2HMFA

Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
469
structure length
464
Chain Sequence
b'TTVMKFGGTSVGSGERIRHVAKIVTKRKKEDDDVVVVVSAMSEVTNALVEISQQALDVRDIAKVGDFIKFIREKHYKAIEEAIKSEEIKEEVKKIIDSRIEELEKVLIGVAYLGELTPKSRDYILSFGERLSSPILSGAIRDLGEKSIALEGGEAGIITDNNFGSARVKRLEVKERLLPLLKEGIIPVVTGFIGTTEEGYITTLGRGGSDYSAALIGYGLDADIIEIWTDVSGVYTTDPRLVPTARRIPKLSYIEAMELAYFGAKVLHPRTIEPAMEKGIPILVKNTFEPESEGTLITNDMEMSDSIVKAISTIKNVALINIFGAGMVGVSGTAARIFKALGEEEVNVILISQGSSETNISLVVSEEDVDKALKALKREFGDFLNNNLIRDVSVDKDVCVISVVGAGMRGAKGIAGKIFTAVSESGANIKMIAQGSSEVNISFVIDEKDLLNCVRKLHEKFIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable aspartokinase
publication title The initial step in the archaeal aspartate biosynthetic pathway catalyzed by a monofunctional aspartokinase.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 162
structure length 464
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.2130.10 Alpha Beta 2-Layer Sandwich VC0802-like VC0802-like 2hmfA02
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2hmfA01
2BNFA 1OH9A 3QVFA 4NDRA 2J5TA 1OHAA 1OHBA 4F6TB 4NDOB 2V5HA 3LL5A 3T7BA 4OLCA 2R8VA 1B7BA 2X2WA 3D41A 3C20A 3S6HA 2BUFA 3WWMA 3QUNA 3NWYA 2R98A 3QVHA 4NDRB 4JZ9A 2WE4A 1E19A 4NDPA 2J0WA 2V4YA 4NDQA 3ZZIA 2BMUA 2BRIA 2J4KA 2J0XA 3QUOA 2HMFA 3QURA 4JZ7A 2J5VA 3TVIA 2OGXA 4I49A 3ZZGA 2JJXA 2IJ9A 3AAWA 3S6KA 2A1FA 2BNEA 2BRXA 3KZFA 4AB7A 2RD5A 3D2MA 1YBDA 3K4YA 3K52A 3S6GA 3L86A 3K4OA 4NDOA 4NDQB 2J4LA 1Z9DA 2JI5A 1ZHVA 3C1MA 2VA1A 4KZTA 2WXBA 4AXSA 3LL9A 2AP9A 3WWNA 2JJ4A 4A7XA 2CDQA 3EK5A 3ZZHA 2BNDA 4JZ8A 3EK6A 2W21A 2E9YA 3L76A 3ZZFA 1GSJA 3D40A 2WE5A 4F6TA 4NDPB 2F06A 3D2PA 2AKOA 3LKKA 3B8GA 1GS5A 4A7WA 3U6UA 2OGXB 2BTYA 3K56A 1ZVPA 4USJA 4Q1TA 2J4JA 3C1NA 3AB4A 3AB2A
chains in the Genus database with same CATH superfamily
2BNFA 3LDUA 1OH9A 3QVFA 4NDRA 2J5TA 1OHAA 1OHBA 4F6TB 4NDOB 4KR7A 2V5HA 3LL5A 3LDGA 3T7BA 4OLCA 2R8VA 1B7BA 2X2WA 3D41A 3C20A 3S6HA 2BUFA 3WWMA 3QUNA 3NWYA 2R98A 3QVHA 4NDRB 2C5SA 4JZ9A 2WE4A 1E19A 4NDPA 2J0WA 3TMAA 2V4YA 4NDQA 3ZZIA 2BMUA 2BRIA 2J4KA 2J0XA 3QUOA 2HMFA 3QURA 4JZ7A 2J5VA 3TVIA 2OGXA 4I49A 3ZZGA 2JJXA 2IJ9A 3AAWA 3S6KA 2A1FA 2BNEA 2BRXA 3KZFA 4AB7A 2RD5A 3D2MA 1YBDA 3K4YA 3K52A 3S6GA 3L86A 3K4OA 4NDOA 3TM5A 4NDQB 2J4LA 3TLJA 1Z9DA 2JI5A 1ZHVA 3C1MA 2VA1A 4KZTA 2WXBA 4AXSA 3LL9A 2AP9A 3WWNA 2JJ4A 4A7XA 2CDQA 3EK5A 3ZZHA 2BNDA 4JZ8A 3EK6A 2W21A 2E9YA 4KR9A 3K0BA 3L76A 3ZZFA 4KR6A 1GSJA 3D40A 2WE5A 4F6TA 4NDPB 2F06A 3D2PA 2AKOA 3LKKA 3V8VA 3B8GA 1GS5A 4A7WA 3U6UA 2OGXB 2BTYA 3K56A 1ZVPA 3V97A 4USJA 4Q1TA 3TM4A 2J4JA 3C1NA 3AB4A 3AB2A
chains in the Genus database with same CATH topology
2BNFA 3LDUA 1OH9A 3QVFA 4NDRA 2J5TA 1OHAA 1OHBA 4F6TB 4NDOB 4KR7A 2V5HA 3LL5A 3LDGA 3T7BA 4OLCA 2R8VA 1B7BA 2X2WA 3D41A 3C20A 3S6HA 2BUFA 3WWMA 3QUNA 3NWYA 2R98A 3QVHA 4NDRB 2C5SA 4JZ9A 2WE4A 1E19A 4NDPA 2J0WA 3TMAA 2V4YA 4NDQA 3ZZIA 2BMUA 2BRIA 2J4KA 2J0XA 3QUOA 2HMFA 3QURA 4JZ7A 2J5VA 3TVIA 2OGXA 4I49A 3ZZGA 2JJXA 2IJ9A 3AAWA 3S6KA 2A1FA 2BNEA 2BRXA 3KZFA 4AB7A 2RD5A 3D2MA 1YBDA 3K4YA 3K52A 3S6GA 3L86A 3K4OA 4NDOA 3TM5A 4NDQB 2J4LA 3TLJA 1Z9DA 2JI5A 1ZHVA 3C1MA 2VA1A 4KZTA 2WXBA 4AXSA 3LL9A 2AP9A 3WWNA 2JJ4A 4A7XA 2CDQA 3EK5A 3ZZHA 2BNDA 4JZ8A 3EK6A 2W21A 2E9YA 4KR9A 3K0BA 3L76A 3ZZFA 4KR6A 1GSJA 3D40A 2WE5A 4F6TA 4NDPB 2F06A 3D2PA 2AKOA 3LKKA 3V8VA 3B8GA 1GS5A 4A7WA 3U6UA 2OGXB 2BTYA 3K56A 1ZVPA 3V97A 4USJA 4Q1TA 3TM4A 2J4JA 3C1NA 3AB4A 3AB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BNF A;  1OH9 A;  3QVF A;  4NDR A;  2J5T A;  1OHA A;  1OHB A;  4F6T B;  4NDO B;  2V5H A;  3LL5 A;  3T7B A;  4OLC A;  2R8V A;  1B7B A;  2X2W A;  3D41 A;  3C20 A;  3S6H A;  2BUF A;  3WWM A;  3QUN A;  3NWY A;  2R98 A;  3QVH A;  4NDR B;  4JZ9 A;  2WE4 A;  1E19 A;  4NDP A;  2J0W A;  2V4Y A;  4NDQ A;  3ZZI A;  2BMU A;  2BRI A;  2J4K A;  2J0X A;  3QUO A;  2HMF A;  3QUR A;  4JZ7 A;  2J5V A;  3TVI A;  2OGX A;  4I49 A;  3ZZG A;  2JJX A;  2IJ9 A;  3AAW A;  3S6K A;  2A1F A;  2BNE A;  2BRX A;  3KZF A;  4AB7 A;  2RD5 A;  3D2M A;  1YBD A;  3K4Y A;  3K52 A;  3S6G A;  3L86 A;  3K4O A;  4NDO A;  4NDQ B;  2J4L A;  1Z9D A;  2JI5 A;  1ZHV A;  3C1M A;  2VA1 A;  4KZT A;  2WXB A;  4AXS A;  3LL9 A;  2AP9 A;  3WWN A;  2JJ4 A;  4A7X A;  2CDQ A;  3EK5 A;  3ZZH A;  2BND A;  4JZ8 A;  3EK6 A;  2W21 A;  2E9Y A;  3L76 A;  3ZZF A;  1GSJ A;  3D40 A;  2WE5 A;  4F6T A;  4NDP B;  2F06 A;  3D2P A;  2AKO A;  3LKK A;  3B8G A;  1GS5 A;  4A7W A;  3U6U A;  2OGX B;  2BTY A;  3K56 A;  1ZVP A;  4USJ A;  4Q1T A;  2J4J A;  3C1N A;  3AB4 A;  3AB2 A; 
#chains in the Genus database with same CATH topology
 2BNF A;  3LDU A;  1OH9 A;  3QVF A;  4NDR A;  2J5T A;  1OHA A;  1OHB A;  4F6T B;  4NDO B;  4KR7 A;  2V5H A;  3LL5 A;  3LDG A;  3T7B A;  4OLC A;  2R8V A;  1B7B A;  2X2W A;  3D41 A;  3C20 A;  3S6H A;  2BUF A;  3WWM A;  3QUN A;  3NWY A;  2R98 A;  3QVH A;  4NDR B;  2C5S A;  4JZ9 A;  2WE4 A;  1E19 A;  4NDP A;  2J0W A;  3TMA A;  2V4Y A;  4NDQ A;  3ZZI A;  2BMU A;  2BRI A;  2J4K A;  2J0X A;  3QUO A;  2HMF A;  3QUR A;  4JZ7 A;  2J5V A;  3TVI A;  2OGX A;  4I49 A;  3ZZG A;  2JJX A;  2IJ9 A;  3AAW A;  3S6K A;  2A1F A;  2BNE A;  2BRX A;  3KZF A;  4AB7 A;  2RD5 A;  3D2M A;  1YBD A;  3K4Y A;  3K52 A;  3S6G A;  3L86 A;  3K4O A;  4NDO A;  3TM5 A;  4NDQ B;  2J4L A;  3TLJ A;  1Z9D A;  2JI5 A;  1ZHV A;  3C1M A;  2VA1 A;  4KZT A;  2WXB A;  4AXS A;  3LL9 A;  2AP9 A;  3WWN A;  2JJ4 A;  4A7X A;  2CDQ A;  3EK5 A;  3ZZH A;  2BND A;  4JZ8 A;  3EK6 A;  2W21 A;  2E9Y A;  4KR9 A;  3K0B A;  3L76 A;  3ZZF A;  4KR6 A;  1GSJ A;  3D40 A;  2WE5 A;  4F6T A;  4NDP B;  2F06 A;  3D2P A;  2AKO A;  3LKK A;  3V8V A;  3B8G A;  1GS5 A;  4A7W A;  3U6U A;  2OGX B;  2BTY A;  3K56 A;  1ZVP A;  3V97 A;  4USJ A;  4Q1T A;  3TM4 A;  2J4J A;  3C1N A;  3AB4 A;  3AB2 A; 
#chains in the Genus database with same CATH homology
 2BNF A;  3LDU A;  1OH9 A;  3QVF A;  4NDR A;  2J5T A;  1OHA A;  1OHB A;  4F6T B;  4NDO B;  4KR7 A;  2V5H A;  3LL5 A;  3LDG A;  3T7B A;  4OLC A;  2R8V A;  1B7B A;  2X2W A;  3D41 A;  3C20 A;  3S6H A;  2BUF A;  3WWM A;  3QUN A;  3NWY A;  2R98 A;  3QVH A;  4NDR B;  2C5S A;  4JZ9 A;  2WE4 A;  1E19 A;  4NDP A;  2J0W A;  3TMA A;  2V4Y A;  4NDQ A;  3ZZI A;  2BMU A;  2BRI A;  2J4K A;  2J0X A;  3QUO A;  2HMF A;  3QUR A;  4JZ7 A;  2J5V A;  3TVI A;  2OGX A;  4I49 A;  3ZZG A;  2JJX A;  2IJ9 A;  3AAW A;  3S6K A;  2A1F A;  2BNE A;  2BRX A;  3KZF A;  4AB7 A;  2RD5 A;  3D2M A;  1YBD A;  3K4Y A;  3K52 A;  3S6G A;  3L86 A;  3K4O A;  4NDO A;  3TM5 A;  4NDQ B;  2J4L A;  3TLJ A;  1Z9D A;  2JI5 A;  1ZHV A;  3C1M A;  2VA1 A;  4KZT A;  2WXB A;  4AXS A;  3LL9 A;  2AP9 A;  3WWN A;  2JJ4 A;  4A7X A;  2CDQ A;  3EK5 A;  3ZZH A;  2BND A;  4JZ8 A;  3EK6 A;  2W21 A;  2E9Y A;  4KR9 A;  3K0B A;  3L76 A;  3ZZF A;  4KR6 A;  1GSJ A;  3D40 A;  2WE5 A;  4F6T A;  4NDP B;  2F06 A;  3D2P A;  2AKO A;  3LKK A;  3V8V A;  3B8G A;  1GS5 A;  4A7W A;  3U6U A;  2OGX B;  2BTY A;  3K56 A;  1ZVP A;  3V97 A;  4USJ A;  4Q1T A;  3TM4 A;  2J4J A;  3C1N A;  3AB4 A;  3AB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...