2HMFA

Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
469
structure length
464
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The initial step in the archaeal aspartate biosynthetic pathway catalyzed by a monofunctional aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Probable aspartokinase
total genus 162
structure length 464
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 2hmfA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2hmfA01
3C1MA 3TVIA 1ZVPA 3U6UA 3LKKA 4NDPA 2VA1A 3ZZHA 4NDOB 3AB2A 2BMUA 4I49A 4NDRA 1ZHVA 3QVFA 3K56A 4NDQB 2JI5A 2A1FA 4A7WA 3L86A 4F6TA 2OGXB 2J5TA 3NWYA 3S6GA 2F06A 3C1NA 3QUNA 2W21A 2R8VA 4NDPB 2BTYA 4AXSA 2BRXA 2J0XA 4JZ9A 1OHAA 4A7XA 3LL5A 3EK5A 3K4YA 3T7BA 2V4YA 3L76A 2BNFA 3C20A 2E9YA 4NDOA 2BRIA 2AP9A 2HMFA 1OHBA 2AKOA 4Q1TA 3WWNA 3AB4A 1OH9A 3ZZFA 3EK6A 2WXBA 3WWMA 1E19A 2JJXA 3LL9A 1Z9DA 4JZ7A 2CDQA 1B7BA 2OGXA 3S6KA 2J4JA 3QVHA 4NDRB 2V5HA 3D2MA 3K4OA 4OLCA 3S6HA 2BUFA 4NDQA 1GSJA 2IJ9A 2RD5A 4KZTA 1GS5A 2BNEA 3ZZGA 1YBDA 3D40A 3ZZIA 3D2PA 2R98A 3D41A 2J4LA 3AAWA 3KZFA 2BNDA 4AB7A 2X2WA 2J5VA 2J0WA 4USJA 2JJ4A 3QURA 2J4KA 4JZ8A 2WE5A 3B8GA 3K52A 2WE4A 4F6TB 3QUOA
chains in the Genus database with same CATH superfamily
3C1MA 3TVIA 1ZVPA 3U6UA 3LKKA 4KR9A 3TLJA 2VA1A 4NDPA 3ZZHA 4NDOB 3AB2A 2BMUA 4I49A 4NDRA 3LDGA 1ZHVA 3QVFA 4KR6A 3K56A 4NDQB 2JI5A 2A1FA 4A7WA 3L86A 4F6TA 2OGXB 2J5TA 3NWYA 3S6GA 2F06A 3C1NA 3QUNA 2W21A 2R8VA 4NDPB 2BTYA 4AXSA 2BRXA 3V97A 2J0XA 4JZ9A 1OHAA 4A7XA 3LL5A 3EK5A 3K4YA 3T7BA 2V4YA 3L76A 2BNFA 3C20A 2E9YA 3K0BA 4NDOA 2BRIA 2AP9A 2HMFA 1OHBA 2AKOA 4Q1TA 3WWNA 3AB4A 1OH9A 3ZZFA 3EK6A 2WXBA 3WWMA 1E19A 3TMAA 2JJXA 3LL9A 1Z9DA 4KR7A 4JZ7A 2CDQA 1B7BA 2OGXA 3S6KA 2J4JA 3V8VA 3QVHA 4NDRB 2V5HA 3LDUA 3TM5A 3D2MA 3K4OA 4OLCA 3S6HA 2BUFA 4NDQA 1GSJA 2IJ9A 2RD5A 4KZTA 1GS5A 2C5SA 2BNEA 3ZZGA 1YBDA 3D40A 3ZZIA 3D2PA 2R98A 3D41A 2J4LA 3AAWA 3KZFA 2BNDA 4AB7A 2X2WA 2J5VA 2J0WA 4USJA 2JJ4A 3QURA 2J4KA 4JZ8A 2WE5A 3B8GA 3K52A 2WE4A 4F6TB 3QUOA 3TM4A
chains in the Genus database with same CATH topology
3C1MA 3TVIA 1ZVPA 3U6UA 3LKKA 4KR9A 3TLJA 2VA1A 4NDPA 3ZZHA 4NDOB 3AB2A 2BMUA 4I49A 4NDRA 3LDGA 1ZHVA 3QVFA 4KR6A 3K56A 4NDQB 2JI5A 2A1FA 4A7WA 3L86A 4F6TA 2OGXB 2J5TA 3NWYA 3S6GA 2F06A 3C1NA 3QUNA 2W21A 2R8VA 4NDPB 2BTYA 4AXSA 2BRXA 3V97A 2J0XA 4JZ9A 1OHAA 4A7XA 3LL5A 3EK5A 3K4YA 3T7BA 2V4YA 3L76A 2BNFA 3C20A 2E9YA 3K0BA 4NDOA 2BRIA 2AP9A 2HMFA 1OHBA 2AKOA 4Q1TA 3WWNA 3AB4A 1OH9A 3ZZFA 3EK6A 2WXBA 3WWMA 1E19A 3TMAA 2JJXA 3LL9A 1Z9DA 4KR7A 4JZ7A 2CDQA 1B7BA 2OGXA 3S6KA 2J4JA 3V8VA 3QVHA 4NDRB 2V5HA 3LDUA 3TM5A 3D2MA 3K4OA 4OLCA 3S6HA 2BUFA 4NDQA 1GSJA 2IJ9A 2RD5A 4KZTA 1GS5A 2C5SA 2BNEA 3ZZGA 1YBDA 3D40A 3ZZIA 3D2PA 2R98A 3D41A 2J4LA 3AAWA 3KZFA 2BNDA 4AB7A 2X2WA 2J5VA 2J0WA 4USJA 2JJ4A 3QURA 2J4KA 4JZ8A 2WE5A 3B8GA 3K52A 2WE4A 4F6TB 3QUOA 3TM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1M A;  3TVI A;  1ZVP A;  3U6U A;  3LKK A;  4NDP A;  2VA1 A;  3ZZH A;  4NDO B;  3AB2 A;  2BMU A;  4I49 A;  4NDR A;  1ZHV A;  3QVF A;  3K56 A;  4NDQ B;  2JI5 A;  2A1F A;  4A7W A;  3L86 A;  4F6T A;  2OGX B;  2J5T A;  3NWY A;  3S6G A;  2F06 A;  3C1N A;  3QUN A;  2W21 A;  2R8V A;  4NDP B;  2BTY A;  4AXS A;  2BRX A;  2J0X A;  4JZ9 A;  1OHA A;  4A7X A;  3LL5 A;  3EK5 A;  3K4Y A;  3T7B A;  2V4Y A;  3L76 A;  2BNF A;  3C20 A;  2E9Y A;  4NDO A;  2BRI A;  2AP9 A;  2HMF A;  1OHB A;  2AKO A;  4Q1T A;  3WWN A;  3AB4 A;  1OH9 A;  3ZZF A;  3EK6 A;  2WXB A;  3WWM A;  1E19 A;  2JJX A;  3LL9 A;  1Z9D A;  4JZ7 A;  2CDQ A;  1B7B A;  2OGX A;  3S6K A;  2J4J A;  3QVH A;  4NDR B;  2V5H A;  3D2M A;  3K4O A;  4OLC A;  3S6H A;  2BUF A;  4NDQ A;  1GSJ A;  2IJ9 A;  2RD5 A;  4KZT A;  1GS5 A;  2BNE A;  3ZZG A;  1YBD A;  3D40 A;  3ZZI A;  3D2P A;  2R98 A;  3D41 A;  2J4L A;  3AAW A;  3KZF A;  2BND A;  4AB7 A;  2X2W A;  2J5V A;  2J0W A;  4USJ A;  2JJ4 A;  3QUR A;  2J4K A;  4JZ8 A;  2WE5 A;  3B8G A;  3K52 A;  2WE4 A;  4F6T B;  3QUO A; 
#chains in the Genus database with same CATH topology
 3C1M A;  3TVI A;  1ZVP A;  3U6U A;  3LKK A;  4KR9 A;  3TLJ A;  2VA1 A;  4NDP A;  3ZZH A;  4NDO B;  3AB2 A;  2BMU A;  4I49 A;  4NDR A;  3LDG A;  1ZHV A;  3QVF A;  4KR6 A;  3K56 A;  4NDQ B;  2JI5 A;  2A1F A;  4A7W A;  3L86 A;  4F6T A;  2OGX B;  2J5T A;  3NWY A;  3S6G A;  2F06 A;  3C1N A;  3QUN A;  2W21 A;  2R8V A;  4NDP B;  2BTY A;  4AXS A;  2BRX A;  3V97 A;  2J0X A;  4JZ9 A;  1OHA A;  4A7X A;  3LL5 A;  3EK5 A;  3K4Y A;  3T7B A;  2V4Y A;  3L76 A;  2BNF A;  3C20 A;  2E9Y A;  3K0B A;  4NDO A;  2BRI A;  2AP9 A;  2HMF A;  1OHB A;  2AKO A;  4Q1T A;  3WWN A;  3AB4 A;  1OH9 A;  3ZZF A;  3EK6 A;  2WXB A;  3WWM A;  1E19 A;  3TMA A;  2JJX A;  3LL9 A;  1Z9D A;  4KR7 A;  4JZ7 A;  2CDQ A;  1B7B A;  2OGX A;  3S6K A;  2J4J A;  3V8V A;  3QVH A;  4NDR B;  2V5H A;  3LDU A;  3TM5 A;  3D2M A;  3K4O A;  4OLC A;  3S6H A;  2BUF A;  4NDQ A;  1GSJ A;  2IJ9 A;  2RD5 A;  4KZT A;  1GS5 A;  2C5S A;  2BNE A;  3ZZG A;  1YBD A;  3D40 A;  3ZZI A;  3D2P A;  2R98 A;  3D41 A;  2J4L A;  3AAW A;  3KZF A;  2BND A;  4AB7 A;  2X2W A;  2J5V A;  2J0W A;  4USJ A;  2JJ4 A;  3QUR A;  2J4K A;  4JZ8 A;  2WE5 A;  3B8G A;  3K52 A;  2WE4 A;  4F6T B;  3QUO A;  3TM4 A; 
#chains in the Genus database with same CATH homology
 3C1M A;  3TVI A;  1ZVP A;  3U6U A;  3LKK A;  4KR9 A;  3TLJ A;  2VA1 A;  4NDP A;  3ZZH A;  4NDO B;  3AB2 A;  2BMU A;  4I49 A;  4NDR A;  3LDG A;  1ZHV A;  3QVF A;  4KR6 A;  3K56 A;  4NDQ B;  2JI5 A;  2A1F A;  4A7W A;  3L86 A;  4F6T A;  2OGX B;  2J5T A;  3NWY A;  3S6G A;  2F06 A;  3C1N A;  3QUN A;  2W21 A;  2R8V A;  4NDP B;  2BTY A;  4AXS A;  2BRX A;  3V97 A;  2J0X A;  4JZ9 A;  1OHA A;  4A7X A;  3LL5 A;  3EK5 A;  3K4Y A;  3T7B A;  2V4Y A;  3L76 A;  2BNF A;  3C20 A;  2E9Y A;  3K0B A;  4NDO A;  2BRI A;  2AP9 A;  2HMF A;  1OHB A;  2AKO A;  4Q1T A;  3WWN A;  3AB4 A;  1OH9 A;  3ZZF A;  3EK6 A;  2WXB A;  3WWM A;  1E19 A;  3TMA A;  2JJX A;  3LL9 A;  1Z9D A;  4KR7 A;  4JZ7 A;  2CDQ A;  1B7B A;  2OGX A;  3S6K A;  2J4J A;  3V8V A;  3QVH A;  4NDR B;  2V5H A;  3LDU A;  3TM5 A;  3D2M A;  3K4O A;  4OLC A;  3S6H A;  2BUF A;  4NDQ A;  1GSJ A;  2IJ9 A;  2RD5 A;  4KZT A;  1GS5 A;  2C5S A;  2BNE A;  3ZZG A;  1YBD A;  3D40 A;  3ZZI A;  3D2P A;  2R98 A;  3D41 A;  2J4L A;  3AAW A;  3KZF A;  2BND A;  4AB7 A;  2X2W A;  2J5V A;  2J0W A;  4USJ A;  2JJ4 A;  3QUR A;  2J4K A;  4JZ8 A;  2WE5 A;  3B8G A;  3K52 A;  2WE4 A;  4F6T B;  3QUO A;  3TM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...