2HMFA

Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
469
structure length
464
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable aspartokinase
publication title The initial step in the archaeal aspartate biosynthetic pathway catalyzed by a monofunctional aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 162
structure length 464
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 2hmfA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2hmfA01
4NDRA 3LL9A 2JI5A 3QURA 3ZZFA 2IJ9A 3EK6A 2J0XA 2BRXA 2JJXA 3D2PA 4AB7A 3QUNA 4F6TB 3D40A 3S6KA 2J4LA 2J4KA 2E9YA 3C1NA 3QVHA 2BNFA 3ZZHA 4NDPB 2OGXA 2CDQA 3ZZGA 3AB4A 1ZHVA 4NDQA 2J5TA 3L76A 3ZZIA 3K4YA 3L86A 3D41A 2WE5A 3WWNA 4JZ7A 1OHBA 1B7BA 2J0WA 2A1FA 3QUOA 1E19A 2BMUA 2J4JA 1ZVPA 2HMFA 2X2WA 1OH9A 4F6TA 3EK5A 3D2MA 2WXBA 3K4OA 4OLCA 3C1MA 1GS5A 3K52A 4NDOB 4AXSA 4A7XA 2R8VA 2V4YA 2RD5A 2R98A 3WWMA 4NDRB 2F06A 3S6HA 2BNEA 2W21A 4NDQB 3K56A 2WE4A 3B8GA 3AAWA 4KZTA 2BUFA 3S6GA 3U6UA 1YBDA 2AKOA 2AP9A 2VA1A 4JZ8A 3KZFA 3T7BA 4I49A 1Z9DA 4A7WA 3QVFA 4NDPA 2V5HA 4USJA 2JJ4A 2J5VA 2BRIA 3NWYA 2BNDA 1GSJA 3C20A 3LKKA 4Q1TA 2OGXB 4NDOA 3AB2A 1OHAA 3TVIA 4JZ9A 2BTYA 3LL5A
chains in the Genus database with same CATH superfamily
4NDRA 3LL9A 2JI5A 3QURA 3ZZFA 2C5SA 2IJ9A 3EK6A 3V97A 2J0XA 2BRXA 2JJXA 3D2PA 4AB7A 3QUNA 4F6TB 3D40A 3S6KA 2J4LA 2J4KA 2E9YA 3C1NA 3QVHA 2BNFA 3ZZHA 4KR9A 4NDPB 2OGXA 2CDQA 3ZZGA 3AB4A 1ZHVA 4NDQA 2J5TA 3L76A 3ZZIA 3K4YA 3L86A 3D41A 2WE5A 3WWNA 4JZ7A 1OHBA 1B7BA 2J0WA 2A1FA 3QUOA 1E19A 2BMUA 2J4JA 1ZVPA 2HMFA 2X2WA 1OH9A 3V8VA 4F6TA 3EK5A 3D2MA 2WXBA 3K4OA 4OLCA 3C1MA 1GS5A 3K52A 4NDOB 4AXSA 4A7XA 2R8VA 2V4YA 4KR7A 4KR6A 2RD5A 2R98A 3WWMA 3TMAA 4NDRB 2F06A 3S6HA 2BNEA 3LDGA 2W21A 4NDQB 3K56A 2WE4A 3B8GA 3AAWA 4KZTA 2BUFA 3S6GA 3U6UA 1YBDA 2AKOA 3TM4A 2AP9A 2VA1A 3TLJA 4JZ8A 3K0BA 3KZFA 3T7BA 4I49A 1Z9DA 3TM5A 4A7WA 3QVFA 4NDPA 2V5HA 4USJA 2JJ4A 2J5VA 2BRIA 3NWYA 2BNDA 1GSJA 3C20A 3LKKA 4Q1TA 2OGXB 4NDOA 3AB2A 1OHAA 3TVIA 4JZ9A 3LDUA 2BTYA 3LL5A
chains in the Genus database with same CATH topology
4NDRA 3LL9A 2JI5A 3QURA 3ZZFA 2C5SA 2IJ9A 3EK6A 3V97A 2J0XA 2BRXA 2JJXA 3D2PA 4AB7A 3QUNA 4F6TB 3D40A 3S6KA 2J4LA 2J4KA 2E9YA 3C1NA 3QVHA 2BNFA 3ZZHA 4KR9A 4NDPB 2OGXA 2CDQA 3ZZGA 3AB4A 1ZHVA 4NDQA 2J5TA 3L76A 3ZZIA 3K4YA 3L86A 3D41A 2WE5A 3WWNA 4JZ7A 1OHBA 1B7BA 2J0WA 2A1FA 3QUOA 1E19A 2BMUA 2J4JA 1ZVPA 2HMFA 2X2WA 1OH9A 3V8VA 4F6TA 3EK5A 3D2MA 2WXBA 3K4OA 4OLCA 3C1MA 1GS5A 3K52A 4NDOB 4AXSA 4A7XA 2R8VA 2V4YA 4KR7A 4KR6A 2RD5A 2R98A 3WWMA 3TMAA 4NDRB 2F06A 3S6HA 2BNEA 3LDGA 2W21A 4NDQB 3K56A 2WE4A 3B8GA 3AAWA 4KZTA 2BUFA 3S6GA 3U6UA 1YBDA 2AKOA 3TM4A 2AP9A 2VA1A 3TLJA 4JZ8A 3K0BA 3KZFA 3T7BA 4I49A 1Z9DA 3TM5A 4A7WA 3QVFA 4NDPA 2V5HA 4USJA 2JJ4A 2J5VA 2BRIA 3NWYA 2BNDA 1GSJA 3C20A 3LKKA 4Q1TA 2OGXB 4NDOA 3AB2A 1OHAA 3TVIA 4JZ9A 3LDUA 2BTYA 3LL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDR A;  3LL9 A;  2JI5 A;  3QUR A;  3ZZF A;  2IJ9 A;  3EK6 A;  2J0X A;  2BRX A;  2JJX A;  3D2P A;  4AB7 A;  3QUN A;  4F6T B;  3D40 A;  3S6K A;  2J4L A;  2J4K A;  2E9Y A;  3C1N A;  3QVH A;  2BNF A;  3ZZH A;  4NDP B;  2OGX A;  2CDQ A;  3ZZG A;  3AB4 A;  1ZHV A;  4NDQ A;  2J5T A;  3L76 A;  3ZZI A;  3K4Y A;  3L86 A;  3D41 A;  2WE5 A;  3WWN A;  4JZ7 A;  1OHB A;  1B7B A;  2J0W A;  2A1F A;  3QUO A;  1E19 A;  2BMU A;  2J4J A;  1ZVP A;  2HMF A;  2X2W A;  1OH9 A;  4F6T A;  3EK5 A;  3D2M A;  2WXB A;  3K4O A;  4OLC A;  3C1M A;  1GS5 A;  3K52 A;  4NDO B;  4AXS A;  4A7X A;  2R8V A;  2V4Y A;  2RD5 A;  2R98 A;  3WWM A;  4NDR B;  2F06 A;  3S6H A;  2BNE A;  2W21 A;  4NDQ B;  3K56 A;  2WE4 A;  3B8G A;  3AAW A;  4KZT A;  2BUF A;  3S6G A;  3U6U A;  1YBD A;  2AKO A;  2AP9 A;  2VA1 A;  4JZ8 A;  3KZF A;  3T7B A;  4I49 A;  1Z9D A;  4A7W A;  3QVF A;  4NDP A;  2V5H A;  4USJ A;  2JJ4 A;  2J5V A;  2BRI A;  3NWY A;  2BND A;  1GSJ A;  3C20 A;  3LKK A;  4Q1T A;  2OGX B;  4NDO A;  3AB2 A;  1OHA A;  3TVI A;  4JZ9 A;  2BTY A;  3LL5 A; 
#chains in the Genus database with same CATH topology
 4NDR A;  3LL9 A;  2JI5 A;  3QUR A;  3ZZF A;  2C5S A;  2IJ9 A;  3EK6 A;  3V97 A;  2J0X A;  2BRX A;  2JJX A;  3D2P A;  4AB7 A;  3QUN A;  4F6T B;  3D40 A;  3S6K A;  2J4L A;  2J4K A;  2E9Y A;  3C1N A;  3QVH A;  2BNF A;  3ZZH A;  4KR9 A;  4NDP B;  2OGX A;  2CDQ A;  3ZZG A;  3AB4 A;  1ZHV A;  4NDQ A;  2J5T A;  3L76 A;  3ZZI A;  3K4Y A;  3L86 A;  3D41 A;  2WE5 A;  3WWN A;  4JZ7 A;  1OHB A;  1B7B A;  2J0W A;  2A1F A;  3QUO A;  1E19 A;  2BMU A;  2J4J A;  1ZVP A;  2HMF A;  2X2W A;  1OH9 A;  3V8V A;  4F6T A;  3EK5 A;  3D2M A;  2WXB A;  3K4O A;  4OLC A;  3C1M A;  1GS5 A;  3K52 A;  4NDO B;  4AXS A;  4A7X A;  2R8V A;  2V4Y A;  4KR7 A;  4KR6 A;  2RD5 A;  2R98 A;  3WWM A;  3TMA A;  4NDR B;  2F06 A;  3S6H A;  2BNE A;  3LDG A;  2W21 A;  4NDQ B;  3K56 A;  2WE4 A;  3B8G A;  3AAW A;  4KZT A;  2BUF A;  3S6G A;  3U6U A;  1YBD A;  2AKO A;  3TM4 A;  2AP9 A;  2VA1 A;  3TLJ A;  4JZ8 A;  3K0B A;  3KZF A;  3T7B A;  4I49 A;  1Z9D A;  3TM5 A;  4A7W A;  3QVF A;  4NDP A;  2V5H A;  4USJ A;  2JJ4 A;  2J5V A;  2BRI A;  3NWY A;  2BND A;  1GSJ A;  3C20 A;  3LKK A;  4Q1T A;  2OGX B;  4NDO A;  3AB2 A;  1OHA A;  3TVI A;  4JZ9 A;  3LDU A;  2BTY A;  3LL5 A; 
#chains in the Genus database with same CATH homology
 4NDR A;  3LL9 A;  2JI5 A;  3QUR A;  3ZZF A;  2C5S A;  2IJ9 A;  3EK6 A;  3V97 A;  2J0X A;  2BRX A;  2JJX A;  3D2P A;  4AB7 A;  3QUN A;  4F6T B;  3D40 A;  3S6K A;  2J4L A;  2J4K A;  2E9Y A;  3C1N A;  3QVH A;  2BNF A;  3ZZH A;  4KR9 A;  4NDP B;  2OGX A;  2CDQ A;  3ZZG A;  3AB4 A;  1ZHV A;  4NDQ A;  2J5T A;  3L76 A;  3ZZI A;  3K4Y A;  3L86 A;  3D41 A;  2WE5 A;  3WWN A;  4JZ7 A;  1OHB A;  1B7B A;  2J0W A;  2A1F A;  3QUO A;  1E19 A;  2BMU A;  2J4J A;  1ZVP A;  2HMF A;  2X2W A;  1OH9 A;  3V8V A;  4F6T A;  3EK5 A;  3D2M A;  2WXB A;  3K4O A;  4OLC A;  3C1M A;  1GS5 A;  3K52 A;  4NDO B;  4AXS A;  4A7X A;  2R8V A;  2V4Y A;  4KR7 A;  4KR6 A;  2RD5 A;  2R98 A;  3WWM A;  3TMA A;  4NDR B;  2F06 A;  3S6H A;  2BNE A;  3LDG A;  2W21 A;  4NDQ B;  3K56 A;  2WE4 A;  3B8G A;  3AAW A;  4KZT A;  2BUF A;  3S6G A;  3U6U A;  1YBD A;  2AKO A;  3TM4 A;  2AP9 A;  2VA1 A;  3TLJ A;  4JZ8 A;  3K0B A;  3KZF A;  3T7B A;  4I49 A;  1Z9D A;  3TM5 A;  4A7W A;  3QVF A;  4NDP A;  2V5H A;  4USJ A;  2JJ4 A;  2J5V A;  2BRI A;  3NWY A;  2BND A;  1GSJ A;  3C20 A;  3LKK A;  4Q1T A;  2OGX B;  4NDO A;  3AB2 A;  1OHA A;  3TVI A;  4JZ9 A;  3LDU A;  2BTY A;  3LL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...