1ERCA

The nmr solution structure of the pheromone er-1 from the ciliated protozoan euplotes raikovi
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
b'DACEQAAIQCVESACESLCTEGEDRTGCYMYIYSNCPPYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHEROMONE ER-1
publication title The NMR solution structure of the pheromone Er-1 from the ciliated protozoan Euplotes raikovi.
pubmed rcsb
source organism Euplotes raikovi
molecule tags Pheromone
total genus 14
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1994-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06360 E_raikovi_mat Euplotes raikovi mating pheromone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.10 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 1ercA00
2ERLA 1ERCA
chains in the Genus database with same CATH superfamily
2JMSA 1DDEA 2KK2A 4EDKA 2KC6A 1ERCA 2NSWA 3KLSA 3KXRA 4E2KA 4EDRA 2LMKA 2ERLA 2B39A 1DD9A 3B39A 3CU7A 2NSVA 1EQNA 4EDTA 2AU3A 4EE1A 4EDGA 4EDVA
chains in the Genus database with same CATH topology
2JMSA 1DDEA 2KK2A 4EDKA 2KC6A 1ERCA 2NSWA 3KLSA 3KXRA 4E2KA 4EDRA 2LMKA 2ERLA 2B39A 1DD9A 3B39A 3CU7A 2NSVA 1EQNA 4EDTA 2AU3A 4EE1A 4EDGA 4EDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERL A;  1ERC A; 
#chains in the Genus database with same CATH topology
 2JMS A;  1DDE A;  2KK2 A;  4EDK A;  2KC6 A;  1ERC A;  2NSW A;  3KLS A;  3KXR A;  4E2K A;  4EDR A;  2LMK A;  2ERL A;  2B39 A;  1DD9 A;  3B39 A;  3CU7 A;  2NSV A;  1EQN A;  4EDT A;  2AU3 A;  4EE1 A;  4EDG A;  4EDV A; 
#chains in the Genus database with same CATH homology
 2JMS A;  1DDE A;  2KK2 A;  4EDK A;  2KC6 A;  1ERC A;  2NSW A;  3KLS A;  3KXR A;  4E2K A;  4EDR A;  2LMK A;  2ERL A;  2B39 A;  1DD9 A;  3B39 A;  3CU7 A;  2NSV A;  1EQN A;  4EDT A;  2AU3 A;  4EE1 A;  4EDG A;  4EDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...