2EWJA

Escherichia coli replication terminator protein (tus) complexed with dna- locked form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
305
structure length
305
Chain Sequence
DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular mousetrap determines polarity of termination of DNA replication in E. coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication/dna
molecule keywords 5'-D(*T*TP*AP*GP*TP*TP*AP*CP*AP*AP*CP*AP*TP*AP*CP*T)-3'
total genus 82
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2005-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05472 Ter DNA replication terminus site-binding protein (Ter protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.10 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 2ewjA02
3.50.14.10 Alpha Beta 3-Layer(bba) Sandwich Replication Terminator Protein (Tus); Chain A, domain 1 Replication terminator Tus, domain 1 superfamily/Replication terminator Tus 2ewjA01
4XR3A 4XR1A 4XR0A 4XR2A 1ECRA 2I06A 2I05A 2EWJA
chains in the Genus database with same CATH superfamily
3WQZA 4XR3A 3RFNA 1WNUA 2EWJA 1TKEA 1TKYA 1V4PA 1WXOA 2ZTGA 1QF6A 3RHUA 4XR0A 1TKGA 4XR2A 2ZZGA 1V7OA 4XR1A 1ECRA 2I06A 2ZZEA 2I05A 2ZZFA 1TJEA
chains in the Genus database with same CATH topology
3WQZA 4XR3A 3RFNA 1WNUA 2EWJA 1TKEA 1TKYA 1V4PA 1WXOA 2ZTGA 1QF6A 3RHUA 4XR0A 1TKGA 4XR2A 2ZZGA 1V7OA 4XR1A 1ECRA 2I06A 2ZZEA 2I05A 2ZZFA 1TJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XR3 A;  4XR1 A;  4XR0 A;  4XR2 A;  1ECR A;  2I06 A;  2I05 A;  2EWJ A; 
#chains in the Genus database with same CATH topology
 3WQZ A;  4XR3 A;  3RFN A;  1WNU A;  2EWJ A;  1TKE A;  1TKY A;  1V4P A;  1WXO A;  2ZTG A;  1QF6 A;  3RHU A;  4XR0 A;  1TKG A;  4XR2 A;  2ZZG A;  1V7O A;  4XR1 A;  1ECR A;  2I06 A;  2ZZE A;  2I05 A;  2ZZF A;  1TJE A; 
#chains in the Genus database with same CATH homology
 3WQZ A;  4XR3 A;  3RFN A;  1WNU A;  2EWJ A;  1TKE A;  1TKY A;  1V4P A;  1WXO A;  2ZTG A;  1QF6 A;  3RHU A;  4XR0 A;  1TKG A;  4XR2 A;  2ZZG A;  1V7O A;  4XR1 A;  1ECR A;  2I06 A;  2ZZE A;  2I05 A;  2ZZF A;  1TJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...