2HMFA

Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
469
structure length
464
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The initial step in the archaeal aspartate biosynthetic pathway catalyzed by a monofunctional aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Probable aspartokinase
total genus 162
structure length 464
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 2hmfA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2hmfA01
3S6KA 2BTYA 2J4JA 1OHBA 3WWNA 2AP9A 3ZZGA 2BNEA 2R8VA 4A7WA 2R98A 2WE4A 2E9YA 1GSJA 3LKKA 3AAWA 2IJ9A 2J5VA 1YBDA 3T7BA 3C20A 3QVHA 2V5HA 1OHAA 3D41A 4Q1TA 3ZZFA 1ZVPA 2OGXB 3WWMA 2AKOA 4USJA 2BRXA 2A1FA 3K52A 4NDPA 3D2MA 3AB4A 2J5TA 4NDQA 3U6UA 4NDQB 2V4YA 4JZ9A 3ZZIA 2BRIA 1E19A 2J0XA 3EK5A 4NDOB 2HMFA 3C1NA 4NDRA 2BNFA 2J0WA 2WXBA 3C1MA 2JI5A 3K4YA 3D40A 3KZFA 4A7XA 3QUNA 3L86A 2F06A 2J4KA 2J4LA 2RD5A 3TVIA 1GS5A 2CDQA 1Z9DA 3LL5A 3S6GA 3ZZHA 4OLCA 4JZ7A 3D2PA 4F6TA 2X2WA 2W21A 4AXSA 4NDRB 3QVFA 3AB2A 4NDOA 2JJ4A 3QURA 3NWYA 2BNDA 1OH9A 2WE5A 3B8GA 3S6HA 2BMUA 3LL9A 1ZHVA 3L76A 3QUOA 4KZTA 4AB7A 4I49A 4NDPB 4JZ8A 3K56A 3K4OA 2OGXA 3EK6A 1B7BA 2BUFA 4F6TB 2JJXA 2VA1A
chains in the Genus database with same CATH superfamily
3S6KA 2BTYA 2J4JA 1OHBA 3WWNA 2AP9A 3ZZGA 2BNEA 2R8VA 4A7WA 2C5SA 2R98A 2WE4A 2E9YA 1GSJA 3LKKA 3AAWA 2IJ9A 4KR9A 1YBDA 2J5VA 3T7BA 3C20A 3QVHA 2V5HA 1OHAA 3D41A 4Q1TA 3ZZFA 1ZVPA 2OGXB 3WWMA 2AKOA 4USJA 3LDUA 2BRXA 2A1FA 3K52A 4NDPA 3D2MA 3AB4A 2J5TA 4NDQA 3U6UA 4NDQB 2V4YA 4JZ9A 3ZZIA 3TMAA 2BRIA 1E19A 2J0XA 3EK5A 3K0BA 4NDOB 2HMFA 3C1NA 4NDRA 2BNFA 2J0WA 2WXBA 3C1MA 2JI5A 4KR6A 4KR7A 3K4YA 3TM5A 3D40A 3KZFA 4A7XA 3QUNA 3L86A 2F06A 3TLJA 2J4KA 2J4LA 2RD5A 3TVIA 1GS5A 2CDQA 1Z9DA 3LL5A 3S6GA 3ZZHA 4OLCA 4JZ7A 3D2PA 4F6TA 2X2WA 2W21A 4AXSA 4NDRB 3AB2A 3QVFA 4NDOA 3V8VA 2JJ4A 3QURA 3V97A 3NWYA 2BNDA 1OH9A 2WE5A 3B8GA 3S6HA 2BMUA 3LL9A 1ZHVA 3L76A 3QUOA 4KZTA 4AB7A 4I49A 4NDPB 4JZ8A 3K56A 3TM4A 3K4OA 2OGXA 3EK6A 1B7BA 2BUFA 3LDGA 4F6TB 2JJXA 2VA1A
chains in the Genus database with same CATH topology
3S6KA 2BTYA 2J4JA 1OHBA 3WWNA 2AP9A 3ZZGA 2BNEA 2R8VA 4A7WA 2C5SA 2R98A 2WE4A 2E9YA 1GSJA 3LKKA 3AAWA 2IJ9A 4KR9A 1YBDA 2J5VA 3T7BA 3C20A 3QVHA 2V5HA 1OHAA 3D41A 4Q1TA 3ZZFA 1ZVPA 2OGXB 3WWMA 2AKOA 4USJA 3LDUA 2BRXA 2A1FA 3K52A 4NDPA 3D2MA 3AB4A 2J5TA 4NDQA 3U6UA 4NDQB 2V4YA 4JZ9A 3ZZIA 3TMAA 2BRIA 1E19A 2J0XA 3EK5A 3K0BA 4NDOB 2HMFA 3C1NA 4NDRA 2BNFA 2J0WA 2WXBA 3C1MA 2JI5A 4KR6A 4KR7A 3K4YA 3TM5A 3D40A 3KZFA 4A7XA 3QUNA 3L86A 2F06A 3TLJA 2J4KA 2J4LA 2RD5A 3TVIA 1GS5A 2CDQA 1Z9DA 3LL5A 3S6GA 3ZZHA 4OLCA 4JZ7A 3D2PA 4F6TA 2X2WA 2W21A 4AXSA 4NDRB 3AB2A 3QVFA 4NDOA 3V8VA 2JJ4A 3QURA 3V97A 3NWYA 2BNDA 1OH9A 2WE5A 3B8GA 3S6HA 2BMUA 3LL9A 1ZHVA 3L76A 3QUOA 4KZTA 4AB7A 4I49A 4NDPB 4JZ8A 3K56A 3TM4A 3K4OA 2OGXA 3EK6A 1B7BA 2BUFA 3LDGA 4F6TB 2JJXA 2VA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6K A;  2BTY A;  2J4J A;  1OHB A;  3WWN A;  2AP9 A;  3ZZG A;  2BNE A;  2R8V A;  4A7W A;  2R98 A;  2WE4 A;  2E9Y A;  1GSJ A;  3LKK A;  3AAW A;  2IJ9 A;  2J5V A;  1YBD A;  3T7B A;  3C20 A;  3QVH A;  2V5H A;  1OHA A;  3D41 A;  4Q1T A;  3ZZF A;  1ZVP A;  2OGX B;  3WWM A;  2AKO A;  4USJ A;  2BRX A;  2A1F A;  3K52 A;  4NDP A;  3D2M A;  3AB4 A;  2J5T A;  4NDQ A;  3U6U A;  4NDQ B;  2V4Y A;  4JZ9 A;  3ZZI A;  2BRI A;  1E19 A;  2J0X A;  3EK5 A;  4NDO B;  2HMF A;  3C1N A;  4NDR A;  2BNF A;  2J0W A;  2WXB A;  3C1M A;  2JI5 A;  3K4Y A;  3D40 A;  3KZF A;  4A7X A;  3QUN A;  3L86 A;  2F06 A;  2J4K A;  2J4L A;  2RD5 A;  3TVI A;  1GS5 A;  2CDQ A;  1Z9D A;  3LL5 A;  3S6G A;  3ZZH A;  4OLC A;  4JZ7 A;  3D2P A;  4F6T A;  2X2W A;  2W21 A;  4AXS A;  4NDR B;  3QVF A;  3AB2 A;  4NDO A;  2JJ4 A;  3QUR A;  3NWY A;  2BND A;  1OH9 A;  2WE5 A;  3B8G A;  3S6H A;  2BMU A;  3LL9 A;  1ZHV A;  3L76 A;  3QUO A;  4KZT A;  4AB7 A;  4I49 A;  4NDP B;  4JZ8 A;  3K56 A;  3K4O A;  2OGX A;  3EK6 A;  1B7B A;  2BUF A;  4F6T B;  2JJX A;  2VA1 A; 
#chains in the Genus database with same CATH topology
 3S6K A;  2BTY A;  2J4J A;  1OHB A;  3WWN A;  2AP9 A;  3ZZG A;  2BNE A;  2R8V A;  4A7W A;  2C5S A;  2R98 A;  2WE4 A;  2E9Y A;  1GSJ A;  3LKK A;  3AAW A;  2IJ9 A;  4KR9 A;  1YBD A;  2J5V A;  3T7B A;  3C20 A;  3QVH A;  2V5H A;  1OHA A;  3D41 A;  4Q1T A;  3ZZF A;  1ZVP A;  2OGX B;  3WWM A;  2AKO A;  4USJ A;  3LDU A;  2BRX A;  2A1F A;  3K52 A;  4NDP A;  3D2M A;  3AB4 A;  2J5T A;  4NDQ A;  3U6U A;  4NDQ B;  2V4Y A;  4JZ9 A;  3ZZI A;  3TMA A;  2BRI A;  1E19 A;  2J0X A;  3EK5 A;  3K0B A;  4NDO B;  2HMF A;  3C1N A;  4NDR A;  2BNF A;  2J0W A;  2WXB A;  3C1M A;  2JI5 A;  4KR6 A;  4KR7 A;  3K4Y A;  3TM5 A;  3D40 A;  3KZF A;  4A7X A;  3QUN A;  3L86 A;  2F06 A;  3TLJ A;  2J4K A;  2J4L A;  2RD5 A;  3TVI A;  1GS5 A;  2CDQ A;  1Z9D A;  3LL5 A;  3S6G A;  3ZZH A;  4OLC A;  4JZ7 A;  3D2P A;  4F6T A;  2X2W A;  2W21 A;  4AXS A;  4NDR B;  3AB2 A;  3QVF A;  4NDO A;  3V8V A;  2JJ4 A;  3QUR A;  3V97 A;  3NWY A;  2BND A;  1OH9 A;  2WE5 A;  3B8G A;  3S6H A;  2BMU A;  3LL9 A;  1ZHV A;  3L76 A;  3QUO A;  4KZT A;  4AB7 A;  4I49 A;  4NDP B;  4JZ8 A;  3K56 A;  3TM4 A;  3K4O A;  2OGX A;  3EK6 A;  1B7B A;  2BUF A;  3LDG A;  4F6T B;  2JJX A;  2VA1 A; 
#chains in the Genus database with same CATH homology
 3S6K A;  2BTY A;  2J4J A;  1OHB A;  3WWN A;  2AP9 A;  3ZZG A;  2BNE A;  2R8V A;  4A7W A;  2C5S A;  2R98 A;  2WE4 A;  2E9Y A;  1GSJ A;  3LKK A;  3AAW A;  2IJ9 A;  4KR9 A;  1YBD A;  2J5V A;  3T7B A;  3C20 A;  3QVH A;  2V5H A;  1OHA A;  3D41 A;  4Q1T A;  3ZZF A;  1ZVP A;  2OGX B;  3WWM A;  2AKO A;  4USJ A;  3LDU A;  2BRX A;  2A1F A;  3K52 A;  4NDP A;  3D2M A;  3AB4 A;  2J5T A;  4NDQ A;  3U6U A;  4NDQ B;  2V4Y A;  4JZ9 A;  3ZZI A;  3TMA A;  2BRI A;  1E19 A;  2J0X A;  3EK5 A;  3K0B A;  4NDO B;  2HMF A;  3C1N A;  4NDR A;  2BNF A;  2J0W A;  2WXB A;  3C1M A;  2JI5 A;  4KR6 A;  4KR7 A;  3K4Y A;  3TM5 A;  3D40 A;  3KZF A;  4A7X A;  3QUN A;  3L86 A;  2F06 A;  3TLJ A;  2J4K A;  2J4L A;  2RD5 A;  3TVI A;  1GS5 A;  2CDQ A;  1Z9D A;  3LL5 A;  3S6G A;  3ZZH A;  4OLC A;  4JZ7 A;  3D2P A;  4F6T A;  2X2W A;  2W21 A;  4AXS A;  4NDR B;  3AB2 A;  3QVF A;  4NDO A;  3V8V A;  2JJ4 A;  3QUR A;  3V97 A;  3NWY A;  2BND A;  1OH9 A;  2WE5 A;  3B8G A;  3S6H A;  2BMU A;  3LL9 A;  1ZHV A;  3L76 A;  3QUO A;  4KZT A;  4AB7 A;  4I49 A;  4NDP B;  4JZ8 A;  3K56 A;  3TM4 A;  3K4O A;  2OGX A;  3EK6 A;  1B7B A;  2BUF A;  3LDG A;  4F6T B;  2JJX A;  2VA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...