1TKGA

Crystal structure of the editing domain of threonyl-trna synthetase complexed with an analog of seryladenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Threonyl-tRNA synthetase
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tkgA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tkgA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tkgA02
3B2FA 1TKEA 3SFEB 2CJOA 3NVVA 1KFYB 5G5HA 2W3RA 4ZHOA 2JQRB 1ZOYB 4C80A 1NI3A 3RFNA 1QOBA 2W55A 2KMMA 5G5GA 1VJKA 1ZXIA 3L4PA 3P4PB 1RWSA 4IDIA 3B2GA 3ZYYX 1NVID 3W5VB 1QOGA 3EUB2 1YQ3B 1V4PA 3NVYA 4HROA 2G1EA 1AWDA 1OFFA 2Q5WD 1L5PA 3AEGB 1NEKB 3AM9A 2LEKA 1CZPA 1F0ZA 5EE9A 5AUIA 1QOFA 3WQZA 3FC4A 2WDVB 1N5WA 3AE3B 3NVWA 2M19A 1B9RA 3PO0A 1UWMA 2BS3B 2WQYB 1TKYA 2WDRB 4JWSC 4N58A 2BT6A 3AEEB 4YSZB 1FRRA 1WXOA 1I7HA 1N61A 1T3QA 2PVGC 1CJEA 2WDQB 3HUIA 2QIEB 2KAJA 3NVZA 4A9AA 1NYQA 1L6VA 4ZHPA 1WGKA 1SB3C 3WCQA 3ETRA 4JWUC 3AEFB 3FAHA 2E1BA 1JALA 2CU3A 3P1MA 5EE0A 5H8YE 1FFUA 1E9MA 1PDXA 3AE6B 5C3JB 3RHUA 1DOIA 3AEDB 1PUTA 1ZUD2 1RFKA 1XLOA 1FRDA 2N0SB 3VR8B 2DBYA 2EKIA 4JX1C 2PKOA 5EE3A 4YTMB 2ZZGA 1RYJA 1WXQA 1E6EB 1ROEA 4KX6B 3DWMA 4C7YA 1JQ4A 4N6EB 2W54A 1JROA 3DWGC 1XLNA 1QF6A 1QT9A 2HTME 1YJJA 2FBWB 3ABVB 1AYFA 3W9CB 1WWTA 5AUKA 1VLBA 5H92C 2B76B 3HRDD 3CIRB 1E0ZA 3KWLA 5GXGB 3AMZA 3VR9B 1DGJA 3AEBB 1NYRA 4LTUA 2OHFA 4US8A 4N59A 1XLQA 1N63A 1VDVA 2H88B 2K9XA 3AH7A 3AE7B 1V7OA 4C7ZA 1PFDA 1V8CA 4WWMA 3SFDB 1FXAA 1WRIA 1E7PB 2ACZB 5EE1A 2WU5B 4WQMA 4ZOHC 1TYGB 1J7BA 1L6UA 2DWQA 4HRSA 3BIID 4FXCA 1ZP0B 2WLBA 2MJEA 1OQRA 1XLPA 1YQ4B 2WU2B 3SR6A 2ZTGA 3KEWA 1N5XA 1XO3A 2H89B 3LB8C 4US9A 1EWYC 2MJDA 3LXFA 4ITKA 2M56B 3CWIA 2QJLA 1DOXA 1JRPA 1QLBB 2L83A 1J7AA 2BS2B 3NRZA 1WNUA 4USAA 2ZZFA 2W3SA 3VRBB 3AV8A 1QOAA 4P6VF 1GAQB 1JW9D 1IUEA 1FM0D 3AN1A 2PVOD 3AECB 1YJIA 4YT0B 1FIQA 1JWBD 2K22A 3P63A 1DOYA 1V97A 4YSYB 2CJNA 2WS3B 2ZZEA 1L0VB 1R7SA 1RM6C 4YSXB 1OQQA 3VRAB 1WYGA 1FXIA 4YTPB 1FFVA 1E10A 1A70A 4YXDB 1TKGA 3P4SB 2JX5A 3HVZA 1SF0A 3AE9B 1JWAD 1N60A 2E3TA 2WP9B 5C2TB 1N62A 2K5PA 3P4QB 3RPFC 1J7CA 3NS1A 3AE2B 2L52A 3AB5A 3AE4B 2Y5CA 3AE8B 1SIJA 1TJEA 2PIAA 3AE1B 1KRHA 2BS4B 3W5UB 2AX5A 3P4RB 4YTNB 3AE5B 5MPOA 1FO4A 1GPXA 2MJ3A 3B9JA 1KF6B 1FMAD 3AEAB 1NENB 2MH7A
chains in the Genus database with same CATH superfamily
3B2FA 4CI3A 3A1QA 4HDQA 1JWMD 4PK1A 3QA8A 3NVVA 3BINA 3ZW3A 2GBKA 3U7ZA 1CMXB 3BK2A 2L0TA 3ZJVA 1NVID 2KTRB 4HROA 5JHAA 4KVGB 2AL6A 5BMIA 1F1HA 1MI0A 1V5OA 2I1JA 1OGWA 4C4VB 4KKJA 2DAJA 1OEYJ 2VH2A 4YSZB 3HUIA 2MRPA 3KVFB 3L54A 4KSKC 3TJPA 4ZHPA 1MPEA 1P98A 1AW7A 1SIFA 1XLOA 2L05A 1KLUD 3I8CA 4C7YA 3T3OA 1XLNA 1AYFA 4LNKA 2IYDB 4LDTB 2CU1A 3TEYA 3BVMA 3B08A 1UBIA 4CI1A 4II2B 1V7OA 2WXQA 4PT5A 2KDIA 2JF5A 2AEHA 2WU2B 5BYQA 3MJWA 3LB8C 1ZW7A 3APFA 2DLBA 2WHIA 2WXGA 3VQIA 1V5TA 2ZCBA 1EO6A 3RI7C 3VRBB 4DBGA 1NDDA 1NBFC 1E90A 4UDUC 1YJIA 1FIQA 2JZPA 1V2YA 3R3MA 2KACA 2BF8B 2L00B 4MSQB 2Y3UA 1JCKB 2L32A 4IKGA 1SJHD 2PPHA 3RN9C 3RPFC 3VHTC 2C5LC 2LXAA 2BS4B 3P4RB 2FCQA 3R8BA 1L0XB 1J19A 4CYEA 4S0RA 5TR5A 1WE7A 4RGOS 2N1WA 2WGSA 4E3CA 2KWUB 4DDGD 3BWUD 1YN3A 3EUB2 2WXJA 1UD7A 1L5PA 2MCNB 2GMIC 3RYTA 2BS3B 3APDA 2HE7A 2K8CA 4M8MA 2KQ4X 2CHWA 1YX5B 2IDYA 5IO9A 3MFGA 1DOIA 1PUTA 1KTKA 3VR8B 5CTRC 4YTMB 2MA9B 2I05A 1JROA 4AP4C 4BKTA 3ABVB 5FQDA 1HTQA 4MJSA 3VAWA 3ZUPA 4TMAB 1ZKHA 4BVUC 2K8HA 1FD6A 4IOIE 2XK5A 4DDID 3KW5B 1K51A 2LD9A 3AH7A 4GMVA 2A4ZA 4HXDA 4HRSA 3L0WB 3GE8C 4W9DA 3EHVA 2KOXA 1UGJA 1TTNA 2KMAA 3AN1A 1FM0D 4NQKE 2AWTA 2JXTA 3EA6A 1UBQA 1WJ6A 2XN9C 2JXXA 4KGSA 2OEDA 4A09A 5D3DA 2KWVB 4LNOA 1WI0A 1A70A 2JWUA 1WGGA 1TKGA 4XGAB 2G9HD 1WM2A 2FE8A 3AE9B 2KANA 3RMKC 3NHEB 4WWOA 3PS6A 2ONQA 4IW0A 2FCNA 2Y5CA 2B5MA 1FPYA 3QARA 1SIJA 1D5MC 4WAFA 2ON8A 2GBRA 4LJPB 1C3TA 2MBOA 5CHWA 3IBEA 3GP7A 1XCQL 4K7UA 4GOCA 1TBEA 3DBHI 4BKGA 5G5HA 2W3RA 1I4XA 4K3BA 1NI3A 3UF8A 1ZXIA 1HZ6A 4KKIA 4IDIA 2RSUA 3R7QA 4RGMA 2X8XX 3RNAC 4PYZA 5JHBA 1S1QB 3ZNID 2WX1A 3UIPB 1WRDB 2N9PC 1JRUA 2ZVNA 2MBEA 3IVFA 3KYDD 1LGRA 3H6NA 5IAAC 1WX7A 3TCAA 3I7OA 3I7LA 1FRDA 1PQSA 2G3QB 4W9KA 2D11A 1CK1A 3W9CB 2B76B 2KJRA 2RGFA 1NYRA 4LTUA 2MBQA 2R2OA 4NY0A 4REZA 4ZYNA 2OOBB 2WXKA 2IUSA 2KDFB 4GXBA 1FXAA 3JYUA 3VUWA 1WZ0A 4I6PA 4ANXA 4BZAA 2DHZA 4KIKA 1NI2A 3NJTA 3CWIA 4FHKA 3QAQA 2KLGA 4KV2A 1GAQB 1JW9D 1ZXHA 2ZW0A 1WZCA 2ZZEA 5T8IA 2KJHB 3O13A 1FCLA 5LNK1 3DHHC 4NAMA 2AYOB 5DPWA 3VVWB 3DPDA 2IO2B 2INDC 5KHQA 4WWNA 1WF9A 4KZCA 2ZCCA 2M0XA 2L52A 1EM7A 3ZRCA 1YX6B 2OJRA 2LFIA 4IM2A 3NZSA 5MPOA 1FO4A 2LVQA 1KLGD 2KC1A 1T6BX 3GS2A 5CX3A 4IWPA 5KHOA 3L4PA 5D94A 1RWSA 4B0MA 2YEPB 1SE4A 2EMTA 2J0JA 1AWDA 1OFFA 2Q5WD 3Q3OC 3AM9A 4CHKA 2KLCA 2VH1A 3L10B 3VUXA 4I6LB 3RD2A 1UWMA 1SEBD 4M00A 1ENFA 1A5RA 4RGNA 3SHQA 4XWWA 4RF0A 5IKCM 2BKRB 3ETRA 3PZDA 1PDXA 3RHUA 2PE9A 4XWTA 1PGBA 3AEDB 3EGRA 4MDKE 1F52A 1OQYA 4A55A 2W54A 4X57B 1QF6A 3N9YC 3KH0A 2IBIB 4GDLB 2K6DB 1V86A 3MTNB 2O6VB 1Z5SB 2J0KA 2K9XA 3LJ3A 1STEA 4DQOC 2JVCA 4MH8A 3SFDB 4A3PA 2ACZB 4A90A 3SD5A 1TYGB 5EDSA 4OZBA 4EUTA 1WSPA 1J8CA 2ZNVB 4XZ4A 3OLMD 2M56B 3VDZA 1GB1A 2G4SA 2L83A 3TBLD 3NRZA 1ACCA 3IXSA 4HPMB 4IWQA 1RM6C 5HI1A 1OEYA 3OWEB 1WXSA 3ML8A 1I35A 1KJTA 1P7EA 4W9JA 4GB9A 4OVZA 5LLIA 3W5UB 3I57A 3QHTA 2BB5A 1XEEA 2NBWB 1KF6B 4DHZE 3I89A 2KQSA 1P0RA 4AR1A 2GB1A 4DHZB 1TS4A 5J18A 1M94A 3RZFA 3GZNB 3PTFC 2KFKA 1ZPSA 3P4PB 1YN4A 3I8EA 2BYVE 4HDOA 2N9EB 4RM8A 4JE3B 2YEPF 2NMQA 3RFZB 1EF5A 2LVOA 1NEKB 1WXMA 3I9V1 4NJ6A 4IUMB 4JGHB 4C56C 1PGAA 2PE6B 5AZFA 3H7SA 2IY1B 1NYQA 1TT5B 2HJ8A 2KQ7A 3IAM1 2BB6A 1D5XC 3M63B 4G0NB 1R4NI 2R61A 1GB4A 1ZUD2 2QHOA 4AR8A 3T3NA 2JWZA 1UGMA 3ZLZA 3OAWA 2PTLA 2XK5B 2FIFA 3ALBA 3A33B 1C78A 1SXTA 4OHJA 2IGGA 4XR3A 1VCBA 1SBBB 4EZLA 3CSTA 3W2DA 1GC6A 3DBLB 2W9NA 3R2TA 2BW2A 3AE7B 4ZRJA 4C7ZA 5J17A 4HLEA 5EE1A 1YNTE 1TIFA 2IZVB 3Q8EA 3B0AA 3A9KB 2KWCA 1WR6E 4ASWC 2MSED 3I3TB 1JRPA 3ZDTA 2AQ3B 2NTSA 2Y5PA 2RDBC 1R7SA 1D4BA 4YTPB 1E10A 2BQQA 1C4CA 3ML9A 3RNEC 3BYYB 3ZJTA 2NS5A 2XBBC 2XNAC 2KXJA 4A0AA 3UQAA 3QWZB 1KM7A 4C4VA 3Q2AC 2BKFA 3Q69A 3AEAB 4WIPA 4JQWC 1WFYA 1MJDA 2MW5A 1ZOYB 1QOBA 2V0GA 4WAAA 4II3B 1XD3B 3R7RA 2WXIA 3L08A 3Q3JA 1QOFA 2JPHA 1EF1A 1ZGUB 2M19A 2BBCA 1WJNA 1TKYA 2AL3A 3AEEB 3H1UA 1XVIA 3TEZA 2JSVX 2KX3A 3ZNGC 4A9AA 2M4NA 3ZJUA 4RF1A 1E8XA 1JALA 2CU3A 5H8YE 3ZNZB 1E9MA 4E71A 2LGDA 4JX1C 2KWDA 4W9HA 2QMTA 2NPTB 2G45B 5FR6A 3ZWKA 4S17A 1MVKA 1K53A 3SDLC 3N1YC 1E0ZA 2ICIA 3C19A 3IHPC 3ZIMA 2JU6X 2C7MB 3WALA 3EFCA 4N59A 3RNBC 4XR0A 3UGBB 1I4PA 3MP9A 3N30A 2C7NB 3UQBA 1E7PB 1HE8A 3B1LX 3ZDMC 4HPLB 4WJQA 4M0WB 1SJED 1XO3A 3HHMA 1KLVA 1DOXA 2AQ1B 2D5GA 4AREA 2IGDA 1IP9A 4XYCA 3ZW7A 1ESFA 3HVZA 2MP2A 1WGDA 5HG2A 5GMVA 4GDKA 3NZUA 2AQ2B 3WIMA 2WXLA 4W9LA 2KX0A 1WXAA 4W9FA 1WIAA 3KLSX 1I4HA 3JSVB 3W1YA 3B9JA 4RM9A 2BTEA 4CO7A 1WH3A 4NQLB 4C80A 4GSWA 2VRRB 3Q3FA 1HEZE 2YVCA 3MC9A 3VTWA 3FC4A 4BFRA 1B9RA 4AQ7A 4EKUA 2IUUA 5JZEB 3PRMB 1FNUA 4E54A 3Q3MC 2NCNA 3PHXB 3Q8FA 3AE6B 2HJ1A 4BAXA 3ECIA 3S2AA 2PKOA 3V6CB 4XX5A 4P16A 2LGYA 3DWMA 3KQ4A 4F8CB 1QT9A 1QZEA 3PVLA 2N7JA 2B3AA 2K25A 3A9JB 3BY4B 3ZNHB 1F9JA 2N9KA 2MP2B 1V1PB 2L76A 1WRIA 4DXFA 3HM6X 2WU5B 5HKHA 2KVZA 2GBNA 5D3IB 4NJ7A 1YQ4B 1F77A 2FCSA 4ANUA 1E8ZA 4RNAA 3DCGA 1UNSA 2N9LA 4K81A 2ZZFA 1QOAA 4JL9A 3DBHB 1P1AA 4XDCA 2EKEC 1FNVA 2DZIA 3RNCC 1JWAD 1N60A 2WP9B 2ZPNA 1N62A 3AB5A 3U52E 2NR2A 1TJEA 4KSLC 3V05A 2V3PA 1GPXA 1FMAD 3L16A 1JWUD 3DBRI 1WXVA 2IO1B 2GBJA 4KZ0A 3Q8BA 4HCNB 5DPRA 4C00A 1TGZB 3W5VB 3MHSD 1YQ3B 2PMVA 3NVYA 3QC8B 1UZXB 1ISNA 3MHZA 1RRBA 5E6NA 1VZ6A 3Q14C 4N58A 1MFWA 1E8YA 2WQYB 1SSNA 3PLVA 1EU4A 4LLGM 2DYOA 3Q6BA 2UWQA 2INPE 1WGKA 1SB3C 3A9KA 3C8YA 1PYWD 3FAHA 1Q10A 3ZTCA 4TSSA 2N0SB 5IP4D 3RUIB 4EEWA 2IPKD 2V3SA 3CF6E 3IAS1 3QQ8B 4XR1A 1T0SC 3DWGC 2FBWB 3HVDA 3AULA 4EE2A 3HRDD 4MGZE 3VR9B 3QX1A 2MQJA 3W1SA 2WNMA 4M02A 5C23A 3QK0A 1PFDA 1WGYA 2WYQA 4AJYB 3E56A 4BBNC 4AWJA 1F2RC 2IY0B 4P1CC 2UYZB 1N5XA 2EELA 2DAFA 3WANA 1T0YA 3EECA 4XC2A 5L83A 1ECRA 3DDCB 1WNUA 4USAA 1GJZA 2K3UA 1DOYA 3Q8AA 1TS5A 4YSXB 4OZCA 4AOFA 3UIOB 2HD5B 3T8MA 1X1MA 3KUDB 2HDEA 1SE3A 4EFOA 1Y8RC 2N7DA 3QJZA 4LJOB 2KYWA 4I6NB 2K6QA 3AE1B 2LJ5A 3TEWA 3NUHB 1WZ3A 4W9EA 3RNGC 4A6QA 1XQQA 3PZ8A 2RDGA 2KTRA 3NS8A 4IM3A 2G4DB 4ZRKA 2KC2A 2FAZA 3FILA 4GN1A 3PGEA 1ET9A 4IG7B 2JRIB 1R4MI 2TSSA 3WQZA 1N5WA 3H7PA 3UI3A 2I1KA 5BMGA 4JWSC 2IGHA 2B5LA 5D7GA 4AS1A 2BT6A 4NNJB 2QIEB 3TEXA 1AARA 4H2AA 5EE0A 2VZKB 3H9DA 3FKYA 2XEWA 2LWPA 2LGXA 3JW0X 4WWPA 1D3ZA 1LFDA 4URKA 1WE6A 3UINB 3A9JA 2REXA 4K1RB 3CIRB 1WM3A 3GZNI 2E6XA 3BZDB 5DCNA 1WY8A 5DPSA 4LNNA 1V8CA 4IM0A 4FXCA 4NAWA 1ZP0B 2JY6A 1BT0A 3EI1A 5IOIA 3EI3A 4FULA 2H89B 4ITKA 1SE2A 2WXFA 3U4EG 3OJ4B 3I7HA 1IUEA 3AECB 4ACFA 5HHDG 2WXPA 3CSFA 4YSYB 2WS3B 4GGQA 2KDMA 1WR1A 2K39A 2LJIA 5AZHA 1FFVA 1YIWA 4AR9A 4FHJA 4DWFA 2KDBA 4PS7A 1L7YA 3A4SC 1C1YB 5BMHA 1I4GA 3N1XC 4P7IA 4HJKA 1L4ZB 4W9CA 4IWOA 2WXHA 4A08A 4L2YA 4FJYA 4MELA 4RCOA 2CJOA 1IGCA 2ZJDA 3VTUA 4ZHOA 5IN7A 2JQRB 2KHWB 2K0PA 1C9FA 5LXHA 4CQNA 3OJ3A 2MBHA 1ET6A 1JWSD 4O1NA 3AXCA 3WAPA 2MWSB 3TMPB 1WJUA 1I7HA 3MC0B 4KIKB 1CJEA 4M0WA 4MM3B 2KAJA 1TY2A 4ZRIA 4GDKB 2DX5B 2MHJA 4B6WA 3PHWB 1M4VA 1R4NB 3BVGA 3U7DA 3BYTB 2V4LA 1RFKA 3RNFC 1FNWA 3A1QB 4WH4A 2WXMA 2N4FA 3T9LA 4A8XC 2Y50A 2W82A 5H92C 2KZRA 3EFUA 3KWLA 4MT5A 2ASQA 2RD0A 5LXIB 3U30A 2HTHA 1XLQA 2DENB 3RT3B 2LZ6A 2JZ3B 4XE0A 5I4DA 4G11A 1LXDA 2DWQA 2GOWA 2GLSA 3SR6A 2JUOA 3ZU6A 3RCZA 2W3SA 1EWCA 2Z8LA 3X0WA 2L3ZA 4DHJB 1P7FA 3KYCD 2KDEB 3APCA 4BKSD 4YXDB 3ZO5B 3KWVA 4HKQA 4HVBA 2ZVOA 3E0CA 2LHEA 5DPTA 1FXTB 2J0MA 1L4DB 1B1ZA 1TY0A 1Y56A 2C9WB 3DBSA 3PRPB 2AX5A 3HM3A 5FR3A 1J0GA 3AE5B 3GB1A 1XF5L 2LUEA 2MH7A 3D32A 2ZOSA 3I7NA 3CMMB 2K8BA 3FILB 4D2KA 1E7UA 2KT7A 2LEKA 1CZPA 5EE9A 2N1VA 1SGHA 2Z0DB 3PO0A 2KMCA 2WDRB 2VZKD 4BKSA 1EU3A 1FRRA 2D3AA 1T3QA 2RPQA 4ICVA 4XDDA 3WCQA 3N3KB 1FFUA 3WA0A 3JVZX 3I5JC 2DBYA 2J53A 2DZJA 1K8RB 2N7EA 4ZRQA 1ZDXA 2HTME 2SAKA 1WMHA 3K9PB 1QKZA 1WWTA 3ZX4A 1VZ7A 2IO3B 2NBUA 5CHFA 1V6EA 1AN8A 1N63A 2MEKA 1YMHE 3VUYA 4WQMA 4ZOHC 3SEBA 1G6JA 2CKHB 1XLPA 2RPVA 3ZUNA 3QCAA 2EMSA 4P1BC 4PYUA 5C1ZA 4ZYSA 2ZPYA 1V97A 2NPTA 1HQRD 3K9OB 4HJGE 1C4PA 1OQQA 2LVPA 2NVUI 1WYGA 4MEMA 4WURA 4FJVB 3VXWA 3KUCB 3NY5A 3AE2B 3ZGZA 1I42A 3AU5A 5BYSA 4RMAA 1V9JA 2Z0EB 3MC8A 2D3BA 1BUIC 2PIAA 4PS3A 4F7ZA 2D07B 2BYTA 3KUZA 5FK9C 4A20A 4J6IA 4LDTD 4RH6A 3SFEB 5E6PA 2A5UA 1MHHE 3V3XA 2W55A 1V80A 2KMMA 5G55A 4HK2A 1UH6A 1V4PA 1LM8B 3AEGB 3EC8A 1L0YB 2KJ6A 2WDVB 4ANWA 1UELA 1YD8U 4FLHA 4LK0M 2V4IB 1D5ZC 2PVGC 1T0RC 1IGDA 1GC7A 2R2QA 2KFKB 4LNIA 1ZDVA 4XR2A 3ZKJC 2GI9A 5EE3A 2CS4A 1DYQA 4B95A 1JQ4A 3PSEB 2BVCA 4ANVA 4ARCA 2QILA 1ZE3D 1IYFA 1EUVB 1Q5WB 2JYTA 4G3XB 2D2QA 2OHFA 4RGTA 4GLSC 4TZ4A 1V1PA 5D6JB 2DZMA 2LMCA 3ENEA 2FUHB 3BIID 2O6VA 1C76A 2WLBA 4R3DA 2MJEA 2V1YA 5AEKB 3PT2B 1EWYC 2BS2B 3TIXA 3W1SC 4WJPA 1HXYD 2D3CA 1S3SG 3P63A 2J7QB 4KDIC 1UUPA 2MLBA 3VH4B 4L23A 2M8SA 3IFWB 3DBLI 2QSDA 2K5PA 2J42A 3V60A 4YWGG 2LRWA 1KRHA 4YTNB 1WYWB 1KOTA 2I2YA 4BBNF 3DHIC 3BVZA 2O6VD 1H4RA 4ARFA 4LCDE 4M8NA 3AU4A 3ZYYX 3C0RB 1E5WA 3BK1A 4FA6A 2PEAA 1WGRA 4L1BA 1F0ZA 3EI2A 5IA7A 4QAYA 3AE3B 4OVUA 2QCZA 3L13A 3NG0A 3WAMA 1N61A 3PRZA 1PGXA 2WDQB 1GUAB 1C4AA 4JWUC 1C77A 3AEFB 2E1BA 3R2IA 5D2MB 2WDTB 5TSSA 3N20C 1GG3A 1WXQA 3V62A 4KX6B 2HYEA 2MX2A 5L95C 2ZW1A 3ZRFA 3ZVVA 2KD0A 2NTTA 1I4QA 2RDHA 3HK0A 3AEBB 4NAWB 4HCPB 2CHXA 1C79A 2IUTA 2KNBA 4B9KA 4Q2JA 2UU7A 1J7BA 1L6UA 3L17A 3Q3NC 4BOSC 4AUQC 3DBRB 2IO0B 2LGIA 4NPNA 3LXFA 4WJOA 1P9DU 1VZ8A 4DXAB 1XXGA 2I06A 3AV8A 2I38A 4YT0B 2PVOD 1JWBD 2KN4A 1XT9B 1UF0A 2INCC 3IG3A 2WXNA 3DOWA 3SU8X 1WJ4A 2CR5A 3DVGX 2KFJA 4FADA 3ZTWA 1SF0A 3ZXRA 3RULA 2LASA 2E3TA 1MG4A 2J4XA 4E5ZA 3LYYA 3P4QB 4K7SA 2L7RA 1LO5D 3H7PB 2K1FA 2BYEA 2MJ3A 3OG5A 3PREA 1BXTA 3TL5A 4WQOB 5E6OA 4JPSA 3RFNA 2LRUA 2DZKA 2OJWA 4F1SA 2BWES 3NZ3A 2M0AA 4MM3A 4A3OA 2G1EA 1TS2A 2PLPA 4MSMB 1V1OA 3P2BA 4DK5A 4HEA1 3URYA 3P42A 4TKNA 3JSVA 2BGFA 2M1MA 2NBVB 2WX0A 2ZEQA 4A0BA 3NVZA 1L6VA 2ZZPB 3I63C 4FN2A 2INNE 2BYFA 3P1MA 5C3JB 3PZ7A 1OTRB 2Y6IA 5E6JA 1E6EB 1ROEA 4N6EB 3VFKA 2O2VA 1VLBA 2LHDA 2KKCA 2Y3AA 4US8A 4DHJD 1VDVA 2Z59B 3TUOA 1E7VA 3DVNU 3M3JA 3N32A 1Z2MA 2KN5A 4WWMA 3IT6B 3EI4A 1FEHA 3GOEA 2BWFA 2D3GA 3KEWA 1HA5A 1U4AA 1IPGA 1VD2A 2GRIA 2LXCA 2QJLA 1QLBB 1IBXB 1J7AA 2EWJA 4P6VF 1YQBA 2JT4B 3DHGC 3Q8CA 3DVGY 2BPSA 1YN5A 4E74A 3DVNV 2LI5A 1LQBA 5FKAC 3ZX5A 2JRHA 4MACA 1MG8A 1TZ1A 2MBBB 2L1AA 1BMLC 1WX9A 1J7CA 3DQVA 4M01A 3AE4B 3AE8B 2FIDA 4ICUA 4OZAA 1E8WA 4OVVA 2X38A 2WWZA 4MJSB 1MHXA 3WAOA 2V9HA 2SEBD 1NENB 2KTFA 1KH0A 3PLUA 2ZNVC 4IC7B 5G5GA 3ZTDA 2KK8A 4K3CA 3B2GA 1QOGA 4RFBA 5BYRA 3A4RA 3IT4B 1HTOA 4YL8A 5AUIA 4W9IA 1VRAB 3ONSA 2WXOA 3TSSA 3ZTYA 2PJHA 3M62B 1CQVA 4MGKE 1IBXA 1WXOA 4GIVA 1H8CA 2C7HA 3MJ5A 2GBMA 1SE9A 4GU2A 3U8ZA 2FUG1 3V61A 2V3NA 1VR9A 1FCCC 3ZWDA 4K7WA 3I7PA 2KO3A 2WXRA 5GXGB 2L0FA 3AMZA 1DGJA 3H8HA 3QIJA 3I7KA 2H88B 4CI2A 1N6ZA 2J52A 3VTVA 1V81A 2FNJB 2QEJC 2QC8A 1K50A 2CHZA 1YJ1A 4GDLA 4US9A 2MJDA 4EOYA 4NZLB 1WGHA 2JYEA 2L8JA 1GOZA 4PS8A 3E9SA 1JMLA 4FBJB 2C60A 2K22A 5G2NA 1L0VB 1GNUA 4KGTA 1FXIA 4WJNA 5AZGA 4AJWA 3P4SB 3ZXVA 2RR9A 1V49A 3NOBA 1RLFA 5C2TB 3NS1A 1QILA 2RMMA 1I4RA 1QQRA 3PV1A 1WMHB 1WX8A 4NJCA 1TKEA 4A11A 4MH0E 1KFYB 2Y5BB 4BOZB 4JLCA 2IJ0A 1RFAA 1VJKA 3O65B 4TV3A 3M95A 4EZKA 2DNFA 2QDFA 1UWXA 1HZ5A 2LUMA 4MGYE 3RZWC 1T5XD 3NVWA 2PW9A 4OW0A 3VH3B 2DYMA 4MGIE 5JH5C 4KGRA 4EZJA 1TZOA 1TS3A 4B0EA 3U2SC 3HIZA 2D10A 4HWIB 4G50A 1YOVB 2JZZA 3J9CA 2YLMA 4JIOU 2EKIA 2LGSA 1P3QU 2ZZGA 1RYJA 1L2NA 1YJJA 2M17A 5AUKA 1K52A 4ZRPA 1R4MB 1F2RI 4FJZA 5J2RA 1T0QC 1XCTL 2DYBA 4LNFA 1Q1OA 1OQRA 2FCMA 2ZTGA 3ZQ4A 4TQ1A 1RAXA 2KVRA 5CHVC 1Q0WB 3LDZE 2O2VB 4ARIA 2CJNA 1D6EC 3GE3C 5JXVA 3VRAB 5HFYA 5BO4B 2N9XA 3X23A 2JX5A 3V6EB 4DXGA 3PPAA 4KDLB 3N1ZC 4HPPA 4W9GA 4TUUA 4TQ0A 3AI5A 4N9F4 4HKZE 3R66C 4J3OD 4ZDVA
chains in the Genus database with same CATH topology
3B2FA 4CI3A 3I89A 3BVZA 1JWMD 3PZ8A 4AR1A 2RDGA 2GB1A 3NVVA 1TS4A 4ARFA 3U7ZA 1ZPSA 3BK2A 3FILA 3P4PB 1YN4A 3I8EA 3ZJVA 3ZYYX 1NVID 4JE3B 2YEPF 2NMQA 4HROA 1ET9A 3RFZB 3BK1A 5BMIA 1NEKB 4L1BA 2TSSA 1F0ZA 3I9V1 1MI0A 3EI2A 3WQZA 3AE3B 1N5WA 3UI3A 4C56C 1PGAA 5BMGA 4KKJA 4JWSC 2IGHA 2B5LA 5D7GA 4AS1A 2BT6A 4YSZB 1N61A 1PGXA 2WDQB 3HUIA 2QIEB 1C4AA 1NYQA 3TEXA 4ZHPA 1MPEA 4JWUC 1C77A 3AEFB 4H2AA 2E1BA 5EE0A 3IAM1 2BB6A 1D5XC 1AW7A 2R61A 2VZKB 1ZUD2 1GB4A 3R2IA 1XLOA 4AR8A 5TSSA 1KLUD 3T3NA 3I8CA 1WXQA 4KX6B 4C7YA 2PTLA 2HYEA 3T3OA 1XLNA 2ZW1A 1AYFA 1C78A 1SXTA 1I4QA 2NTTA 2RDHA 3CIRB 4OHJA 2IGGA 4XR3A 1SBBB 2E6XA 3BZDB 3TEYA 3AEBB 3BVMA 3W2DA 4NAWB 1C79A 3R2TA 2IUTA 4CI1A 2BW2A 3AE7B 1V7OA 2WXQA 4C7ZA 1V8CA 4PT5A 5EE1A 1YNTE 4Q2JA 3Q8EA 1J7BA 1L6UA 4FXCA 1ZP0B 3EI1A 3EI3A 2WU2B 5BYQA 2H89B 2LGIA 3LB8C 1SE2A 2WXFA 3LXFA 4ITKA 2DLBA 1JRPA 2WXGA 1VZ8A 3U4EG 3VQIA 1XXGA 2I06A 3VRBB 3I7HA 2AQ3B 3AV8A 2I38A 1IUEA 4YT0B 2PVOD 3AECB 2NTSA 1YJIA 1FIQA 1JWBD 2Y5PA 2KN4A 2WXPA 4UDUC 4YSYB 2JZPA 2WS3B 1R7SA 2WXNA 2KDMA 1D4BA 2LJIA 4YTPB 1FFVA 2KACA 1E10A 4AR9A 1SF0A 1C4CA 2Y3UA 1JCKB 2E3TA 2L32A 2J4XA 4IKGA 3LYYA 1SJHD 1I4GA 3P4QB 3RPFC 5BMHA 4E5ZA 3BYYB 3ZJTA 2XNAC 4A0AA 2BS4B 3P4RB 3R8BA 1LO5D 1L4ZB 3Q69A 2MJ3A 2WXHA 4A08A 4L2YA 1L0XB 1BXTA 3AEAB 4WIPA 4RCOA 4RGOS 2CJOA 1IGCA 4ZHOA 2JQRB 1ZOYB 4JPSA 3RFNA 1QOBA 2K0PA 2V0GA 3BWUD 1YN3A 3NZ3A 3EUB2 2M0AA 1C9FA 2WXJA 2G1EA 2WXIA 4CQNA 1TS2A 1L5PA 2PLPA 1QOFA 1V1OA 1ET6A 1JWSD 2M19A 2BBCA 4HEA1 4O1NA 3URYA 3P42A 2BS3B 1TKYA 3AEEB 1I7HA 3MC0B 3TEZA 1CJEA 2JSVX 4M0WA 4MM3B 4A0BA 2KAJA 3NVZA 1TY2A 4A9AA 1L6VA 3ZJUA 2KQ4X 4RF1A 4GDKB 2INNE 1JALA 2CU3A 3P1MA 1M4VA 5H8YE 2IDYA 1E9MA 3BVGA 3PZ7A 5C3JB 3MFGA 1DOIA 3BYTB 1PUTA 1RFKA 1KTKA 3VR8B 2Y6IA 5E6JA 4JX1C 1FNWA 4YTMB 2KWDA 4WH4A 2WXMA 1E6EB 1ROEA 2QMTA 4N6EB 2I05A 1JROA 4A8XC 1MVKA 3ABVB 5FQDA 1K53A 2Y50A 2W82A 1VLBA 5H92C 4TMAB 1E0ZA 2ICIA 3KWLA 1FD6A 4MT5A 4IOIE 2LHDA 2JU6X 2Y3AA 4US8A 4N59A 1XLQA 1VDVA 3TUOA 1K51A 4XR0A 3AH7A 1I4PA 3MP9A 4WWMA 4XE0A 5I4DA 1E7PB 3IT6B 2DWQA 4HRSA 3EI4A 1FEHA 3SR6A 3KEWA 1SJED 1HA5A 1XO3A 2GRIA 2QJLA 1DOXA 1QLBB 1IBXB 1J7AA 1UGJA 2AQ1B 2EWJA 2W3SA 4P6VF 2D5GA 3AN1A 4AREA 2IGDA 1FM0D 2JXTA 1EWCA 2Z8LA 3EA6A 3Q8CA 4KGSA 1YN5A 2XN9C 4A09A 2OEDA 5D3DA 5FKAC 1P7FA 1A70A 1ESFA 2JWUA 4MACA 1TKGA 4YXDB 3HVZA 3KWVA 2G9HD 4HKQA 2FE8A 3AE9B 5HG2A 2L1AA 3E0CA 2ONQA 2AQ2B 1BMLC 2WXLA 2LHEA 1J7CA 3AE4B 3AE8B 2Y5CA 2B5MA 4OZAA 1SIJA 1L4DB 1B1ZA 1D5MC 1TY0A 1Y56A 2X38A 4WAFA 2ON8A 3KLSX 1I4HA 2AX5A 5FR3A 1MHXA 3AE5B 3GB1A 3B9JA 1XF5L 2SEBD 1NENB 2MH7A 3GP7A 1XCQL 3I7NA 2BTEA 5G5HA 2W3RA 1KH0A 1I4XA 4C80A 1NI3A 3FILB 4D2KA 5G5GA 1ZXIA 1HEZE 1HZ6A 4KKIA 4IDIA 3B2GA 4RGMA 1QOGA 4RFBA 5BYRA 2LEKA 1CZPA 3IT4B 5EE9A 5AUIA 1VRAB 3FC4A 2WXOA 3TSSA 1B9RA 4AQ7A 3PO0A 2WDRB 2VZKD 1CQVA 1IBXA 1WXOA 1EU3A 1FRRA 1T3QA 2IUUA 4XDDA 1FNUA 4E54A 3WCQA 3Q8FA 3MJ5A 1FFUA 3AE6B 3I7OA 3I7LA 1FRDA 2DBYA 2J53A 2PKOA 4P16A 2FUG1 2V3NA 3DWMA 3KQ4A 4ZRQA 1ZDXA 1QT9A 2HTME 1CK1A 1FCCC 1VR9A 2SAKA 3I7PA 1QKZA 1WWTA 3W9CB 2B76B 2WXRA 2N7JA 5GXGB 3AMZA 1DGJA 1VZ7A 3H8HA 1NYRA 3I7KA 4LTUA 1AN8A 2H88B 1N63A 4CI2A 2J52A 2N9KA 4REZA 2MEKA 1YMHE 1V1PB 2WXKA 2IUSA 1FXAA 1WRIA 4DXFA 2WU5B 4WQMA 4ZOHC 3SEBA 2QEJC 1K50A 5D3IB 1XLPA 1YQ4B 2RPVA 1F77A 4US9A 2MJDA 4RNAA 3CWIA 4NZLB 1UNSA 2JYEA 2N9LA 2ZZFA 1GOZA 1QOAA 4ZYSA 1GAQB 1JW9D 1ZXHA 2ZW0A 3E9SA 1JMLA 2K22A 1V97A 2ZZEA 1HQRD 5T8IA 1L0VB 3O13A 1FCLA 4HJGE 5LNK1 1C4PA 1OQQA 4NAMA 2I2YA 4XDCA 4KGTA 1WYGA 1FXIA 1FNVA 4WURA 3P4SB 1JWAD 1N60A 2WP9B 5C2TB 1N62A 3NS1A 1QILA 3AE2B 3ZGZA 2L52A 1EM7A 2RMMA 3AB5A 3U52E 5BYSA 1I4RA 1BUIC 1QQRA 1TJEA 2PIAA 2LFIA 3V05A 2V3PA 5MPOA 1FO4A 4NJCA 1GPXA 2BYTA 1FMAD 1JWUD 1KLGD 1T6BX 1TKEA 5FK9C 3GS2A 4RH6A 3SFEB 5HHDG 4A11A 1KFYB 1MHHE 3V3XA 3Q8BA 2IJ0A 2W55A 2KMMA 1VJKA 3L4PA 1RWSA 4B0MA 2YEPB 1SE4A 3W5VB 1YQ3B 2PMVA 3NVYA 1V4PA 1AWDA 1OFFA 2Q5WD 3AEGB 1UWXA 3AM9A 1HZ5A 2LUMA 3MHZA 1L0YB 1T5XD 2WDVB 3NVWA 1VZ6A 2PW9A 4OW0A 1UWMA 4N58A 2WQYB 4LK0M 1SEBD 2V4IB 1D5ZC 2DYMA 1ENFA 1SSNA 1EU4A 4LLGM 2PVGC 2DYOA 4KGRA 1IGDA 4RGNA 4XWWA 2INPE 1TZOA 1WGKA 1SB3C 1TS3A 4RF0A 4B0EA 3U2SC 3C8YA 3ETRA 1PYWD 3FAHA 1ZDVA 1PDXA 3RHUA 1Q10A 4XWTA 4XR2A 1PGBA 3AEDB 3J9CA 2GI9A 3EGRA 4TSSA 2N0SB 2EKIA 5EE3A 2IPKD 2ZZGA 1DYQA 1RYJA 4A55A 3IAS1 1JQ4A 4XR1A 2W54A 3DWGC 1QF6A 3N9YC 1YJJA 2FBWB 3HVDA 4EE2A 4ARCA 2QILA 1ZE3D 5AUKA 3HRDD 4GDLB 1K52A 3VR9B 4ZRPA 3W1SA 2JYTA 4RGTA 2OHFA 2WNMA 4GLSC 2K9XA 1STEA 4TZ4A 1PFDA 1F2RI 1V1PA 4DQOC 4MH8A 3SFDB 2LMCA 2ACZB 3E56A 1XCTL 4A90A 1TYGB 4OZBA 3BIID 1F2RC 1C76A 2WLBA 4R3DA 2MJEA 1OQRA 1WSPA 2ZTGA 3ZQ4A 1N5XA 2EELA 1EWYC 2M56B 1GB1A 1ECRA 2L83A 4TQ1A 2BS2B 3NRZA 1WNUA 4USAA 1HXYD 2K3UA 1ACCA 3P63A 1UUPA 3IXSA 3Q8AA 4ARIA 2CJNA 1TS5A 1DOYA 1D6EC 1RM6C 4YSXB 4OZCA 5JXVA 5HI1A 3VRAB 4L23A 5HFYA 3OWEB 2JX5A 4DXGA 1P7EA 2HDEA 1SE3A 4TQ0A 2QSDA 2K5PA 2J42A 4YWGG 4HKZE 4OVZA 3W5UB 3AE1B 1KRHA 3I57A 4J3OD 2BB5A 3TEWA 1XEEA 3NUHB 4YTNB 1KF6B 4A6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2F A;  1TKE A;  3SFE B;  2CJO A;  3NVV A;  1KFY B;  5G5H A;  2W3R A;  4ZHO A;  2JQR B;  1ZOY B;  4C80 A;  1NI3 A;  3RFN A;  1QOB A;  2W55 A;  2KMM A;  5G5G A;  1VJK A;  1ZXI A;  3L4P A;  3P4P B;  1RWS A;  4IDI A;  3B2G A;  3ZYY X;  1NVI D;  3W5V B;  1QOG A;  3EUB 2;  1YQ3 B;  1V4P A;  3NVY A;  4HRO A;  2G1E A;  1AWD A;  1OFF A;  2Q5W D;  1L5P A;  3AEG B;  1NEK B;  3AM9 A;  2LEK A;  1CZP A;  1F0Z A;  5EE9 A;  5AUI A;  1QOF A;  3WQZ A;  3FC4 A;  2WDV B;  1N5W A;  3AE3 B;  3NVW A;  2M19 A;  1B9R A;  3PO0 A;  1UWM A;  2BS3 B;  2WQY B;  1TKY A;  2WDR B;  4JWS C;  4N58 A;  2BT6 A;  3AEE B;  4YSZ B;  1FRR A;  1WXO A;  1I7H A;  1N61 A;  1T3Q A;  2PVG C;  1CJE A;  2WDQ B;  3HUI A;  2QIE B;  2KAJ A;  3NVZ A;  4A9A A;  1NYQ A;  1L6V A;  4ZHP A;  1WGK A;  1SB3 C;  3WCQ A;  3ETR A;  4JWU C;  3AEF B;  3FAH A;  2E1B A;  1JAL A;  2CU3 A;  3P1M A;  5EE0 A;  5H8Y E;  1FFU A;  1E9M A;  1PDX A;  3AE6 B;  5C3J B;  3RHU A;  1DOI A;  3AED B;  1PUT A;  1ZUD 2;  1RFK A;  1XLO A;  1FRD A;  2N0S B;  3VR8 B;  2DBY A;  2EKI A;  4JX1 C;  2PKO A;  5EE3 A;  4YTM B;  2ZZG A;  1RYJ A;  1WXQ A;  1E6E B;  1ROE A;  4KX6 B;  3DWM A;  4C7Y A;  1JQ4 A;  4N6E B;  2W54 A;  1JRO A;  3DWG C;  1XLN A;  1QF6 A;  1QT9 A;  2HTM E;  1YJJ A;  2FBW B;  3ABV B;  1AYF A;  3W9C B;  1WWT A;  5AUK A;  1VLB A;  5H92 C;  2B76 B;  3HRD D;  3CIR B;  1E0Z A;  3KWL A;  5GXG B;  3AMZ A;  3VR9 B;  1DGJ A;  3AEB B;  1NYR A;  4LTU A;  2OHF A;  4US8 A;  4N59 A;  1XLQ A;  1N63 A;  1VDV A;  2H88 B;  2K9X A;  3AH7 A;  3AE7 B;  1V7O A;  4C7Z A;  1PFD A;  1V8C A;  4WWM A;  3SFD B;  1FXA A;  1WRI A;  1E7P B;  2ACZ B;  5EE1 A;  2WU5 B;  4WQM A;  4ZOH C;  1TYG B;  1J7B A;  1L6U A;  2DWQ A;  4HRS A;  3BII D;  4FXC A;  1ZP0 B;  2WLB A;  2MJE A;  1OQR A;  1XLP A;  1YQ4 B;  2WU2 B;  3SR6 A;  2ZTG A;  3KEW A;  1N5X A;  1XO3 A;  2H89 B;  3LB8 C;  4US9 A;  1EWY C;  2MJD A;  3LXF A;  4ITK A;  2M56 B;  3CWI A;  2QJL A;  1DOX A;  1JRP A;  1QLB B;  2L83 A;  1J7A A;  2BS2 B;  3NRZ A;  1WNU A;  4USA A;  2ZZF A;  2W3S A;  3VRB B;  3AV8 A;  1QOA A;  4P6V F;  1GAQ B;  1JW9 D;  1IUE A;  1FM0 D;  3AN1 A;  2PVO D;  3AEC B;  1YJI A;  4YT0 B;  1FIQ A;  1JWB D;  2K22 A;  3P63 A;  1DOY A;  1V97 A;  4YSY B;  2CJN A;  2WS3 B;  2ZZE A;  1L0V B;  1R7S A;  1RM6 C;  4YSX B;  1OQQ A;  3VRA B;  1WYG A;  1FXI A;  4YTP B;  1FFV A;  1E10 A;  1A70 A;  4YXD B;  1TKG A;  3P4S B;  2JX5 A;  3HVZ A;  1SF0 A;  3AE9 B;  1JWA D;  1N60 A;  2E3T A;  2WP9 B;  5C2T B;  1N62 A;  2K5P A;  3P4Q B;  3RPF C;  1J7C A;  3NS1 A;  3AE2 B;  2L52 A;  3AB5 A;  3AE4 B;  2Y5C A;  3AE8 B;  1SIJ A;  1TJE A;  2PIA A;  3AE1 B;  1KRH A;  2BS4 B;  3W5U B;  2AX5 A;  3P4R B;  4YTN B;  3AE5 B;  5MPO A;  1FO4 A;  1GPX A;  2MJ3 A;  3B9J A;  1KF6 B;  1FMA D;  3AEA B;  1NEN B;  2MH7 A; 
#chains in the Genus database with same CATH topology
 3B2F A;  4CI3 A;  3A1Q A;  4HDQ A;  1JWM D;  4PK1 A;  3QA8 A;  3NVV A;  3BIN A;  3ZW3 A;  2GBK A;  3U7Z A;  1CMX B;  3BK2 A;  2L0T A;  3ZJV A;  1NVI D;  2KTR B;  4HRO A;  5JHA A;  4KVG B;  2AL6 A;  5BMI A;  1F1H A;  1MI0 A;  1V5O A;  2I1J A;  1OGW A;  4C4V B;  4KKJ A;  2DAJ A;  1OEY J;  2VH2 A;  4YSZ B;  3HUI A;  2MRP A;  3KVF B;  3L54 A;  4KSK C;  3TJP A;  4ZHP A;  1MPE A;  1P98 A;  1AW7 A;  1SIF A;  1XLO A;  2L05 A;  1KLU D;  3I8C A;  4C7Y A;  3T3O A;  1XLN A;  1AYF A;  4LNK A;  2IYD B;  4LDT B;  2CU1 A;  3TEY A;  3BVM A;  3B08 A;  1UBI A;  4CI1 A;  4II2 B;  1V7O A;  2WXQ A;  4PT5 A;  2KDI A;  2JF5 A;  2AEH A;  2WU2 B;  5BYQ A;  3MJW A;  3LB8 C;  1ZW7 A;  3APF A;  2DLB A;  2WHI A;  2WXG A;  3VQI A;  1V5T A;  2ZCB A;  1EO6 A;  3RI7 C;  3VRB B;  4DBG A;  1NDD A;  1NBF C;  1E90 A;  4UDU C;  1YJI A;  1FIQ A;  2JZP A;  1V2Y A;  3R3M A;  2KAC A;  2BF8 B;  2L00 B;  4MSQ B;  2Y3U A;  1JCK B;  2L32 A;  4IKG A;  1SJH D;  2PPH A;  3RN9 C;  3RPF C;  3VHT C;  2C5L C;  2LXA A;  2BS4 B;  3P4R B;  2FCQ A;  3R8B A;  1L0X B;  1J19 A;  4CYE A;  4S0R A;  5TR5 A;  1WE7 A;  4RGO S;  2N1W A;  2WGS A;  4E3C A;  2KWU B;  4DDG D;  3BWU D;  1YN3 A;  3EUB 2;  2WXJ A;  1UD7 A;  1L5P A;  2MCN B;  2GMI C;  3RYT A;  2BS3 B;  3APD A;  2HE7 A;  2K8C A;  4M8M A;  2KQ4 X;  2CHW A;  1YX5 B;  2IDY A;  5IO9 A;  3MFG A;  1DOI A;  1PUT A;  1KTK A;  3VR8 B;  5CTR C;  4YTM B;  2MA9 B;  2I05 A;  1JRO A;  4AP4 C;  4BKT A;  3ABV B;  5FQD A;  1HTQ A;  4MJS A;  3VAW A;  3ZUP A;  4TMA B;  1ZKH A;  4BVU C;  2K8H A;  1FD6 A;  4IOI E;  2XK5 A;  4DDI D;  3KW5 B;  1K51 A;  2LD9 A;  3AH7 A;  4GMV A;  2A4Z A;  4HXD A;  4HRS A;  3L0W B;  3GE8 C;  4W9D A;  3EHV A;  2KOX A;  1UGJ A;  1TTN A;  2KMA A;  3AN1 A;  1FM0 D;  4NQK E;  2AWT A;  2JXT A;  3EA6 A;  1UBQ A;  1WJ6 A;  2XN9 C;  2JXX A;  4KGS A;  2OED A;  4A09 A;  5D3D A;  2KWV B;  4LNO A;  1WI0 A;  1A70 A;  2JWU A;  1WGG A;  1TKG A;  4XGA B;  2G9H D;  1WM2 A;  2FE8 A;  3AE9 B;  2KAN A;  3RMK C;  3NHE B;  4WWO A;  3PS6 A;  2ONQ A;  4IW0 A;  2FCN A;  2Y5C A;  2B5M A;  1FPY A;  3QAR A;  1SIJ A;  1D5M C;  4WAF A;  2ON8 A;  2GBR A;  4LJP B;  1C3T A;  2MBO A;  5CHW A;  3IBE A;  3GP7 A;  1XCQ L;  4K7U A;  4GOC A;  1TBE A;  3DBH I;  4BKG A;  5G5H A;  2W3R A;  1I4X A;  4K3B A;  1NI3 A;  3UF8 A;  1ZXI A;  1HZ6 A;  4KKI A;  4IDI A;  2RSU A;  3R7Q A;  4RGM A;  2X8X X;  3RNA C;  4PYZ A;  5JHB A;  1S1Q B;  3ZNI D;  2WX1 A;  3UIP B;  1WRD B;  2N9P C;  1JRU A;  2ZVN A;  2MBE A;  3IVF A;  3KYD D;  1LGR A;  3H6N A;  5IAA C;  1WX7 A;  3TCA A;  3I7O A;  3I7L A;  1FRD A;  1PQS A;  2G3Q B;  4W9K A;  2D11 A;  1CK1 A;  3W9C B;  2B76 B;  2KJR A;  2RGF A;  1NYR A;  4LTU A;  2MBQ A;  2R2O A;  4NY0 A;  4REZ A;  4ZYN A;  2OOB B;  2WXK A;  2IUS A;  2KDF B;  4GXB A;  1FXA A;  3JYU A;  3VUW A;  1WZ0 A;  4I6P A;  4ANX A;  4BZA A;  2DHZ A;  4KIK A;  1NI2 A;  3NJT A;  3CWI A;  4FHK A;  3QAQ A;  2KLG A;  4KV2 A;  1GAQ B;  1JW9 D;  1ZXH A;  2ZW0 A;  1WZC A;  2ZZE A;  5T8I A;  2KJH B;  3O13 A;  1FCL A;  5LNK 1;  3DHH C;  4NAM A;  2AYO B;  5DPW A;  3VVW B;  3DPD A;  2IO2 B;  2IND C;  5KHQ A;  4WWN A;  1WF9 A;  4KZC A;  2ZCC A;  2M0X A;  2L52 A;  1EM7 A;  3ZRC A;  1YX6 B;  2OJR A;  2LFI A;  4IM2 A;  3NZS A;  5MPO A;  1FO4 A;  2LVQ A;  1KLG D;  2KC1 A;  1T6B X;  3GS2 A;  5CX3 A;  4IWP A;  5KHO A;  3L4P A;  5D94 A;  1RWS A;  4B0M A;  2YEP B;  1SE4 A;  2EMT A;  2J0J A;  1AWD A;  1OFF A;  2Q5W D;  3Q3O C;  3AM9 A;  4CHK A;  2KLC A;  2VH1 A;  3L10 B;  3VUX A;  4I6L B;  3RD2 A;  1UWM A;  1SEB D;  4M00 A;  1ENF A;  1A5R A;  4RGN A;  3SHQ A;  4XWW A;  4RF0 A;  5IKC M;  2BKR B;  3ETR A;  3PZD A;  1PDX A;  3RHU A;  2PE9 A;  4XWT A;  1PGB A;  3AED B;  3EGR A;  4MDK E;  1F52 A;  1OQY A;  4A55 A;  2W54 A;  4X57 B;  1QF6 A;  3N9Y C;  3KH0 A;  2IBI B;  4GDL B;  2K6D B;  1V86 A;  3MTN B;  2O6V B;  1Z5S B;  2J0K A;  2K9X A;  3LJ3 A;  1STE A;  4DQO C;  2JVC A;  4MH8 A;  3SFD B;  4A3P A;  2ACZ B;  4A90 A;  3SD5 A;  1TYG B;  5EDS A;  4OZB A;  4EUT A;  1WSP A;  1J8C A;  2ZNV B;  4XZ4 A;  3OLM D;  2M56 B;  3VDZ A;  1GB1 A;  2G4S A;  2L83 A;  3TBL D;  3NRZ A;  1ACC A;  3IXS A;  4HPM B;  4IWQ A;  1RM6 C;  5HI1 A;  1OEY A;  3OWE B;  1WXS A;  3ML8 A;  1I35 A;  1KJT A;  1P7E A;  4W9J A;  4GB9 A;  4OVZ A;  5LLI A;  3W5U B;  3I57 A;  3QHT A;  2BB5 A;  1XEE A;  2NBW B;  1KF6 B;  4DHZ E;  3I89 A;  2KQS A;  1P0R A;  4AR1 A;  2GB1 A;  4DHZ B;  1TS4 A;  5J18 A;  1M94 A;  3RZF A;  3GZN B;  3PTF C;  2KFK A;  1ZPS A;  3P4P B;  1YN4 A;  3I8E A;  2BYV E;  4HDO A;  2N9E B;  4RM8 A;  4JE3 B;  2YEP F;  2NMQ A;  3RFZ B;  1EF5 A;  2LVO A;  1NEK B;  1WXM A;  3I9V 1;  4NJ6 A;  4IUM B;  4JGH B;  4C56 C;  1PGA A;  2PE6 B;  5AZF A;  3H7S A;  2IY1 B;  1NYQ A;  1TT5 B;  2HJ8 A;  2KQ7 A;  3IAM 1;  2BB6 A;  1D5X C;  3M63 B;  4G0N B;  1R4N I;  2R61 A;  1GB4 A;  1ZUD 2;  2QHO A;  4AR8 A;  3T3N A;  2JWZ A;  1UGM A;  3ZLZ A;  3OAW A;  2PTL A;  2XK5 B;  2FIF A;  3ALB A;  3A33 B;  1C78 A;  1SXT A;  4OHJ A;  2IGG A;  4XR3 A;  1VCB A;  1SBB B;  4EZL A;  3CST A;  3W2D A;  1GC6 A;  3DBL B;  2W9N A;  3R2T A;  2BW2 A;  3AE7 B;  4ZRJ A;  4C7Z A;  5J17 A;  4HLE A;  5EE1 A;  1YNT E;  1TIF A;  2IZV B;  3Q8E A;  3B0A A;  3A9K B;  2KWC A;  1WR6 E;  4ASW C;  2MSE D;  3I3T B;  1JRP A;  3ZDT A;  2AQ3 B;  2NTS A;  2Y5P A;  2RDB C;  1R7S A;  1D4B A;  4YTP B;  1E10 A;  2BQQ A;  1C4C A;  3ML9 A;  3RNE C;  3BYY B;  3ZJT A;  2NS5 A;  2XBB C;  2XNA C;  2KXJ A;  4A0A A;  3UQA A;  3QWZ B;  1KM7 A;  4C4V A;  3Q2A C;  2BKF A;  3Q69 A;  3AEA B;  4WIP A;  4JQW C;  1WFY A;  1MJD A;  2MW5 A;  1ZOY B;  1QOB A;  2V0G A;  4WAA A;  4II3 B;  1XD3 B;  3R7R A;  2WXI A;  3L08 A;  3Q3J A;  1QOF A;  2JPH A;  1EF1 A;  1ZGU B;  2M19 A;  2BBC A;  1WJN A;  1TKY A;  2AL3 A;  3AEE B;  3H1U A;  1XVI A;  3TEZ A;  2JSV X;  2KX3 A;  3ZNG C;  4A9A A;  2M4N A;  3ZJU A;  4RF1 A;  1E8X A;  1JAL A;  2CU3 A;  5H8Y E;  3ZNZ B;  1E9M A;  4E71 A;  2LGD A;  4JX1 C;  2KWD A;  4W9H A;  2QMT A;  2NPT B;  2G45 B;  5FR6 A;  3ZWK A;  4S17 A;  1MVK A;  1K53 A;  3SDL C;  3N1Y C;  1E0Z A;  2ICI A;  3C19 A;  3IHP C;  3ZIM A;  2JU6 X;  2C7M B;  3WAL A;  3EFC A;  4N59 A;  3RNB C;  4XR0 A;  3UGB B;  1I4P A;  3MP9 A;  3N30 A;  2C7N B;  3UQB A;  1E7P B;  1HE8 A;  3B1L X;  3ZDM C;  4HPL B;  4WJQ A;  4M0W B;  1SJE D;  1XO3 A;  3HHM A;  1KLV A;  1DOX A;  2AQ1 B;  2D5G A;  4ARE A;  2IGD A;  1IP9 A;  4XYC A;  3ZW7 A;  1ESF A;  3HVZ A;  2MP2 A;  1WGD A;  5HG2 A;  5GMV A;  4GDK A;  3NZU A;  2AQ2 B;  3WIM A;  2WXL A;  4W9L A;  2KX0 A;  1WXA A;  4W9F A;  1WIA A;  3KLS X;  1I4H A;  3JSV B;  3W1Y A;  3B9J A;  4RM9 A;  2BTE A;  4CO7 A;  1WH3 A;  4NQL B;  4C80 A;  4GSW A;  2VRR B;  3Q3F A;  1HEZ E;  2YVC A;  3MC9 A;  3VTW A;  3FC4 A;  4BFR A;  1B9R A;  4AQ7 A;  4EKU A;  2IUU A;  5JZE B;  3PRM B;  1FNU A;  4E54 A;  3Q3M C;  2NCN A;  3PHX B;  3Q8F A;  3AE6 B;  2HJ1 A;  4BAX A;  3ECI A;  3S2A A;  2PKO A;  3V6C B;  4XX5 A;  4P16 A;  2LGY A;  3DWM A;  3KQ4 A;  4F8C B;  1QT9 A;  1QZE A;  3PVL A;  2N7J A;  2B3A A;  2K25 A;  3A9J B;  3BY4 B;  3ZNH B;  1F9J A;  2N9K A;  2MP2 B;  1V1P B;  2L76 A;  1WRI A;  4DXF A;  3HM6 X;  2WU5 B;  5HKH A;  2KVZ A;  2GBN A;  5D3I B;  4NJ7 A;  1YQ4 B;  1F77 A;  2FCS A;  4ANU A;  1E8Z A;  4RNA A;  3DCG A;  1UNS A;  2N9L A;  4K81 A;  2ZZF A;  1QOA A;  4JL9 A;  3DBH B;  1P1A A;  4XDC A;  2EKE C;  1FNV A;  2DZI A;  3RNC C;  1JWA D;  1N60 A;  2WP9 B;  2ZPN A;  1N62 A;  3AB5 A;  3U52 E;  2NR2 A;  1TJE A;  4KSL C;  3V05 A;  2V3P A;  1GPX A;  1FMA D;  3L16 A;  1JWU D;  3DBR I;  1WXV A;  2IO1 B;  2GBJ A;  4KZ0 A;  3Q8B A;  4HCN B;  5DPR A;  4C00 A;  1TGZ B;  3W5V B;  3MHS D;  1YQ3 B;  2PMV A;  3NVY A;  3QC8 B;  1UZX B;  1ISN A;  3MHZ A;  1RRB A;  5E6N A;  1VZ6 A;  3Q14 C;  4N58 A;  1MFW A;  1E8Y A;  2WQY B;  1SSN A;  3PLV A;  1EU4 A;  4LLG M;  2DYO A;  3Q6B A;  2UWQ A;  2INP E;  1WGK A;  1SB3 C;  3A9K A;  3C8Y A;  1PYW D;  3FAH A;  1Q10 A;  3ZTC A;  4TSS A;  2N0S B;  5IP4 D;  3RUI B;  4EEW A;  2IPK D;  2V3S A;  3CF6 E;  3IAS 1;  3QQ8 B;  4XR1 A;  1T0S C;  3DWG C;  2FBW B;  3HVD A;  3AUL A;  4EE2 A;  3HRD D;  4MGZ E;  3VR9 B;  3QX1 A;  2MQJ A;  3W1S A;  2WNM A;  4M02 A;  5C23 A;  3QK0 A;  1PFD A;  1WGY A;  2WYQ A;  4AJY B;  3E56 A;  4BBN C;  4AWJ A;  1F2R C;  2IY0 B;  4P1C C;  2UYZ B;  1N5X A;  2EEL A;  2DAF A;  3WAN A;  1T0Y A;  3EEC A;  4XC2 A;  5L83 A;  1ECR A;  3DDC B;  1WNU A;  4USA A;  1GJZ A;  2K3U A;  1DOY A;  3Q8A A;  1TS5 A;  4YSX B;  4OZC A;  4AOF A;  3UIO B;  2HD5 B;  3T8M A;  1X1M A;  3KUD B;  2HDE A;  1SE3 A;  4EFO A;  1Y8R C;  2N7D A;  3QJZ A;  4LJO B;  2KYW A;  4I6N B;  2K6Q A;  3AE1 B;  2LJ5 A;  3TEW A;  3NUH B;  1WZ3 A;  4W9E A;  3RNG C;  4A6Q A;  1XQQ A;  3PZ8 A;  2RDG A;  2KTR A;  3NS8 A;  4IM3 A;  2G4D B;  4ZRK A;  2KC2 A;  2FAZ A;  3FIL A;  4GN1 A;  3PGE A;  1ET9 A;  4IG7 B;  2JRI B;  1R4M I;  2TSS A;  3WQZ A;  1N5W A;  3H7P A;  3UI3 A;  2I1K A;  5BMG A;  4JWS C;  2IGH A;  2B5L A;  5D7G A;  4AS1 A;  2BT6 A;  4NNJ B;  2QIE B;  3TEX A;  1AAR A;  4H2A A;  5EE0 A;  2VZK B;  3H9D A;  3FKY A;  2XEW A;  2LWP A;  2LGX A;  3JW0 X;  4WWP A;  1D3Z A;  1LFD A;  4URK A;  1WE6 A;  3UIN B;  3A9J A;  2REX A;  4K1R B;  3CIR B;  1WM3 A;  3GZN I;  2E6X A;  3BZD B;  5DCN A;  1WY8 A;  5DPS A;  4LNN A;  1V8C A;  4IM0 A;  4FXC A;  4NAW A;  1ZP0 B;  2JY6 A;  1BT0 A;  3EI1 A;  5IOI A;  3EI3 A;  4FUL A;  2H89 B;  4ITK A;  1SE2 A;  2WXF A;  3U4E G;  3OJ4 B;  3I7H A;  1IUE A;  3AEC B;  4ACF A;  5HHD G;  2WXP A;  3CSF A;  4YSY B;  2WS3 B;  4GGQ A;  2KDM A;  1WR1 A;  2K39 A;  2LJI A;  5AZH A;  1FFV A;  1YIW A;  4AR9 A;  4FHJ A;  4DWF A;  2KDB A;  4PS7 A;  1L7Y A;  3A4S C;  1C1Y B;  5BMH A;  1I4G A;  3N1X C;  4P7I A;  4HJK A;  1L4Z B;  4W9C A;  4IWO A;  2WXH A;  4A08 A;  4L2Y A;  4FJY A;  4MEL A;  4RCO A;  2CJO A;  1IGC A;  2ZJD A;  3VTU A;  4ZHO A;  5IN7 A;  2JQR B;  2KHW B;  2K0P A;  1C9F A;  5LXH A;  4CQN A;  3OJ3 A;  2MBH A;  1ET6 A;  1JWS D;  4O1N A;  3AXC A;  3WAP A;  2MWS B;  3TMP B;  1WJU A;  1I7H A;  3MC0 B;  4KIK B;  1CJE A;  4M0W A;  4MM3 B;  2KAJ A;  1TY2 A;  4ZRI A;  4GDK B;  2DX5 B;  2MHJ A;  4B6W A;  3PHW B;  1M4V A;  1R4N B;  3BVG A;  3U7D A;  3BYT B;  2V4L A;  1RFK A;  3RNF C;  1FNW A;  3A1Q B;  4WH4 A;  2WXM A;  2N4F A;  3T9L A;  4A8X C;  2Y50 A;  2W82 A;  5H92 C;  2KZR A;  3EFU A;  3KWL A;  4MT5 A;  2ASQ A;  2RD0 A;  5LXI B;  3U30 A;  2HTH A;  1XLQ A;  2DEN B;  3RT3 B;  2LZ6 A;  2JZ3 B;  4XE0 A;  5I4D A;  4G11 A;  1LXD A;  2DWQ A;  2GOW A;  2GLS A;  3SR6 A;  2JUO A;  3ZU6 A;  3RCZ A;  2W3S A;  1EWC A;  2Z8L A;  3X0W A;  2L3Z A;  4DHJ B;  1P7F A;  3KYC D;  2KDE B;  3APC A;  4BKS D;  4YXD B;  3ZO5 B;  3KWV A;  4HKQ A;  4HVB A;  2ZVO A;  3E0C A;  2LHE A;  5DPT A;  1FXT B;  2J0M A;  1L4D B;  1B1Z A;  1TY0 A;  1Y56 A;  2C9W B;  3DBS A;  3PRP B;  2AX5 A;  3HM3 A;  5FR3 A;  1J0G A;  3AE5 B;  3GB1 A;  1XF5 L;  2LUE A;  2MH7 A;  3D32 A;  2ZOS A;  3I7N A;  3CMM B;  2K8B A;  3FIL B;  4D2K A;  1E7U A;  2KT7 A;  2LEK A;  1CZP A;  5EE9 A;  2N1V A;  1SGH A;  2Z0D B;  3PO0 A;  2KMC A;  2WDR B;  2VZK D;  4BKS A;  1EU3 A;  1FRR A;  2D3A A;  1T3Q A;  2RPQ A;  4ICV A;  4XDD A;  3WCQ A;  3N3K B;  1FFU A;  3WA0 A;  3JVZ X;  3I5J C;  2DBY A;  2J53 A;  2DZJ A;  1K8R B;  2N7E A;  4ZRQ A;  1ZDX A;  2HTM E;  2SAK A;  1WMH A;  3K9P B;  1QKZ A;  1WWT A;  3ZX4 A;  1VZ7 A;  2IO3 B;  2NBU A;  5CHF A;  1V6E A;  1AN8 A;  1N63 A;  2MEK A;  1YMH E;  3VUY A;  4WQM A;  4ZOH C;  3SEB A;  1G6J A;  2CKH B;  1XLP A;  2RPV A;  3ZUN A;  3QCA A;  2EMS A;  4P1B C;  4PYU A;  5C1Z A;  4ZYS A;  2ZPY A;  1V97 A;  2NPT A;  1HQR D;  3K9O B;  4HJG E;  1C4P A;  1OQQ A;  2LVP A;  2NVU I;  1WYG A;  4MEM A;  4WUR A;  4FJV B;  3VXW A;  3KUC B;  3NY5 A;  3AE2 B;  3ZGZ A;  1I42 A;  3AU5 A;  5BYS A;  4RMA A;  1V9J A;  2Z0E B;  3MC8 A;  2D3B A;  1BUI C;  2PIA A;  4PS3 A;  4F7Z A;  2D07 B;  2BYT A;  3KUZ A;  5FK9 C;  4A20 A;  4J6I A;  4LDT D;  4RH6 A;  3SFE B;  5E6P A;  2A5U A;  1MHH E;  3V3X A;  2W55 A;  1V80 A;  2KMM A;  5G55 A;  4HK2 A;  1UH6 A;  1V4P A;  1LM8 B;  3AEG B;  3EC8 A;  1L0Y B;  2KJ6 A;  2WDV B;  4ANW A;  1UEL A;  1YD8 U;  4FLH A;  4LK0 M;  2V4I B;  1D5Z C;  2PVG C;  1T0R C;  1IGD A;  1GC7 A;  2R2Q A;  2KFK B;  4LNI A;  1ZDV A;  4XR2 A;  3ZKJ C;  2GI9 A;  5EE3 A;  2CS4 A;  1DYQ A;  4B95 A;  1JQ4 A;  3PSE B;  2BVC A;  4ANV A;  4ARC A;  2QIL A;  1ZE3 D;  1IYF A;  1EUV B;  1Q5W B;  2JYT A;  4G3X B;  2D2Q A;  2OHF A;  4RGT A;  4GLS C;  4TZ4 A;  1V1P A;  5D6J B;  2DZM A;  2LMC A;  3ENE A;  2FUH B;  3BII D;  2O6V A;  1C76 A;  2WLB A;  4R3D A;  2MJE A;  2V1Y A;  5AEK B;  3PT2 B;  1EWY C;  2BS2 B;  3TIX A;  3W1S C;  4WJP A;  1HXY D;  2D3C A;  1S3S G;  3P63 A;  2J7Q B;  4KDI C;  1UUP A;  2MLB A;  3VH4 B;  4L23 A;  2M8S A;  3IFW B;  3DBL I;  2QSD A;  2K5P A;  2J42 A;  3V60 A;  4YWG G;  2LRW A;  1KRH A;  4YTN B;  1WYW B;  1KOT A;  2I2Y A;  4BBN F;  3DHI C;  3BVZ A;  2O6V D;  1H4R A;  4ARF A;  4LCD E;  4M8N A;  3AU4 A;  3ZYY X;  3C0R B;  1E5W A;  3BK1 A;  4FA6 A;  2PEA A;  1WGR A;  4L1B A;  1F0Z A;  3EI2 A;  5IA7 A;  4QAY A;  3AE3 B;  4OVU A;  2QCZ A;  3L13 A;  3NG0 A;  3WAM A;  1N61 A;  3PRZ A;  1PGX A;  2WDQ B;  1GUA B;  1C4A A;  4JWU C;  1C77 A;  3AEF B;  2E1B A;  3R2I A;  5D2M B;  2WDT B;  5TSS A;  3N20 C;  1GG3 A;  1WXQ A;  3V62 A;  4KX6 B;  2HYE A;  2MX2 A;  5L95 C;  2ZW1 A;  3ZRF A;  3ZVV A;  2KD0 A;  2NTT A;  1I4Q A;  2RDH A;  3HK0 A;  3AEB B;  4NAW B;  4HCP B;  2CHX A;  1C79 A;  2IUT A;  2KNB A;  4B9K A;  4Q2J A;  2UU7 A;  1J7B A;  1L6U A;  3L17 A;  3Q3N C;  4BOS C;  4AUQ C;  3DBR B;  2IO0 B;  2LGI A;  4NPN A;  3LXF A;  4WJO A;  1P9D U;  1VZ8 A;  4DXA B;  1XXG A;  2I06 A;  3AV8 A;  2I38 A;  4YT0 B;  2PVO D;  1JWB D;  2KN4 A;  1XT9 B;  1UF0 A;  2INC C;  3IG3 A;  2WXN A;  3DOW A;  3SU8 X;  1WJ4 A;  2CR5 A;  3DVG X;  2KFJ A;  4FAD A;  3ZTW A;  1SF0 A;  3ZXR A;  3RUL A;  2LAS A;  2E3T A;  1MG4 A;  2J4X A;  4E5Z A;  3LYY A;  3P4Q B;  4K7S A;  2L7R A;  1LO5 D;  3H7P B;  2K1F A;  2BYE A;  2MJ3 A;  3OG5 A;  3PRE A;  1BXT A;  3TL5 A;  4WQO B;  5E6O A;  4JPS A;  3RFN A;  2LRU A;  2DZK A;  2OJW A;  4F1S A;  2BWE S;  3NZ3 A;  2M0A A;  4MM3 A;  4A3O A;  2G1E A;  1TS2 A;  2PLP A;  4MSM B;  1V1O A;  3P2B A;  4DK5 A;  4HEA 1;  3URY A;  3P42 A;  4TKN A;  3JSV A;  2BGF A;  2M1M A;  2NBV B;  2WX0 A;  2ZEQ A;  4A0B A;  3NVZ A;  1L6V A;  2ZZP B;  3I63 C;  4FN2 A;  2INN E;  2BYF A;  3P1M A;  5C3J B;  3PZ7 A;  1OTR B;  2Y6I A;  5E6J A;  1E6E B;  1ROE A;  4N6E B;  3VFK A;  2O2V A;  1VLB A;  2LHD A;  2KKC A;  2Y3A A;  4US8 A;  4DHJ D;  1VDV A;  2Z59 B;  3TUO A;  1E7V A;  3DVN U;  3M3J A;  3N32 A;  1Z2M A;  2KN5 A;  4WWM A;  3IT6 B;  3EI4 A;  1FEH A;  3GOE A;  2BWF A;  2D3G A;  3KEW A;  1HA5 A;  1U4A A;  1IPG A;  1VD2 A;  2GRI A;  2LXC A;  2QJL A;  1QLB B;  1IBX B;  1J7A A;  2EWJ A;  4P6V F;  1YQB A;  2JT4 B;  3DHG C;  3Q8C A;  3DVG Y;  2BPS A;  1YN5 A;  4E74 A;  3DVN V;  2LI5 A;  1LQB A;  5FKA C;  3ZX5 A;  2JRH A;  4MAC A;  1MG8 A;  1TZ1 A;  2MBB B;  2L1A A;  1BML C;  1WX9 A;  1J7C A;  3DQV A;  4M01 A;  3AE4 B;  3AE8 B;  2FID A;  4ICU A;  4OZA A;  1E8W A;  4OVV A;  2X38 A;  2WWZ A;  4MJS B;  1MHX A;  3WAO A;  2V9H A;  2SEB D;  1NEN B;  2KTF A;  1KH0 A;  3PLU A;  2ZNV C;  4IC7 B;  5G5G A;  3ZTD A;  2KK8 A;  4K3C A;  3B2G A;  1QOG A;  4RFB A;  5BYR A;  3A4R A;  3IT4 B;  1HTO A;  4YL8 A;  5AUI A;  4W9I A;  1VRA B;  3ONS A;  2WXO A;  3TSS A;  3ZTY A;  2PJH A;  3M62 B;  1CQV A;  4MGK E;  1IBX A;  1WXO A;  4GIV A;  1H8C A;  2C7H A;  3MJ5 A;  2GBM A;  1SE9 A;  4GU2 A;  3U8Z A;  2FUG 1;  3V61 A;  2V3N A;  1VR9 A;  1FCC C;  3ZWD A;  4K7W A;  3I7P A;  2KO3 A;  2WXR A;  5GXG B;  2L0F A;  3AMZ A;  1DGJ A;  3H8H A;  3QIJ A;  3I7K A;  2H88 B;  4CI2 A;  1N6Z A;  2J52 A;  3VTV A;  1V81 A;  2FNJ B;  2QEJ C;  2QC8 A;  1K50 A;  2CHZ A;  1YJ1 A;  4GDL A;  4US9 A;  2MJD A;  4EOY A;  4NZL B;  1WGH A;  2JYE A;  2L8J A;  1GOZ A;  4PS8 A;  3E9S A;  1JML A;  4FBJ B;  2C60 A;  2K22 A;  5G2N A;  1L0V B;  1GNU A;  4KGT A;  1FXI A;  4WJN A;  5AZG A;  4AJW A;  3P4S B;  3ZXV A;  2RR9 A;  1V49 A;  3NOB A;  1RLF A;  5C2T B;  3NS1 A;  1QIL A;  2RMM A;  1I4R A;  1QQR A;  3PV1 A;  1WMH B;  1WX8 A;  4NJC A;  1TKE A;  4A11 A;  4MH0 E;  1KFY B;  2Y5B B;  4BOZ B;  4JLC A;  2IJ0 A;  1RFA A;  1VJK A;  3O65 B;  4TV3 A;  3M95 A;  4EZK A;  2DNF A;  2QDF A;  1UWX A;  1HZ5 A;  2LUM A;  4MGY E;  3RZW C;  1T5X D;  3NVW A;  2PW9 A;  4OW0 A;  3VH3 B;  2DYM A;  4MGI E;  5JH5 C;  4KGR A;  4EZJ A;  1TZO A;  1TS3 A;  4B0E A;  3U2S C;  3HIZ A;  2D10 A;  4HWI B;  4G50 A;  1YOV B;  2JZZ A;  3J9C A;  2YLM A;  4JIO U;  2EKI A;  2LGS A;  1P3Q U;  2ZZG A;  1RYJ A;  1L2N A;  1YJJ A;  2M17 A;  5AUK A;  1K52 A;  4ZRP A;  1R4M B;  1F2R I;  4FJZ A;  5J2R A;  1T0Q C;  1XCT L;  2DYB A;  4LNF A;  1Q1O A;  1OQR A;  2FCM A;  2ZTG A;  3ZQ4 A;  4TQ1 A;  1RAX A;  2KVR A;  5CHV C;  1Q0W B;  3LDZ E;  2O2V B;  4ARI A;  2CJN A;  1D6E C;  3GE3 C;  5JXV A;  3VRA B;  5HFY A;  5BO4 B;  2N9X A;  3X23 A;  2JX5 A;  3V6E B;  4DXG A;  3PPA A;  4KDL B;  3N1Z C;  4HPP A;  4W9G A;  4TUU A;  4TQ0 A;  3AI5 A;  4N9F 4;  4HKZ E;  3R66 C;  4J3O D;  4ZDV A; 
#chains in the Genus database with same CATH homology
 3B2F A;  4CI3 A;  3I89 A;  3BVZ A;  1JWM D;  3PZ8 A;  4AR1 A;  2RDG A;  2GB1 A;  3NVV A;  1TS4 A;  4ARF A;  3U7Z A;  1ZPS A;  3BK2 A;  3FIL A;  3P4P B;  1YN4 A;  3I8E A;  3ZJV A;  3ZYY X;  1NVI D;  4JE3 B;  2YEP F;  2NMQ A;  4HRO A;  1ET9 A;  3RFZ B;  3BK1 A;  5BMI A;  1NEK B;  4L1B A;  2TSS A;  1F0Z A;  3I9V 1;  1MI0 A;  3EI2 A;  3WQZ A;  3AE3 B;  1N5W A;  3UI3 A;  4C56 C;  1PGA A;  5BMG A;  4KKJ A;  4JWS C;  2IGH A;  2B5L A;  5D7G A;  4AS1 A;  2BT6 A;  4YSZ B;  1N61 A;  1PGX A;  2WDQ B;  3HUI A;  2QIE B;  1C4A A;  1NYQ A;  3TEX A;  4ZHP A;  1MPE A;  4JWU C;  1C77 A;  3AEF B;  4H2A A;  2E1B A;  5EE0 A;  3IAM 1;  2BB6 A;  1D5X C;  1AW7 A;  2R61 A;  2VZK B;  1ZUD 2;  1GB4 A;  3R2I A;  1XLO A;  4AR8 A;  5TSS A;  1KLU D;  3T3N A;  3I8C A;  1WXQ A;  4KX6 B;  4C7Y A;  2PTL A;  2HYE A;  3T3O A;  1XLN A;  2ZW1 A;  1AYF A;  1C78 A;  1SXT A;  1I4Q A;  2NTT A;  2RDH A;  3CIR B;  4OHJ A;  2IGG A;  4XR3 A;  1SBB B;  2E6X A;  3BZD B;  3TEY A;  3AEB B;  3BVM A;  3W2D A;  4NAW B;  1C79 A;  3R2T A;  2IUT A;  4CI1 A;  2BW2 A;  3AE7 B;  1V7O A;  2WXQ A;  4C7Z A;  1V8C A;  4PT5 A;  5EE1 A;  1YNT E;  4Q2J A;  3Q8E A;  1J7B A;  1L6U A;  4FXC A;  1ZP0 B;  3EI1 A;  3EI3 A;  2WU2 B;  5BYQ A;  2H89 B;  2LGI A;  3LB8 C;  1SE2 A;  2WXF A;  3LXF A;  4ITK A;  2DLB A;  1JRP A;  2WXG A;  1VZ8 A;  3U4E G;  3VQI A;  1XXG A;  2I06 A;  3VRB B;  3I7H A;  2AQ3 B;  3AV8 A;  2I38 A;  1IUE A;  4YT0 B;  2PVO D;  3AEC B;  2NTS A;  1YJI A;  1FIQ A;  1JWB D;  2Y5P A;  2KN4 A;  2WXP A;  4UDU C;  4YSY B;  2JZP A;  2WS3 B;  1R7S A;  2WXN A;  2KDM A;  1D4B A;  2LJI A;  4YTP B;  1FFV A;  2KAC A;  1E10 A;  4AR9 A;  1SF0 A;  1C4C A;  2Y3U A;  1JCK B;  2E3T A;  2L32 A;  2J4X A;  4IKG A;  3LYY A;  1SJH D;  1I4G A;  3P4Q B;  3RPF C;  5BMH A;  4E5Z A;  3BYY B;  3ZJT A;  2XNA C;  4A0A A;  2BS4 B;  3P4R B;  3R8B A;  1LO5 D;  1L4Z B;  3Q69 A;  2MJ3 A;  2WXH A;  4A08 A;  4L2Y A;  1L0X B;  1BXT A;  3AEA B;  4WIP A;  4RCO A;  4RGO S;  2CJO A;  1IGC A;  4ZHO A;  2JQR B;  1ZOY B;  4JPS A;  3RFN A;  1QOB A;  2K0P A;  2V0G A;  3BWU D;  1YN3 A;  3NZ3 A;  3EUB 2;  2M0A A;  1C9F A;  2WXJ A;  2G1E A;  2WXI A;  4CQN A;  1TS2 A;  1L5P A;  2PLP A;  1QOF A;  1V1O A;  1ET6 A;  1JWS D;  2M19 A;  2BBC A;  4HEA 1;  4O1N A;  3URY A;  3P42 A;  2BS3 B;  1TKY A;  3AEE B;  1I7H A;  3MC0 B;  3TEZ A;  1CJE A;  2JSV X;  4M0W A;  4MM3 B;  4A0B A;  2KAJ A;  3NVZ A;  1TY2 A;  4A9A A;  1L6V A;  3ZJU A;  2KQ4 X;  4RF1 A;  4GDK B;  2INN E;  1JAL A;  2CU3 A;  3P1M A;  1M4V A;  5H8Y E;  2IDY A;  1E9M A;  3BVG A;  3PZ7 A;  5C3J B;  3MFG A;  1DOI A;  3BYT B;  1PUT A;  1RFK A;  1KTK A;  3VR8 B;  2Y6I A;  5E6J A;  4JX1 C;  1FNW A;  4YTM B;  2KWD A;  4WH4 A;  2WXM A;  1E6E B;  1ROE A;  2QMT A;  4N6E B;  2I05 A;  1JRO A;  4A8X C;  1MVK A;  3ABV B;  5FQD A;  1K53 A;  2Y50 A;  2W82 A;  1VLB A;  5H92 C;  4TMA B;  1E0Z A;  2ICI A;  3KWL A;  1FD6 A;  4MT5 A;  4IOI E;  2LHD A;  2JU6 X;  2Y3A A;  4US8 A;  4N59 A;  1XLQ A;  1VDV A;  3TUO A;  1K51 A;  4XR0 A;  3AH7 A;  1I4P A;  3MP9 A;  4WWM A;  4XE0 A;  5I4D A;  1E7P B;  3IT6 B;  2DWQ A;  4HRS A;  3EI4 A;  1FEH A;  3SR6 A;  3KEW A;  1SJE D;  1HA5 A;  1XO3 A;  2GRI A;  2QJL A;  1DOX A;  1QLB B;  1IBX B;  1J7A A;  1UGJ A;  2AQ1 B;  2EWJ A;  2W3S A;  4P6V F;  2D5G A;  3AN1 A;  4ARE A;  2IGD A;  1FM0 D;  2JXT A;  1EWC A;  2Z8L A;  3EA6 A;  3Q8C A;  4KGS A;  1YN5 A;  2XN9 C;  4A09 A;  2OED A;  5D3D A;  5FKA C;  1P7F A;  1A70 A;  1ESF A;  2JWU A;  4MAC A;  1TKG A;  4YXD B;  3HVZ A;  3KWV A;  2G9H D;  4HKQ A;  2FE8 A;  3AE9 B;  5HG2 A;  2L1A A;  3E0C A;  2ONQ A;  2AQ2 B;  1BML C;  2WXL A;  2LHE A;  1J7C A;  3AE4 B;  3AE8 B;  2Y5C A;  2B5M A;  4OZA A;  1SIJ A;  1L4D B;  1B1Z A;  1D5M C;  1TY0 A;  1Y56 A;  2X38 A;  4WAF A;  2ON8 A;  3KLS X;  1I4H A;  2AX5 A;  5FR3 A;  1MHX A;  3AE5 B;  3GB1 A;  3B9J A;  1XF5 L;  2SEB D;  1NEN B;  2MH7 A;  3GP7 A;  1XCQ L;  3I7N A;  2BTE A;  5G5H A;  2W3R A;  1KH0 A;  1I4X A;  4C80 A;  1NI3 A;  3FIL B;  4D2K A;  5G5G A;  1ZXI A;  1HEZ E;  1HZ6 A;  4KKI A;  4IDI A;  3B2G A;  4RGM A;  1QOG A;  4RFB A;  5BYR A;  2LEK A;  1CZP A;  3IT4 B;  5EE9 A;  5AUI A;  1VRA B;  3FC4 A;  2WXO A;  3TSS A;  1B9R A;  4AQ7 A;  3PO0 A;  2WDR B;  2VZK D;  1CQV A;  1IBX A;  1WXO A;  1EU3 A;  1FRR A;  1T3Q A;  2IUU A;  4XDD A;  1FNU A;  4E54 A;  3WCQ A;  3Q8F A;  3MJ5 A;  1FFU A;  3AE6 B;  3I7O A;  3I7L A;  1FRD A;  2DBY A;  2J53 A;  2PKO A;  4P16 A;  2FUG 1;  2V3N A;  3DWM A;  3KQ4 A;  4ZRQ A;  1ZDX A;  1QT9 A;  2HTM E;  1CK1 A;  1FCC C;  1VR9 A;  2SAK A;  3I7P A;  1QKZ A;  1WWT A;  3W9C B;  2B76 B;  2WXR A;  2N7J A;  5GXG B;  3AMZ A;  1DGJ A;  1VZ7 A;  3H8H A;  1NYR A;  3I7K A;  4LTU A;  1AN8 A;  2H88 B;  1N63 A;  4CI2 A;  2J52 A;  2N9K A;  4REZ A;  2MEK A;  1YMH E;  1V1P B;  2WXK A;  2IUS A;  1FXA A;  1WRI A;  4DXF A;  2WU5 B;  4WQM A;  4ZOH C;  3SEB A;  2QEJ C;  1K50 A;  5D3I B;  1XLP A;  1YQ4 B;  2RPV A;  1F77 A;  4US9 A;  2MJD A;  4RNA A;  3CWI A;  4NZL B;  1UNS A;  2JYE A;  2N9L A;  2ZZF A;  1GOZ A;  1QOA A;  4ZYS A;  1GAQ B;  1JW9 D;  1ZXH A;  2ZW0 A;  3E9S A;  1JML A;  2K22 A;  1V97 A;  2ZZE A;  1HQR D;  5T8I A;  1L0V B;  3O13 A;  1FCL A;  4HJG E;  5LNK 1;  1C4P A;  1OQQ A;  4NAM A;  2I2Y A;  4XDC A;  4KGT A;  1WYG A;  1FXI A;  1FNV A;  4WUR A;  3P4S B;  1JWA D;  1N60 A;  2WP9 B;  5C2T B;  1N62 A;  3NS1 A;  1QIL A;  3AE2 B;  3ZGZ A;  2L52 A;  1EM7 A;  2RMM A;  3AB5 A;  3U52 E;  5BYS A;  1I4R A;  1BUI C;  1QQR A;  1TJE A;  2PIA A;  2LFI A;  3V05 A;  2V3P A;  5MPO A;  1FO4 A;  4NJC A;  1GPX A;  2BYT A;  1FMA D;  1JWU D;  1KLG D;  1T6B X;  1TKE A;  5FK9 C;  3GS2 A;  4RH6 A;  3SFE B;  5HHD G;  4A11 A;  1KFY B;  1MHH E;  3V3X A;  3Q8B A;  2IJ0 A;  2W55 A;  2KMM A;  1VJK A;  3L4P A;  1RWS A;  4B0M A;  2YEP B;  1SE4 A;  3W5V B;  1YQ3 B;  2PMV A;  3NVY A;  1V4P A;  1AWD A;  1OFF A;  2Q5W D;  3AEG B;  1UWX A;  3AM9 A;  1HZ5 A;  2LUM A;  3MHZ A;  1L0Y B;  1T5X D;  2WDV B;  3NVW A;  1VZ6 A;  2PW9 A;  4OW0 A;  1UWM A;  4N58 A;  2WQY B;  4LK0 M;  1SEB D;  2V4I B;  1D5Z C;  2DYM A;  1ENF A;  1SSN A;  1EU4 A;  4LLG M;  2PVG C;  2DYO A;  4KGR A;  1IGD A;  4RGN A;  4XWW A;  2INP E;  1TZO A;  1WGK A;  1SB3 C;  1TS3 A;  4RF0 A;  4B0E A;  3U2S C;  3C8Y A;  3ETR A;  1PYW D;  3FAH A;  1ZDV A;  1PDX A;  3RHU A;  1Q10 A;  4XWT A;  4XR2 A;  1PGB A;  3AED B;  3J9C A;  2GI9 A;  3EGR A;  4TSS A;  2N0S B;  2EKI A;  5EE3 A;  2IPK D;  2ZZG A;  1DYQ A;  1RYJ A;  4A55 A;  3IAS 1;  1JQ4 A;  4XR1 A;  2W54 A;  3DWG C;  1QF6 A;  3N9Y C;  1YJJ A;  2FBW B;  3HVD A;  4EE2 A;  4ARC A;  2QIL A;  1ZE3 D;  5AUK A;  3HRD D;  4GDL B;  1K52 A;  3VR9 B;  4ZRP A;  3W1S A;  2JYT A;  4RGT A;  2OHF A;  2WNM A;  4GLS C;  2K9X A;  1STE A;  4TZ4 A;  1PFD A;  1F2R I;  1V1P A;  4DQO C;  4MH8 A;  3SFD B;  2LMC A;  2ACZ B;  3E56 A;  1XCT L;  4A90 A;  1TYG B;  4OZB A;  3BII D;  1F2R C;  1C76 A;  2WLB A;  4R3D A;  2MJE A;  1OQR A;  1WSP A;  2ZTG A;  3ZQ4 A;  1N5X A;  2EEL A;  1EWY C;  2M56 B;  1GB1 A;  1ECR A;  2L83 A;  4TQ1 A;  2BS2 B;  3NRZ A;  1WNU A;  4USA A;  1HXY D;  2K3U A;  1ACC A;  3P63 A;  1UUP A;  3IXS A;  3Q8A A;  4ARI A;  2CJN A;  1TS5 A;  1DOY A;  1D6E C;  1RM6 C;  4YSX B;  4OZC A;  5JXV A;  5HI1 A;  3VRA B;  4L23 A;  5HFY A;  3OWE B;  2JX5 A;  4DXG A;  1P7E A;  2HDE A;  1SE3 A;  4TQ0 A;  2QSD A;  2K5P A;  2J42 A;  4YWG G;  4HKZ E;  4OVZ A;  3W5U B;  3AE1 B;  1KRH A;  3I57 A;  4J3O D;  2BB5 A;  3TEW A;  1XEE A;  3NUH B;  4YTN B;  1KF6 B;  4A6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...