2HMFA

Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
469
structure length
464
Chain Sequence
TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable aspartokinase
publication title The initial step in the archaeal aspartate biosynthetic pathway catalyzed by a monofunctional aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 162
structure length 464
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 2hmfA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2hmfA01
4KZTA 4NDRB 2IJ9A 3ZZGA 3AB2A 1B7BA 3AAWA 2R8VA 2V5HA 2WE4A 4JZ8A 3AB4A 3WWNA 4USJA 1OHAA 3LL5A 3C20A 3KZFA 3U6UA 1E19A 3QVFA 2VA1A 4NDOB 2HMFA 2WXBA 2V4YA 3K4YA 2J0WA 4F6TB 2CDQA 4I49A 2BNFA 2BNDA 2W21A 4Q1TA 2BNEA 4A7XA 2J4JA 2BUFA 2JJXA 3C1NA 3QUNA 3B8GA 3S6GA 3EK5A 1ZHVA 2F06A 2BRXA 1YBDA 1GSJA 1Z9DA 2JJ4A 3QUOA 2J4LA 4NDQA 2AP9A 2J5VA 4AB7A 3K56A 2BRIA 3S6HA 2OGXA 2J4KA 3D2MA 3ZZHA 2E9YA 3C1MA 3D40A 3QVHA 3LKKA 1ZVPA 2WE5A 3K4OA 3D41A 2BMUA 2BTYA 3L86A 3ZZFA 4NDPA 3WWMA 4NDRA 4JZ7A 3L76A 3EK6A 3K52A 3T7BA 2J5TA 2A1FA 3ZZIA 4OLCA 4A7WA 4NDQB 1GS5A 2J0XA 4JZ9A 2OGXB 3TVIA 2AKOA 3S6KA 3D2PA 1OHBA 3NWYA 3LL9A 4NDOA 2JI5A 4F6TA 4AXSA 2RD5A 2X2WA 2R98A 1OH9A 3QURA 4NDPB
chains in the Genus database with same CATH superfamily
4KZTA 4NDRB 3TLJA 2IJ9A 3ZZGA 3TMAA 3V8VA 3AB2A 1B7BA 3AAWA 2R8VA 2V5HA 2WE4A 4JZ8A 3AB4A 3WWNA 4USJA 1OHAA 3LL5A 3C20A 3KZFA 3U6UA 1E19A 3QVFA 2VA1A 4NDOB 2HMFA 2WXBA 2V4YA 2J0WA 3K4YA 3V97A 4F6TB 3TM4A 2CDQA 4I49A 2BNFA 2BNDA 2W21A 4Q1TA 2BNEA 4A7XA 2J4JA 2BUFA 2JJXA 3C1NA 3QUNA 3B8GA 4KR9A 3S6GA 3EK5A 1ZHVA 2F06A 3K0BA 2BRXA 1YBDA 1GSJA 1Z9DA 2JJ4A 3QUOA 2J4LA 4NDQA 2AP9A 2J5VA 3LDUA 4AB7A 3K56A 2BRIA 3S6HA 2OGXA 2J4KA 3D2MA 3ZZHA 2E9YA 3C1MA 3D40A 3QVHA 3LKKA 1ZVPA 4KR6A 2WE5A 3K4OA 3D41A 2BMUA 2BTYA 3L86A 3ZZFA 4NDPA 3WWMA 4NDRA 4JZ7A 3L76A 3EK6A 3K52A 3T7BA 2J5TA 2A1FA 3ZZIA 4OLCA 4A7WA 4NDQB 2C5SA 1GS5A 3LDGA 2J0XA 4JZ9A 4KR7A 3TVIA 2AKOA 2OGXB 3TM5A 3S6KA 3D2PA 1OHBA 3NWYA 3LL9A 4NDOA 2JI5A 4F6TA 4AXSA 2RD5A 2X2WA 2R98A 1OH9A 3QURA 4NDPB
chains in the Genus database with same CATH topology
4KZTA 4NDRB 3TLJA 2IJ9A 3ZZGA 3TMAA 3V8VA 3AB2A 1B7BA 3AAWA 2R8VA 2V5HA 2WE4A 4JZ8A 3AB4A 3WWNA 4USJA 1OHAA 3LL5A 3C20A 3KZFA 3U6UA 1E19A 3QVFA 2VA1A 4NDOB 2HMFA 2WXBA 2V4YA 2J0WA 3K4YA 3V97A 4F6TB 3TM4A 2CDQA 4I49A 2BNFA 2BNDA 2W21A 4Q1TA 2BNEA 4A7XA 2J4JA 2BUFA 2JJXA 3C1NA 3QUNA 3B8GA 4KR9A 3S6GA 3EK5A 1ZHVA 2F06A 3K0BA 2BRXA 1YBDA 1GSJA 1Z9DA 2JJ4A 3QUOA 2J4LA 4NDQA 2AP9A 2J5VA 3LDUA 4AB7A 3K56A 2BRIA 3S6HA 2OGXA 2J4KA 3D2MA 3ZZHA 2E9YA 3C1MA 3D40A 3QVHA 3LKKA 1ZVPA 4KR6A 2WE5A 3K4OA 3D41A 2BMUA 2BTYA 3L86A 3ZZFA 4NDPA 3WWMA 4NDRA 4JZ7A 3L76A 3EK6A 3K52A 3T7BA 2J5TA 2A1FA 3ZZIA 4OLCA 4A7WA 4NDQB 2C5SA 1GS5A 3LDGA 2J0XA 4JZ9A 4KR7A 3TVIA 2AKOA 2OGXB 3TM5A 3S6KA 3D2PA 1OHBA 3NWYA 3LL9A 4NDOA 2JI5A 4F6TA 4AXSA 2RD5A 2X2WA 2R98A 1OH9A 3QURA 4NDPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZT A;  4NDR B;  2IJ9 A;  3ZZG A;  3AB2 A;  1B7B A;  3AAW A;  2R8V A;  2V5H A;  2WE4 A;  4JZ8 A;  3AB4 A;  3WWN A;  4USJ A;  1OHA A;  3LL5 A;  3C20 A;  3KZF A;  3U6U A;  1E19 A;  3QVF A;  2VA1 A;  4NDO B;  2HMF A;  2WXB A;  2V4Y A;  3K4Y A;  2J0W A;  4F6T B;  2CDQ A;  4I49 A;  2BNF A;  2BND A;  2W21 A;  4Q1T A;  2BNE A;  4A7X A;  2J4J A;  2BUF A;  2JJX A;  3C1N A;  3QUN A;  3B8G A;  3S6G A;  3EK5 A;  1ZHV A;  2F06 A;  2BRX A;  1YBD A;  1GSJ A;  1Z9D A;  2JJ4 A;  3QUO A;  2J4L A;  4NDQ A;  2AP9 A;  2J5V A;  4AB7 A;  3K56 A;  2BRI A;  3S6H A;  2OGX A;  2J4K A;  3D2M A;  3ZZH A;  2E9Y A;  3C1M A;  3D40 A;  3QVH A;  3LKK A;  1ZVP A;  2WE5 A;  3K4O A;  3D41 A;  2BMU A;  2BTY A;  3L86 A;  3ZZF A;  4NDP A;  3WWM A;  4NDR A;  4JZ7 A;  3L76 A;  3EK6 A;  3K52 A;  3T7B A;  2J5T A;  2A1F A;  3ZZI A;  4OLC A;  4A7W A;  4NDQ B;  1GS5 A;  2J0X A;  4JZ9 A;  2OGX B;  3TVI A;  2AKO A;  3S6K A;  3D2P A;  1OHB A;  3NWY A;  3LL9 A;  4NDO A;  2JI5 A;  4F6T A;  4AXS A;  2RD5 A;  2X2W A;  2R98 A;  1OH9 A;  3QUR A;  4NDP B; 
#chains in the Genus database with same CATH topology
 4KZT A;  4NDR B;  3TLJ A;  2IJ9 A;  3ZZG A;  3TMA A;  3V8V A;  3AB2 A;  1B7B A;  3AAW A;  2R8V A;  2V5H A;  2WE4 A;  4JZ8 A;  3AB4 A;  3WWN A;  4USJ A;  1OHA A;  3LL5 A;  3C20 A;  3KZF A;  3U6U A;  1E19 A;  3QVF A;  2VA1 A;  4NDO B;  2HMF A;  2WXB A;  2V4Y A;  2J0W A;  3K4Y A;  3V97 A;  4F6T B;  3TM4 A;  2CDQ A;  4I49 A;  2BNF A;  2BND A;  2W21 A;  4Q1T A;  2BNE A;  4A7X A;  2J4J A;  2BUF A;  2JJX A;  3C1N A;  3QUN A;  3B8G A;  4KR9 A;  3S6G A;  3EK5 A;  1ZHV A;  2F06 A;  3K0B A;  2BRX A;  1YBD A;  1GSJ A;  1Z9D A;  2JJ4 A;  3QUO A;  2J4L A;  4NDQ A;  2AP9 A;  2J5V A;  3LDU A;  4AB7 A;  3K56 A;  2BRI A;  3S6H A;  2OGX A;  2J4K A;  3D2M A;  3ZZH A;  2E9Y A;  3C1M A;  3D40 A;  3QVH A;  3LKK A;  1ZVP A;  4KR6 A;  2WE5 A;  3K4O A;  3D41 A;  2BMU A;  2BTY A;  3L86 A;  3ZZF A;  4NDP A;  3WWM A;  4NDR A;  4JZ7 A;  3L76 A;  3EK6 A;  3K52 A;  3T7B A;  2J5T A;  2A1F A;  3ZZI A;  4OLC A;  4A7W A;  4NDQ B;  2C5S A;  1GS5 A;  3LDG A;  2J0X A;  4JZ9 A;  4KR7 A;  3TVI A;  2AKO A;  2OGX B;  3TM5 A;  3S6K A;  3D2P A;  1OHB A;  3NWY A;  3LL9 A;  4NDO A;  2JI5 A;  4F6T A;  4AXS A;  2RD5 A;  2X2W A;  2R98 A;  1OH9 A;  3QUR A;  4NDP B; 
#chains in the Genus database with same CATH homology
 4KZT A;  4NDR B;  3TLJ A;  2IJ9 A;  3ZZG A;  3TMA A;  3V8V A;  3AB2 A;  1B7B A;  3AAW A;  2R8V A;  2V5H A;  2WE4 A;  4JZ8 A;  3AB4 A;  3WWN A;  4USJ A;  1OHA A;  3LL5 A;  3C20 A;  3KZF A;  3U6U A;  1E19 A;  3QVF A;  2VA1 A;  4NDO B;  2HMF A;  2WXB A;  2V4Y A;  2J0W A;  3K4Y A;  3V97 A;  4F6T B;  3TM4 A;  2CDQ A;  4I49 A;  2BNF A;  2BND A;  2W21 A;  4Q1T A;  2BNE A;  4A7X A;  2J4J A;  2BUF A;  2JJX A;  3C1N A;  3QUN A;  3B8G A;  4KR9 A;  3S6G A;  3EK5 A;  1ZHV A;  2F06 A;  3K0B A;  2BRX A;  1YBD A;  1GSJ A;  1Z9D A;  2JJ4 A;  3QUO A;  2J4L A;  4NDQ A;  2AP9 A;  2J5V A;  3LDU A;  4AB7 A;  3K56 A;  2BRI A;  3S6H A;  2OGX A;  2J4K A;  3D2M A;  3ZZH A;  2E9Y A;  3C1M A;  3D40 A;  3QVH A;  3LKK A;  1ZVP A;  4KR6 A;  2WE5 A;  3K4O A;  3D41 A;  2BMU A;  2BTY A;  3L86 A;  3ZZF A;  4NDP A;  3WWM A;  4NDR A;  4JZ7 A;  3L76 A;  3EK6 A;  3K52 A;  3T7B A;  2J5T A;  2A1F A;  3ZZI A;  4OLC A;  4A7W A;  4NDQ B;  2C5S A;  1GS5 A;  3LDG A;  2J0X A;  4JZ9 A;  4KR7 A;  3TVI A;  2AKO A;  2OGX B;  3TM5 A;  3S6K A;  3D2P A;  1OHB A;  3NWY A;  3LL9 A;  4NDO A;  2JI5 A;  4F6T A;  4AXS A;  2RD5 A;  2X2W A;  2R98 A;  1OH9 A;  3QUR A;  4NDP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...