A;  3V97 A;  1E19 A;  2HMF A;  2JI5 A;  3D41 A;  2J0X A;  3LDU A;  2BTY A;  2WE5 A;  4NDR B;  3ZZI A;  1OHB A;  4I49 A;  3LL9 A;  2J4J A;  2J5T A;  3C1N A;  1B7B A;  3TM4 A;  2OGX B;  3K56 A;  2W21 A;  3K0B A;  2BRI A;  3ZZF A;  2E9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...