1TKGA

Crystal structure of the editing domain of threonyl-trna synthetase complexed with an analog of seryladenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonyl-tRNA synthetase
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tkgA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tkgA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tkgA02
1DOYA 1QLBB 2ZTGA 5MPOA 3L4PA 3B2FA 4YTMB 3AEDB 4ZHOA 1J7BA 1FFVA 1AYFA 3SR6A 1KF6B 1XLQA 2MJDA 1N62A 1RFKA 4WQMA 3AE6B 5C2TB 2G1EA 1KRHA 4JWSC 1NYRA 2PKOA 1UWMA 3CWIA 5H92C 1XLOA 1SIJA 2MJ3A 3VRAB 3B9JA 4C7ZA 1L6VA 2BS3B 1N5XA 1WYGA 1QT9A 1R7SA 1VLBA 1EWYC 2WQYB 1ZOYB 3VRBB 1F0ZA 3P4QB 1T3QA 3ETRA 4ITKA 4WWMA 2WDQB 1DOXA 1YQ4B 2OHFA 2M19A 3NVVA 2QIEB 1JW9D 3AE8B 1VJKA 3FC4A 1FRDA 2KMMA 4JWUC 5G5GA 1N63A 1QOAA 4P6VF 3RPFC 2L83A 3KEWA 3HRDD 1WRIA 1N61A 1VDVA 2ACZB 2Q5WD 2W3RA 1E10A 3AE5B 4US8A 1V7OA 3ABVB 2WU5B 1FMAD 2H89B 3AMZA 3RHUA 1YJJA 2HTME 2BT6A 1L6UA 2N0SB 3AEBB 1YJIA 3DWMA 1ZUD2 3NVYA 5G5HA 1TYGB 2B76B 4YSYB 1DOIA 2E1BA 2MJEA 1FXIA 2LEKA 1NEKB 3VR9B 2K22A 3HUIA 1ROEA 4YSZB 3AE1B 3SFDB 1QOGA 1V4PA 1TKYA 1JRPA 1XLNA 2FBWB 5AUKA 3AB5A 1AWDA 1JWAD 1GPXA 1FM0D 1QF6A 1N60A 1B9RA 1WXQA 2W55A 3AV8A 1JQ4A 2K9XA 3HVZA 3LXFA 3SFEB 2WLBA 2M56B 3P4PB 2BS4B 2E3TA 3NS1A 2KAJA 3KWLA 4LTUA 4FXCA 2WDRB 1PUTA 3AE7B 1OFFA 3BIID 1FFUA 1XLPA 3AN1A 1WGKA 1GAQB 2L52A 1PFDA 3WCQA 1PDXA 1IUEA 1TKGA 3PO0A 4A9AA 2EKIA 2AX5A 2WP9B 3AEEB 3AE9B 3AE3B 1J7AA 3P4RB 1A70A 3AECB 1TJEA 5EE0A 3VR8B 1FXAA 4YSXB 1WXOA 1YQ3B 1E9MA 1RWSA 4C80A 1RM6C 2JX5A 3P1MA 4IDIA 1TKEA 1WWTA 1J7CA 1N5WA 2WS3B 4YT0B 4N6EB 3RFNA 3EUB2 4N59A 4YXDB 1JALA 2MH7A 4C7YA 1V97A 2DWQA 3P63A 1SF0A 2H88B 1RYJA 5GXGB 1OQQA 3W5VB 2JQRB 3AM9A 3WQZA 5EE9A 2W54A 1L5PA 2ZZEA 1ZXIA 1I7HA 3FAHA 3NVZA 2DBYA 2WDVB 3LB8C 1E6EB 1NI3A 1JWBD 5C3JB 1OQRA 3AEFB 3DWGC 3NRZA 2PVOD 2QJLA 2WU2B 3AE2B 3CIRB 3W5UB 3ZYYX 4ZHPA 1WNUA 2PIAA 2Y5CA 5H8YE 4JX1C 1FIQA 2CU3A 4HROA 1NYQA 5AUIA 2K5PA 2ZZFA 1ZP0B 4HRSA 3P4SB 1QOBA 3AEGB 4YTPB 1JROA 2ZZGA 1NENB 2PVGC 1FO4A 3AH7A 1E7PB 1E0ZA 2W3SA 2CJNA 1CJEA 1NVID 3AEAB 1XO3A 1DGJA 4N58A 4US9A 5EE3A 1FRRA 5EE1A 1QOFA 1KFYB 3AE4B 1SB3C 3B2GA 1V8CA 3W9CB 3NVWA 4ZOHC 1L0VB 4KX6B 4USAA 4YTNB 1CZPA 2CJOA 2BS2B
chains in the Genus database with same CATH superfamily
1JCKB 3VTWA 2D3GA 2ZPNA 3PV1A 2MLBA 2NR2A 1FCCC 1OQYA 4IC7B 1UGJA 3EECA 2LWPA 1NYRA 2LHDA 3K9PB 4EZJA 1FNVA 4XX5A 1F2RI 3BK1A 2FCNA 4DHJB 2LASA 2G45B 2BYFA 1FXTB 3VVWB 1DOXA 3ZNHB 4P6VF 5CHFA 3C8YA 1T6BX 2OOBB 3TL5A 5E6PA 3OG5A 2BVCA 3QWZB 2K8CA 3I63C 2LEKA 4IWQA 2K22A 1BMLC 2VH2A 1ACCA 2LFIA 3HUIA 1BUIC 1CK1A 4A55A 3U8ZA 1XLNA 4OVUA 3GE3C 2M17A 2DAFA 2N9EB 4ZRKA 1WXVA 2IGHA 4LDTD 3ZRFA 4NQLB 3JVZX 2BWES 1WX8A 1E7VA 2DX5B 3W1SC 4RH6A 2KQSA 3UQAA 1C4PA 1WFYA 2KLGA 4AOFA 2BTEA 4WURA 2ZJDA 1OQQA 3KWVA 5EE9A 2W54A 2CHWA 3IHPC 3O13A 3J9CA 5C23A 3EI4A 2Y6IA 1D5ZC 4RGTA 2BWFA 2K8BA 1E8YA 1C3TA 3DHIC 2K0PA 2PIAA 2R2QA 2ZZFA 4NAWB 2Z0DB 2ICIA 1KTKA 3I7KA 2KZRA 3R2TA 1WXSA 3A1QB 4M01A 4KGSA 2PTLA 3IAS1 4ZOHC 3VTVA 2QSDA 3W9CB 1UUPA 2GBRA 4ACFA 5MPOA 1CMXB 3B2FA 2V3SA 3AEDB 2JYTA 3ZQ4A 3N20C 4WAAA 1FCLA 3GOEA 2W82A 1V5TA 2NS5A 3Q3NC 2KDEB 3B9JA 4C7ZA 2KKCA 4OVVA 1XT9B 2IJ0A 1I4GA 2M19A 4RF1A 2J42A 4MACA 1ESFA 1V6EA 1VJKA 3HK0A 3KEWA 4REZA 2J0JA 3X0WA 1SIFA 2L8JA 2FNJB 5KHQA 2PJHA 2BYTA 3AEBB 3BYYB 1FXIA 3MHSD 2KNBA 1QOGA 2V3NA 4K3BA 1Q10A 1JWAD 4EUTA 2KX3A 3PPAA 4B0EA 2R61A 2KAJA 4KZCA 3IFWB 4PYZA 2QDFA 2WDTB 1PFDA 2IY1B 3RZFA 1TJEA 5BYQA 1M94A 1K8RB 2MBHA 4JPSA 3TMPB 3I8EA 1WGDA 3BVZA 3Q14C 3V62A 1P1AA 2GBNA 4HPMB 2JQRB 2D2QA 5E6JA 2NPTA 3VUYA 1AARA 5JZEB 2MEKA 3AE2B 2CKHB 2V4IB 1WE6A 2K5PA 3DCGA 4LJOB 4P7IA 3ZWKA 2DZKA 3GZNI 4WQOB 1FRRA 3AE4B 2WXMA 4ZRPA 3RI7C 4K3CA 3ZJTA 3ONSA 4BZAA 3WA0A 1AN8A 2M1MA 3ZX4A 2GB1A 2WXRA 4E71A 1IGDA 2LVQA 3AU4A 2PLPA 5LNK1 1NBFC 1ZXHA 2CR5A 4OZAA 2XBBC 4P16A 3PZ8A 5C2TB 2G1EA 3RYTA 4AJWA 4TQ0A 2I1JA 4ARFA 1VZ7A 5DPWA 2BBCA 1N5XA 1PQSA 2KTFA 1VLBA 2AYOB 3VRBB 4ZDVA 1ET9A 2LGYA 1Y56A 4CO7A 4HK2A 5G5GA 1VCBA 4MSMB 1A5RA 3L13A 1KH0A 2ZEQA 2JPHA 1E8ZA 1E10A 4FADA 3R2IA 3APCA 1GC6A 3M95A 3PREA 2N0SB 2N9LA 2CHXA 1V2YA 3NVYA 1WGHA 1VD2A 1YQBA 2E1BA 3EC8A 3IVFA 3SFDB 4MGIE 3N1XC 1GPXA 2JF5A 2MQJA 2MBEA 2LUMA 4LNNA 3MJWA 2DLBA 4WWOA 2ZNVC 1XCTL 2IO2B 1FD6A 1GAQB 4KDLB 4FJZA 4IM3A 2R2OA 1J7AA 3P4RB 3AECB 1IBXA 4H2AA 1RM6C 3Q6BA 3PLUA 5IAAC 1WGGA 3HM6X 3NJTA 1ISNA 4ICVA 2DYOA 2IO3B 3U4EG 3JW0X 2DWQA 1RYJA 2I38A 1EF5A 3M3JA 4AWJA 4II2B 2MRPA 3IXSA 3I7LA 3DWGC 3OJ4B 4F7ZA 3QHTA 1QILA 4GLSC 1HTQA 2PW9A 2FCSA 4FHKA 4RCOA 2NTSA 2RR9A 4A20A 2ZTGA 3EGRA 1V86A 4XC2A 3RN9C 1LGRA 2JSVX 2NPTB 1E7UA 2YVCA 3VRAB 2I06A 1QQRA 1WYGA 1L2NA 1EWYC 4LJPB 4MSQB 3ETRA 2Y50A 2WWZA 4WH4A 3BINA 5EDSA 3M63B 2D3AA 1JRUA 2ACZB 1EF1A 1TGZB 2Q5WD 2ASQA 4NPNA 2HTME 4DWFA 4E3CA 4K7WA 4A6QA 3ZW7A 1I4RA 1LXDA 4UDUC 3TEYA 5L95C 2KT7A 2AQ1B 5J2RA 1D6EC 3PSEB 4PYUA 2W55A 3SFEB 1D5MC 2KTRA 2BS4B 2PPHA 1WX7A 2IUSA 2LZ6A 3AE7B 1OFFA 2AWTA 1E8WA 2JZ3B 4A90A 2KWDA 3PO0A 1TIFA 2DAJA 4WJNA 3PZDA 3ECIA 1QZEA 4N6EB 1I4PA 4YXDB 3DBRI 3ZXVA 2MH7A 2N9PC 1V97A 2LXAA 3EA6A 1TTNA 4B95A 2WU2B 3NHEB 2IBIB 2CU3A 4XDDA 3I7NA 1FNWA 2KX0A 2MW5A 3AH7A 1IYFA 3PLVA 2CJNA 4ZRIA 2KLCA 3KH0A 1KFYB 1SEBD 4WJOA 1IBXB 2JRHA 3O65B 3A4SC 4MH0E 1GUAB 4C00A 2M0XA 1TS2A 1WE7A 2XK5A 2LRUA 2ZCBA 3U2SC 3AE6B 4QAYA 3Q8EA 1UWMA 1SIJA 2ZNVB 4RNAA 4ARIA 5FR3A 2GBJA 4XR1A 2V1YA 1SGHA 4KSKC 3T3OA 4FN2A 1WJUA 2LVPA 2PE9A 1WJ4A 2PEAA 5HFYA 4BOZB 2JY6A 4US8A 1EU4A 2LHEA 5GMVA 4OVZA 3VR9B 4C4VA 3V60A 2VRRB 4IKGA 2GLSA 1WRDB 2WXIA 5HKHA 3AV8A 5IO9A 2VZKB 4AP4C 1FFUA 4TQ1A 4MEMA 3DBLI 3BVMA 3ZVVA 3AE3B 3E9SA 3VR8B 1GOZA 4NQKE 4J6IA 2WS3B 1N5WA 1RRBA 4YT0B 5DPTA 3KLSX 5IA7A 4D2KA 2JU6X 4RMAA 1HZ6A 1L0YB 5D7GA 3HIZA 4NJ6A 2JUOA 1NDDA 2L00B 1HTOA 4IOIE 2DBYA 5C1ZA 3RNCC 1T0QC 2G3QB 4OHJA 5JH5C 2N4FA 4W9EA 3V3XA 3D32A 3VUXA 4EE2A 3L17A 2KTRB 3E56A 4JE3B 5AUIA 1OEYA 1QOBA 3AEGB 2ZZGA 5HG2A 1CJEA 4AS1A 3IG3A 4XZ4A 4KX6B 1KLGD 4IM0A 2IGGA 4YWGG 4NY0A 4WWNA 2XEWA 1YMHE 4FBJB 1N62A 1UGMA 3CSFA 1F77A 1GJZA 4JWSC 2KD0A 5CHVC 4IM2A 4HPLB 4ITKA 2WDQB 3VFKA 2MCNB 4L1BA 5T8IA 3GZNB 5JHBA 1SE3A 2LMCA 2D10A 3TSSA 2BYEA 3ZW3A 1H4RA 1FMAD 3NS8A 2KVZA 2YLMA 3I7PA 3PHXB 2O6VA 1TYGB 4URKA 2XK5B 3LYYA 2RMMA 4YSZB 3N1ZC 4JQWC 2G9HD 2D5GA 4W9DA 3DVGX 2K39A 2QMTA 3PRZA 1OGWA 1UF0A 3R7RA 2KWUB 4TKNA 1XLPA 2D3BA 2JWUA 4ZYSA 3ZDTA 1YQ3B 4HDQA 3P1MA 3UQBA 4GIVA 2RPQA 4DBGA 5HI1A 2B3AA 3BK2A 1JALA 4XWWA 2PMVA 2C5LC 2X38A 5JXVA 2H88B 2KJ6A 4C4VB 2ZZEA 2JYEA 1WZ3A 3MHZA 1FNUA 1AW7A 2GBMA 2IGDA 3E0CA 4ZRQA 5C3JB 4G3XB 3Q3JA 4ANVA 1D5XC 1SE4A 2GI9A 2KWCA 4EZKA 3P4SB 1T0YA 4KIKA 2W3SA 1ZDVA 4W9GA 3T3NA 1YJ1A 3HVDA 4A8XC 4USAA 1CZPA 2EWJA 3ZTYA 1SE2A 2N7EA 2ZOSA 2L76A 4W9FA 1XXGA 1RFKA 1WYWB 2UYZB 3RMKC 4GDKA 4HJGE 1L4ZB 2QCZA 3P2BA 1TBEA 4YL8A 3HHMA 2WQYB 1ZOYB 3OWEB 2KQ4X 2NBVB 4WWMA 4ANXA 3DVGY 3MP9A 3PZ7A 2QIEB 4JGHB 3FC4A 1EO6A 4DXFA 2FAZA 5D3DA 4FJVB 1Y8RC 3RHUA 2DENB 3DWMA 3C0RB 2L0FA 4KDIC 5HHDG 2DZIA 2LJIA 3VHTC 5IN7A 1XEEA 3BWUD 2BF8B 2WGSA 1N60A 4KGTA 4ANWA 3R7QA 2INPE 4JIOU 4AQ7A 3ZUPA 3BIID 3TUOA 2LGIA 3WCQA 3VH4B 3P4QB 2WP9B 3VTUA 2IO0B 3U30A 3DDCB 4C80A 3RNBC 2JX5A 3AU5A 3B0AA 2O6VB 1WGRA 4KV2A 3H7PA 1MG8A 1Z2MA 2LVOA 2N7JA 5D3IB 1STEA 1BXTA 3RUIB 1GNUA 4K81A 4N9F4 1WGYA 2WXJA 4W9IA 2QEJC 4A08A 2WX0A 2RDBC 1JROA 5BMIA 4CQNA 2V3PA 1YN5A 1QOFA 2AEHA 3KQ4A 2CJOA 2BS2B 1P7FA 1QLBB 1E5WA 4YTMB 2C9WB 4WWPA 4ZHOA 1J7BA 1FPYA 4NJ7A 3MTNB 3IT6B 3ML8A 2IPKD 4F1SA 2KJHB 2K3UA 2KWVB 2KYWA 2PKOA 1F2RC 4HEA1 4A3PA 4G0NB 3AI5A 1T3QA 3SEBA 1E8XA 4KIKB 2KMMA 3I9V1 5LLIA 1WM2A 2LGDA 1VZ8A 1R4NB 2KC1A 4AREA 2BKFA 1I35A 3AMZA 4G50A 4XR3A 3N32A 3WAMA 2MP2A 2Y5BB 3VDZA 2DYBA 2C7MB 1K50A 1JRPA 1LO5D 4GDKB 3MFGA 5CX3A 1J8CA 1WMHA 1GC7A 3UIPB 3B08A 3PTFC 3LXFA 1SE9A 2RDHA 3VUWA 2K8HA 1YD8U 1PUTA 3IBEA 4I6PA 1ZGUB 1TT5B 1PGBA 2JRIB 3NZUA 4F8CB 3QAQA 1MG4A 4YSXB 1OEYJ 1A70A 2KMAA 3SU8X 1FXAA 3ZTWA 2LXCA 4CI1A 3I89A 3OAWA 2MX2A 3RNFC 4XWTA 4BKGA 3ZO5B 5E6NA 1C78A 5E6OA 1XVIA 1YX6B 2Y3UA 2KANA 2WNMA 3QK0A 4EZLA 1ZP0B 4HRSA 4YTPB 3PVLA 1E7PB 4MH8A 3Q3OC 2I1KA 2KFJA 1DGJA 1S3SG 5EE1A 3DVNV 1I4QA 1SXTA 3B2GA 1TS5A 2C60A 5DPSA 1S1QB 5AZFA 1V1PA 1BT0A 4W9KA 4RF0A 2C7HA 1PGXA 4LDTB 3MC9A 2GRIA 5J18A 3QQ8B 2V0GA 1K51A 1XLQA 4IUMB 3W2DA 3H7PB 1UNSA 4HPPA 5G55A 3QX1A 2INDC 4E54A 1IGCA 1SSNA 5H92C 4JL9A 3EI3A 1QT9A 3RFZB 3L10B 4X57B 3QA8A 2KACA 2ZVNA 1TY2A 4LLGM 1N63A 3RULA 1HA5A 4AR8A 4J3OD 4HDOA 2MSED 2DYMA 3R3MA 1ECRA 1FEHA 4S0RA 4BVUC 2FIDA 5D94A 5G5HA 2MBBB 1NEKB 2BW2A 3DHGC 4MGZE 2EKEC 3N3KB 2J0MA 3WAPA 3N30A 2D07B 3MC0B 2IYDB 2L32A 1FM0D 3GP7A 3H6NA 4BKSD 3QC8B 3VXWA 2NBUA 1TZOA 4JLCA 3KWLA 2L3ZA 3TJPA 3AN1A 4LK0M 2JXXA 3GS2A 4O1NA 4BBNC 1X1MA 2ZW0A 3WALA 3AE9B 4CHKA 3L08A 1K52A 5CHWA 1C9FA 5FQDA 3C19A 2G4DB 1C1YB 3ZTCA 5LXIB 2INNE 2BB5A 2E6XA 2MP2B 3P63A 3V05A 2KQ7A 1I7HA 2WDVB 3WIMA 3RNAC 1WMHB 1EU3A 4MM3A 4HJKA 3A9KA 3RNGC 4PT5A 3CSTA 2WX1A 2XN9C 4KKIA 1MHHE 4WAFA 1FO4A 3DBHI 2WXNA 3UIOB 1NVID 1WR6E 3ML9A 3L54A 4ANUA 3Q3FA 3MJ5A 2REXA 2WXPA 4KKJA 2GOWA 1FFVA 2TSSA 3LDZE 2L7RA 3A4RA 3KVFB 2K25A 2W9NA 2KO3A 4WIPA 3ZNZB 2INCC 4HKZE 2LJ5A 4HKQA 1I4XA 1WI0A 4AJYB 1TS3A 4PK1A 1EM7A 3I8CA 2GBKA 1U4AA 2CHZA 2LGSA 2KC2A 2BGFA 3TIXA 3RPFC 1R4MI 3HRDD 1WRIA 2KXJA 4M00A 1N61A 1VDVA 3EFUA 4GXBA 4EFOA 4FA6A 2K6DB 1JWUD 1V1PB 2KFKA 1MPEA 4OZCA 2BT6A 3LJ3A 4A11A 4MJSA 3H9DA 5D2MB 1P3QU 1ROEA 1WY8A 4OW0A 2FBWB 2J7QB 3AB5A 1WXMA 4ARCA 1RFAA 3A33B 2WXOA 3P4PB 2KDFB 3NS1A 3OJ3A 4FJYA 3SDLC 3EFCA 3NZSA 5JHAA 1PDXA 1IUEA 4ICUA 2QILA 2G4SA 4RGNA 4EEWA 4W9LA 2K6QA 4IDIA 1WWTA 1J7CA 2ZCCA 3TEZA 2N1VA 5KHOA 3RT3B 1ZXIA 4B9KA 3LB8C 1JWBD 5G2NA 4WJPA 3PS6A 3ZYYX 2HJ8A 4ZHPA 3I57A 2JZZA 1WJ6A 3VQIA 3VAWA 2KVRA 4TSSA 3AEAB 4US9A 3N9YC 1C77A 3DQVA 2QC8A 3CF6E 3M62B 4GDLA 3L4PA 3DOWA 1VRAB 4M8NA 4WQMA 2KN4A 1V5OA 3ZRCA 2ZZPB 1C76A 4NAMA 2BS3B 1MHXA 1R7SA 4MM3B 5I4DA 3A9KB 4IW0A 4RGMA 2PE6B 1I4HA 1TS4A 3APDA 1EUVB 2MHJA 3R66C 2DNFA 2LGXA 4MGKE 1UBIA 4DHZE 3T9LA 4B0MA 2W3RA 1WR1A 1QKZA 3UF8A 4TZ4A 1SJHD 2BQQA 4BAXA 1YJIA 1ENFA 2B76B 1DOIA 1JWSD 2I2YA 2OJWA 4ZRJA 1QF6A 2EELA 3ZX5A 1P7EA 1KJTA 3HVZA 4RGOS 1L4DB 1P98A 3TBLD 2M0AA 4P1CC 4A3OA 2CS4A 1SJED 4HCNB 2UU7A 1M4VA 2FCQA 4W9CA 3TEWA 1RWSA 2KFKB 4PS3A 1F9JA 3GB1A 3NZ3A 4MJSB 2KK8A 4XE0A 3AM9A 4HXDA 2HJ1A 2IUUA 2KJRA 5IKCM 4CI2A 4XDCA 2KOXA 3AEFB 4M0WA 1UZXB 5BMGA 4MELA 2OEDA 1KLVA 2Y5CA 4G11A 1HEZE 4OZBA 3CMMB 2Z0EB 4GGQA 3RNEC 2V4LA 1WSPA 1LFDA 1DOYA 4R3DA 3EHVA 3KUZA 3FKYA 2NBWB 1AYFA 2MWSB 5AZHA 4GU2A 4RM9A 1RLFA 4GN1A 4ASWC 1L6VA 1GB4A 1F0ZA 4K7SA 1WIAA 1YQ4B 3ZIMA 5J17A 1J0GA 4M02A 2WHIA 1OTRB 3ALBA 4TMAB 2H89B 1MJDA 2NMQA 4HVBA 4GDLB 2J52A 4RM8A 2YEPB 1WM3A 2K1FA 2LI5A 3OLMD 3QARA 1K53A 1HQRD 3AULA 2UWQA 4FLHA 2WLBA 4DXAB 5D6JB 3ENEA 2A5UA 4FHJA 3W1SA 3L0WB 3RD2A 4C56C 2BB6A 1Q0WB 3SD5A 2M4NA 1MFWA 2C7NB 2WXFA 1TY0A 1B1ZA 1SF0A 5GXGB 2MBOA 1L5PA 3NVZA 2DZJA 2J53A 3DPDA 4BKTA 4EKUA 4RFBA 3P42A 1J19A 3Q3MC 3W5UB 2JT4B 3ZUNA 4LNOA 1D4BA 3PRMB 2KDBA 3DBSA 3I5JC 1YNTE 3AXCA 4NZLB 2EMSA 1GG3A 1UH6A 2HDEA 3V6CB 3I7HA 4E74A 2FCMA 1PGAA 2L05A 3KW5B 3TEXA 3CWIA 3NG0A 4M0WB 4GMVA 1YN3A 3ZXRA 3N1YC 2D3CA 3NVVA 3DBHB 2RGFA 1JW9D 2BKRB 3ZDMC 1FRDA 1QOAA 2L83A 3DBRB 4AR9A 2X8XX 4W9HA 2WU5B 3H1UA 4PS8A 2L1AA 4TUUA 1XD3B 4A09A 1XQQA 3L16A 1AWDA 1B9RA 4P1BC 3X23A 4LCDE 2RSUA 5DPRA 5FR6A 4GOCA 4EOYA 3U7ZA 3ZNID 1R4MB 1TKGA 1UD7A 3IAM1 2AL6A 5TR5A 2N7DA 3PRPB 1HXYD 4MDKE 2QHOA 3ZJVA 2FUHB 2IDYA 3EI1A 3BZDB 3BVGA 3ZGZA 1OQRA 2Z8LA 1HZ5A 1NI2A 4HROA 5DCNA 1NYQA 1EWCA 3ZU6A 2M8SA 3DHHC 4MGYE 3A9JA 1KM7A 1XO3A 1MVKA 3NVWA 2VZKD 1V80A 3H7SA 1YIWA 2WXLA 2KMCA 1KF6B 1XF5L 2LRWA 1WZCA 4I6NB 5TSSA 1XLOA 2MJ3A 3DBLB 3FILA 3DVNU 2BPSA 1V1OA 3RCZA 2WXKA 2WXGA 4LNFA 3Q8FA 2DHZA 2RPVA 4JWUC 1UBQA 3I7OA 1WXAA 1MI0A 2KDMA 3ABVB 4ZYNA 1UWXA 3ZKJC 4DK5A 2XNAC 1V9JA 2JZPA 2N1WA 3URYA 1LM8B 4E5ZA 2IUTA 3WAOA 5AUKA 1LQBA 3U52E 1JQ4A 2I05A 2SAKA 4BOSC 2A4ZA 1CQVA 3PHWB 4LTUA 2WDRB 4GB9A 1WGKA 2L52A 3NUHB 4W9JA 2BYVE 4LNKA 5IOIA 2EKIA 2AX5A 2CU1A 1JMLA 2JWZA 4L23A 3R8BA 2HE7A 2V9HA 1TKEA 4IWOA 3KUDB 3RFNA 2WYQA 3RZWC 4A0AA 3JSVA 1I42A 2KHWB 2Y3AA 4DDGD 4CI3A 3Q8CA 1RAXA 3FAHA 4XR2A 3V61A 3ZLZA 1E6EB 2RD0A 3IT4B 1IPGA 2MBQA 3CIRB 1WJNA 2N9XA 2B5LA 4KSLC 2IY0B 5BMHA 4DHJD 2PVGC 1E90A 1E0ZA 4S17A 5EE3A 3S2AA 4N58A 4DHZB 3W1YA 3APFA 1V8CA 5H8YE 1HE8A 1WF9A 1WZ0A 4M8MA 4KGRA 3T8MA 4KZ0A 1T5XD 3K9OB 4HCPB 5IP4D 2DZMA 1V81A 2J4XA 2Y5PA 1GB1A 1XCQL 2MJDA 2ZW1A 2Z59B 1KRHA 1H8CA 2LUEA 5BO4B 2J0KA 5AZGA 3EI2A 4WJQA 2O2VA 3AE8B 4BFRA 2IZVB 4BBNF 3BY4B 4K7UA 3A9JB 1P9DU 3AE5B 1ZW7A 2WXHA 3KUCB 1L6UA 1JWMD 4IWPA 5CTRC 4YSYB 2MJEA 1TZ1A 2VH1A 4MT5A 3AE1B 4HLEA 3Q8AA 1V4PA 3KYCD 1KLUD 4DXGA 1T0SC 3B1LX 1DYQA 2M56B 3FILB 3GE8C 2E3TA 4FXCA 3PT2B 1YX5B 2FE8A 1C4CA 5AEKB 3AEEB 4HWIB 5EE0A 4AR1A 2AQ2B 1WXOA 3UGBB 1E9MA 4BKSA 4DDID 3EUB2 3KYDD 1R4NI 4KVGB 3ZWDA 3W5VB 2N9KA 3WQZA 3Q2AC 2NTTA 1ZDXA 4PS7A 2JXTA 1NI3A 3I3TB 3BYTB 1YN4A 2AQ3B 2NCNA 4NJCA 4IG7B 1C79A 2PVOD 3NRZA 2QJLA 4A0BA 1WNUA 3Q8BA 4JX1C 3VH3B 1F52A 1N6ZA 4DQOC 2D11A 5FKAC 3QJZA 5FK9C 4NNJB 5BYSA 2ONQA 2HD5B 1L0VB 4XYCA 4K1RB 2WXQA 1Q1OA 1V49A 4CYEA 2ZPYA 2ZVOA 3JSVB 3MC8A 3SR6A 1PYWD 3HM3A 3V6EB 2SEBD 2HTHA 3UI3A 1G6JA 2NVUI 2MA9B 3ZTDA 2RDGA 2O6VD 4XGAB 2OHFA 1Z5SB 2AL3A 1VZ6A 2ON8A 2OJRA 1ZPSA 3ZJUA 1Q5WB 3Q69A 5L83A 1V7OA 4I6LB 1L0XB 1YJJA 3QCAA 1ZKHA 2IO1B 4TV3A 1ZUD2 4AUQC 4LNIA 1C4AA 1TKYA 3ZNGC 5BYRA 1WXQA 1IP9A 2YEPF 2JVCA 4Q2JA 2K9XA 3NOBA 1WX9A 1KOTA 2GMIC 4NAWA 3QIJA 3TCAA 2O2VB 5LXHA 4FULA 4A9AA 3A1QA 4L2YA 2B5MA 1WH3A 1P0RA 1D3ZA 1SBBB 4N59A 1T0RC 4II3B 3SHQA 4C7YA 1YOVB 2KDIA 1UELA 2EMTA 2HYEA 1ZE3D 1ET6A 2FIFA 2FUG1 2L0TA 3JYUA 1FIQA 3PGEA 4GSWA 4B6WA 1NENB 4XR0A 1L7YA 1F1HA 3UINB 3H8HA 1SB3C 1VR9A 3U7DA 2LD9A 4YTNB 3NY5A 2KN5A 3WANA
chains in the Genus database with same CATH topology
1JCKB 1TS2A 2HDEA 1PGXA 3I7HA 2GRIA 1FCCC 1K51A 1XLQA 2V0GA 3W2DA 1UGJA 1UNSA 3U2SC 3AE6B 1PGAA 4E54A 3Q8EA 1IGCA 1NYRA 3TEXA 1SSNA 1UWMA 2LHDA 1FNVA 1SIJA 3CWIA 4RNAA 5H92C 1F2RI 3BK1A 3EI3A 1QT9A 4ARIA 3RFZB 5FR3A 1YN3A 4XR1A 1DOXA 3T3OA 2KACA 3NVVA 1JW9D 1FRDA 1TY2A 4LLGM 1N63A 1QOAA 4P6VF 1HA5A 2L83A 4AR8A 4AR9A 4J3OD 3C8YA 5HFYA 1T6BX 4US8A 2DYMA 2WU5B 1EU4A 2LHEA 1ECRA 4OVZA 1FEHA 5G5HA 2L1AA 2LEKA 1NEKB 3VR9B 2BW2A 2K22A 1BMLC 1ACCA 2LFIA 3HUIA 1BUIC 4A09A 1CK1A 4A55A 1XLNA 4IKGA 1AWDA 3MC0B 2L32A 1FM0D 1B9RA 2WXIA 3AV8A 3GP7A 2IGHA 2VZKB 1TZOA 3KWLA 1FFUA 4TQ1A 3AN1A 4LK0M 3GS2A 4O1NA 3U7ZA 1TKGA 3BVMA 3IAM1 2ZW0A 3AE3B 3AE9B 3E9SA 3VR8B 1GOZA 1HXYD 1K52A 3ZJVA 4RH6A 2WS3B 1N5WA 4YT0B 1C9FA 2IDYA 5FQDA 3KLSX 1C4PA 2JU6X 4D2KA 1HZ6A 1L0YB 3EI1A 2INNE 2BB5A 2E6XA 3P63A 4WURA 5D7GA 3V05A 2BTEA 1OQQA 3BZDB 3BVGA 3KWVA 5EE9A 2W54A 3O13A 1I7HA 4IOIE 3J9CA 2DBYA 2WDVB 3EI4A 4OHJA 1EU3A 2Y6IA 1D5ZC 3ZGZA 1OQRA 4RGTA 3V3XA 2Z8LA 4EE2A 1HZ5A 4PT5A 2K0PA 3E56A 2XN9C 2PIAA 4JE3B 2ZZFA 4HROA 4KKIA 1NYQA 1EWCA 4NAWB 5AUIA 1MHHE 1QOBA 3AEGB 2ZZGA 4WAFA 1FO4A 2ICIA 1KTKA 5HG2A 2WXNA 3I7KA 3R2TA 1CJEA 1NVID 1XO3A 1MVKA 4KGSA 4AS1A 2PTLA 3MJ5A 3IAS1 3NVWA 4ZOHC 2QSDA 4KX6B 3W9CB 1UUPA 1KLGD 2VZKD 2WXPA 4KKJA 2IGGA 2WXLA 5MPOA 4YWGG 3B2FA 3AEDB 2JYTA 1FFVA 3ZQ4A 2TSSA 1KF6B 1XF5L 1FCLA 1YMHE 1N62A 4WIPA 2W82A 1F77A 4HKZE 4JWSC 4HKQA 5TSSA 1I4XA 1TS3A 1XLOA 2MJ3A 3B9JA 4C7ZA 1EM7A 3I8CA 3FILA 1V1OA 4ITKA 2IJ0A 2WDQB 1I4GA 2M19A 4RF1A 2J42A 2WXKA 2WXGA 1ESFA 4MACA 4L1BA 1VJKA 3RPFC 3Q8FA 2RPVA 4JWUC 5T8IA 1SE3A 2LMCA 3HRDD 3TSSA 1WRIA 3KEWA 1N61A 1VDVA 4REZA 3I7OA 1MI0A 2KDMA 1JWUD 1V1PB 3ABVB 1FMAD 1MPEA 1UWXA 4OZCA 3I7PA 2XNAC 2BT6A 2BYTA 3AEBB 4A11A 2JZPA 3BYYB 1TYGB 3URYA 1FXIA 3LYYA 2RMMA 4E5ZA 1ROEA 4YSZB 1QOGA 4OW0A 2V3NA 2IUTA 1Q10A 2FBWB 2D5GA 2G9HD 5AUKA 3AB5A 1JWAD 3U52E 4ARCA 2QMTA 1JQ4A 2I05A 2SAKA 2WXOA 3P4PB 4B0EA 3NS1A 1CQVA 2R61A 2KAJA 4LTUA 2WDRB 1XLPA 1WGKA 2L52A 3NUHB 1PFDA 1PDXA 1IUEA 2QILA 2EKIA 2AX5A 4RGNA 2JWUA 4ZYSA 1JMLA 1TJEA 4L23A 5BYQA 1YQ3B 3R8BA 4JPSA 3P1MA 4IDIA 1TKEA 1WWTA 1J7CA 3TEZA 3RFNA 4A0AA 5HI1A 3BK2A 1JALA 4XWWA 2PMVA 3I8EA 2Y3AA 2X38A 3BVZA 5JXVA 2H88B 2JQRB 2ZZEA 2JYEA 3MHZA 3Q8CA 1ZXIA 1FNUA 3FAHA 5E6JA 4XR2A 4CI3A 1AW7A 3LB8C 2IGDA 1E6EB 3E0CA 4ZRQA 3IT4B 1JWBD 5C3JB 2MEKA 3AE2B 3CIRB 1D5XC 1SE4A 2GI9A 3ZYYX 4ZHPA 3I57A 2B5LA 2V4IB 2K5PA 5BMHA 3P4SB 2PVGC 3VQIA 1E0ZA 2W3SA 4TSSA 1ZDVA 3AEAB 5EE3A 4N58A 4US9A 3T3NA 1FRRA 3N9YC 3HVDA 3AE4B 1C77A 4A8XC 1V8CA 2WXMA 4ZRPA 4USAA 5H8YE 1CZPA 3ZJTA 2EWJA 1SE2A 4KGRA 1AN8A 1T5XD 2GB1A 2WXRA 3L4PA 1IGDA 2J4XA 2PLPA 2Y5PA 5LNK1 1XCQL 1XXGA 1GB1A 1ZXHA 2MJDA 1VRAB 4OZAA 1RFKA 2ZW1A 4WQMA 2KN4A 3PZ8A 4P16A 5C2TB 2G1EA 1KRHA 4HJGE 1L4ZB 4TQ0A 4ARFA 1VZ7A 1C76A 4NAMA 2BBCA 2BS3B 1N5XA 1MHXA 1R7SA 4MM3B 1VLBA 2WQYB 5I4DA 1ZOYB 3OWEB 4RGMA 3VRBB 2KQ4X 3EI2A 4WWMA 1I4HA 1ET9A 1Y56A 1TS4A 3MP9A 3PZ7A 2QIEB 3AE8B 5G5GA 3FC4A 4DXFA 1KH0A 5D3DA 2W3RA 4B0MA 1E10A 3AE5B 3R2IA 1QKZA 4TZ4A 1SJHD 3RHUA 2WXHA 1L6UA 1JWMD 2N0SB 2N9LA 1YJIA 3DWMA 3NVYA 1ENFA 2B76B 4YSYB 1DOIA 2E1BA 2MJEA 5HHDG 1JWSD 2LJIA 4MT5A 3AE1B 3Q8AA 3SFDB 1V4PA 2I2YA 4YTNB 1KLUD 1XEEA 3BWUD 4DXGA 1GPXA 1QF6A 1N60A 4KGTA 2EELA 1DYQA 2INPE 1P7EA 3HVZA 4RGOS 2LUMA 1L4DB 2M56B 2E3TA 3FILB 4AQ7A 2M0AA 2DLBA 4FXCA 3BIID 1FD6A 1XCTL 2FE8A 1SJED 1GAQB 1M4VA 2LGIA 3TUOA 3WCQA 1C4CA 3AEEB 2WP9B 3P4QB 5EE0A 1J7AA 3P4RB 4AR1A 2AQ2B 3AECB 1IBXA 1WXOA 3TEWA 1E9MA 4H2AA 1RWSA 4C80A 1RM6C 2JX5A 3EUB2 3GB1A 3NZ3A 2DYOA 3U4EG 2DWQA 4XE0A 3W5VB 2N9KA 1RYJA 3WQZA 2NTTA 3AM9A 1ZDXA 2I38A 2IUUA 2N7JA 2JXTA 1NI3A 3BYTB 5D3IB 4CI2A 1STEA 4XDCA 1BXTA 1YN4A 2AQ3B 3IXSA 3AEFB 1C79A 3DWGC 2PVOD 3NRZA 2QJLA 4M0WA 4NJCA 5BMGA 3I7LA 4A0BA 2OEDA 2WXJA 1WNUA 3Q8BA 2Y5CA 2QEJC 4A08A 4JX1C 1HEZE 4OZBA 1JROA 4DQOC 5FKAC 5BMIA 4CQNA 1QILA 2V3PA 1YN5A 5FK9C 4GLSC 5BYSA 2ONQA 1QOFA 2PW9A 1WSPA 1L0VB 3KQ4A 2CJOA 2BS2B 4RCOA 1P7FA 2NTSA 1DOYA 2WXQA 1QLBB 4R3DA 2ZTGA 4YTMB 3EGRA 4ZHOA 1J7BA 1AYFA 3SR6A 3IT6B 1PYWD 2IPKD 2SEBD 2JSVX 2K3UA 2PKOA 3UI3A 3VRAB 2I06A 1QQRA 1L6VA 1WYGA 1F2RC 4HEA1 1GB4A 2RDGA 1EWYC 1F0ZA 1T3QA 3ETRA 2Y50A 1YQ4B 2OHFA 3SEBA 4WH4A 1VZ6A 2KMMA 3I9V1 1VZ8A 2ON8A 1ZPSA 2ACZB 3ZJUA 2Q5WD 3Q69A 4TMAB 1V7OA 4AREA 2H89B 3AMZA 1L0XB 1YJJA 2NMQA 4XR3A 2HTME 4GDLB 2J52A 1ZUD2 4A6QA 1I4RA 2YEPB 4UDUC 1C4AA 1TKYA 1K50A 3TEYA 1JRPA 1LO5D 4GDKB 5BYRA 2AQ1B 3MFGA 1D6EC 1K53A 1WXQA 1HQRD 2W55A 2YEPF 4Q2JA 2K9XA 1D5MC 3LXFA 2RDHA 2WLBA 3SFEB 2BS4B 2IUSA 1PUTA 3AE7B 1OFFA 1PGBA 4A90A 3W1SA 2KWDA 3PO0A 4A9AA 4L2YA 2B5MA 4YSXB 1A70A 4C56C 1FXAA 2BB6A 1SBBB 4CI1A 4N6EB 3I89A 1I4PA 4N59A 4YXDB 4XWTA 2WXFA 2MH7A 4C7YA 1V97A 1TY0A 3EA6A 1B1ZA 1C78A 1SF0A 5GXGB 1L5PA 3NVZA 2J53A 2Y3UA 2HYEA 1ZE3D 1ET6A 4RFBA 2WNMA 3P42A 2FUG1 2WU2B 3W5UB 1FIQA 2CU3A 4XDDA 1D4BA 3I7NA 1FNWA 1ZP0B 4HRSA 4YTPB 1NENB 4XR0A 3AH7A 1E7PB 4MH8A 2CJNA 1DGJA 3H8HA 5EE1A 1I4QA 1KFYB 1SEBD 1SB3C 1SXTA 1TS5A 3B2GA 1VR9A 1IBXB 1V1PA 1YNTE 4NZLB 4RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOY A;  1QLB B;  2ZTG A;  5MPO A;  3L4P A;  3B2F A;  4YTM B;  3AED B;  4ZHO A;  1J7B A;  1FFV A;  1AYF A;  3SR6 A;  1KF6 B;  1XLQ A;  2MJD A;  1N62 A;  1RFK A;  4WQM A;  3AE6 B;  5C2T B;  2G1E A;  1KRH A;  4JWS C;  1NYR A;  2PKO A;  1UWM A;  3CWI A;  5H92 C;  1XLO A;  1SIJ A;  2MJ3 A;  3VRA B;  3B9J A;  4C7Z A;  1L6V A;  2BS3 B;  1N5X A;  1WYG A;  1QT9 A;  1R7S A;  1VLB A;  1EWY C;  2WQY B;  1ZOY B;  3VRB B;  1F0Z A;  3P4Q B;  1T3Q A;  3ETR A;  4ITK A;  4WWM A;  2WDQ B;  1DOX A;  1YQ4 B;  2OHF A;  2M19 A;  3NVV A;  2QIE B;  1JW9 D;  3AE8 B;  1VJK A;  3FC4 A;  1FRD A;  2KMM A;  4JWU C;  5G5G A;  1N63 A;  1QOA A;  4P6V F;  3RPF C;  2L83 A;  3KEW A;  3HRD D;  1WRI A;  1N61 A;  1VDV A;  2ACZ B;  2Q5W D;  2W3R A;  1E10 A;  3AE5 B;  4US8 A;  1V7O A;  3ABV B;  2WU5 B;  1FMA D;  2H89 B;  3AMZ A;  3RHU A;  1YJJ A;  2HTM E;  2BT6 A;  1L6U A;  2N0S B;  3AEB B;  1YJI A;  3DWM A;  1ZUD 2;  3NVY A;  5G5H A;  1TYG B;  2B76 B;  4YSY B;  1DOI A;  2E1B A;  2MJE A;  1FXI A;  2LEK A;  1NEK B;  3VR9 B;  2K22 A;  3HUI A;  1ROE A;  4YSZ B;  3AE1 B;  3SFD B;  1QOG A;  1V4P A;  1TKY A;  1JRP A;  1XLN A;  2FBW B;  5AUK A;  3AB5 A;  1AWD A;  1JWA D;  1GPX A;  1FM0 D;  1QF6 A;  1N60 A;  1B9R A;  1WXQ A;  2W55 A;  3AV8 A;  1JQ4 A;  2K9X A;  3HVZ A;  3LXF A;  3SFE B;  2WLB A;  2M56 B;  3P4P B;  2BS4 B;  2E3T A;  3NS1 A;  2KAJ A;  3KWL A;  4LTU A;  4FXC A;  2WDR B;  1PUT A;  3AE7 B;  1OFF A;  3BII D;  1FFU A;  1XLP A;  3AN1 A;  1WGK A;  1GAQ B;  2L52 A;  1PFD A;  3WCQ A;  1PDX A;  1IUE A;  1TKG A;  3PO0 A;  4A9A A;  2EKI A;  2AX5 A;  2WP9 B;  3AEE B;  3AE9 B;  3AE3 B;  1J7A A;  3P4R B;  1A70 A;  3AEC B;  1TJE A;  5EE0 A;  3VR8 B;  1FXA A;  4YSX B;  1WXO A;  1YQ3 B;  1E9M A;  1RWS A;  4C80 A;  1RM6 C;  2JX5 A;  3P1M A;  4IDI A;  1TKE A;  1WWT A;  1J7C A;  1N5W A;  2WS3 B;  4YT0 B;  4N6E B;  3RFN A;  3EUB 2;  4N59 A;  4YXD B;  1JAL A;  2MH7 A;  4C7Y A;  1V97 A;  2DWQ A;  3P63 A;  1SF0 A;  2H88 B;  1RYJ A;  5GXG B;  1OQQ A;  3W5V B;  2JQR B;  3AM9 A;  3WQZ A;  5EE9 A;  2W54 A;  1L5P A;  2ZZE A;  1ZXI A;  1I7H A;  3FAH A;  3NVZ A;  2DBY A;  2WDV B;  3LB8 C;  1E6E B;  1NI3 A;  1JWB D;  5C3J B;  1OQR A;  3AEF B;  3DWG C;  3NRZ A;  2PVO D;  2QJL A;  2WU2 B;  3AE2 B;  3CIR B;  3W5U B;  3ZYY X;  4ZHP A;  1WNU A;  2PIA A;  2Y5C A;  5H8Y E;  4JX1 C;  1FIQ A;  2CU3 A;  4HRO A;  1NYQ A;  5AUI A;  2K5P A;  2ZZF A;  1ZP0 B;  4HRS A;  3P4S B;  1QOB A;  3AEG B;  4YTP B;  1JRO A;  2ZZG A;  1NEN B;  2PVG C;  1FO4 A;  3AH7 A;  1E7P B;  1E0Z A;  2W3S A;  2CJN A;  1CJE A;  1NVI D;  3AEA B;  1XO3 A;  1DGJ A;  4N58 A;  4US9 A;  5EE3 A;  1FRR A;  5EE1 A;  1QOF A;  1KFY B;  3AE4 B;  1SB3 C;  3B2G A;  1V8C A;  3W9C B;  3NVW A;  4ZOH C;  1L0V B;  4KX6 B;  4USA A;  4YTN B;  1CZP A;  2CJO A;  2BS2 B; 
#chains in the Genus database with same CATH topology
 1JCK B;  3VTW A;  2D3G A;  2ZPN A;  3PV1 A;  2MLB A;  2NR2 A;  1FCC C;  1OQY A;  4IC7 B;  1UGJ A;  3EEC A;  2LWP A;  1NYR A;  2LHD A;  3K9P B;  4EZJ A;  1FNV A;  4XX5 A;  1F2R I;  3BK1 A;  2FCN A;  4DHJ B;  2LAS A;  2G45 B;  2BYF A;  1FXT B;  3VVW B;  1DOX A;  3ZNH B;  4P6V F;  5CHF A;  3C8Y A;  1T6B X;  2OOB B;  3TL5 A;  5E6P A;  3OG5 A;  2BVC A;  3QWZ B;  2K8C A;  3I63 C;  2LEK A;  4IWQ A;  2K22 A;  1BML C;  2VH2 A;  1ACC A;  2LFI A;  3HUI A;  1BUI C;  1CK1 A;  4A55 A;  3U8Z A;  1XLN A;  4OVU A;  3GE3 C;  2M17 A;  2DAF A;  2N9E B;  4ZRK A;  1WXV A;  2IGH A;  4LDT D;  3ZRF A;  4NQL B;  3JVZ X;  2BWE S;  1WX8 A;  1E7V A;  2DX5 B;  3W1S C;  4RH6 A;  2KQS A;  3UQA A;  1C4P A;  1WFY A;  2KLG A;  4AOF A;  2BTE A;  4WUR A;  2ZJD A;  1OQQ A;  3KWV A;  5EE9 A;  2W54 A;  2CHW A;  3IHP C;  3O13 A;  3J9C A;  5C23 A;  3EI4 A;  2Y6I A;  1D5Z C;  4RGT A;  2BWF A;  2K8B A;  1E8Y A;  1C3T A;  3DHI C;  2K0P A;  2PIA A;  2R2Q A;  2ZZF A;  4NAW B;  2Z0D B;  2ICI A;  1KTK A;  3I7K A;  2KZR A;  3R2T A;  1WXS A;  3A1Q B;  4M01 A;  4KGS A;  2PTL A;  3IAS 1;  4ZOH C;  3VTV A;  2QSD A;  3W9C B;  1UUP A;  2GBR A;  4ACF A;  5MPO A;  1CMX B;  3B2F A;  2V3S A;  3AED B;  2JYT A;  3ZQ4 A;  3N20 C;  4WAA A;  1FCL A;  3GOE A;  2W82 A;  1V5T A;  2NS5 A;  3Q3N C;  2KDE B;  3B9J A;  4C7Z A;  2KKC A;  4OVV A;  1XT9 B;  2IJ0 A;  1I4G A;  2M19 A;  4RF1 A;  2J42 A;  4MAC A;  1ESF A;  1V6E A;  1VJK A;  3HK0 A;  3KEW A;  4REZ A;  2J0J A;  3X0W A;  1SIF A;  2L8J A;  2FNJ B;  5KHQ A;  2PJH A;  2BYT A;  3AEB B;  3BYY B;  1FXI A;  3MHS D;  2KNB A;  1QOG A;  2V3N A;  4K3B A;  1Q10 A;  1JWA D;  4EUT A;  2KX3 A;  3PPA A;  4B0E A;  2R61 A;  2KAJ A;  4KZC A;  3IFW B;  4PYZ A;  2QDF A;  2WDT B;  1PFD A;  2IY1 B;  3RZF A;  1TJE A;  5BYQ A;  1M94 A;  1K8R B;  2MBH A;  4JPS A;  3TMP B;  3I8E A;  1WGD A;  3BVZ A;  3Q14 C;  3V62 A;  1P1A A;  2GBN A;  4HPM B;  2JQR B;  2D2Q A;  5E6J A;  2NPT A;  3VUY A;  1AAR A;  5JZE B;  2MEK A;  3AE2 B;  2CKH B;  2V4I B;  1WE6 A;  2K5P A;  3DCG A;  4LJO B;  4P7I A;  3ZWK A;  2DZK A;  3GZN I;  4WQO B;  1FRR A;  3AE4 B;  2WXM A;  4ZRP A;  3RI7 C;  4K3C A;  3ZJT A;  3ONS A;  4BZA A;  3WA0 A;  1AN8 A;  2M1M A;  3ZX4 A;  2GB1 A;  2WXR A;  4E71 A;  1IGD A;  2LVQ A;  3AU4 A;  2PLP A;  5LNK 1;  1NBF C;  1ZXH A;  2CR5 A;  4OZA A;  2XBB C;  4P16 A;  3PZ8 A;  5C2T B;  2G1E A;  3RYT A;  4AJW A;  4TQ0 A;  2I1J A;  4ARF A;  1VZ7 A;  5DPW A;  2BBC A;  1N5X A;  1PQS A;  2KTF A;  1VLB A;  2AYO B;  3VRB B;  4ZDV A;  1ET9 A;  2LGY A;  1Y56 A;  4CO7 A;  4HK2 A;  5G5G A;  1VCB A;  4MSM B;  1A5R A;  3L13 A;  1KH0 A;  2ZEQ A;  2JPH A;  1E8Z A;  1E10 A;  4FAD A;  3R2I A;  3APC A;  1GC6 A;  3M95 A;  3PRE A;  2N0S B;  2N9L A;  2CHX A;  1V2Y A;  3NVY A;  1WGH A;  1VD2 A;  1YQB A;  2E1B A;  3EC8 A;  3IVF A;  3SFD B;  4MGI E;  3N1X C;  1GPX A;  2JF5 A;  2MQJ A;  2MBE A;  2LUM A;  4LNN A;  3MJW A;  2DLB A;  4WWO A;  2ZNV C;  1XCT L;  2IO2 B;  1FD6 A;  1GAQ B;  4KDL B;  4FJZ A;  4IM3 A;  2R2O A;  1J7A A;  3P4R B;  3AEC B;  1IBX A;  4H2A A;  1RM6 C;  3Q6B A;  3PLU A;  5IAA C;  1WGG A;  3HM6 X;  3NJT A;  1ISN A;  4ICV A;  2DYO A;  2IO3 B;  3U4E G;  3JW0 X;  2DWQ A;  1RYJ A;  2I38 A;  1EF5 A;  3M3J A;  4AWJ A;  4II2 B;  2MRP A;  3IXS A;  3I7L A;  3DWG C;  3OJ4 B;  4F7Z A;  3QHT A;  1QIL A;  4GLS C;  1HTQ A;  2PW9 A;  2FCS A;  4FHK A;  4RCO A;  2NTS A;  2RR9 A;  4A20 A;  2ZTG A;  3EGR A;  1V86 A;  4XC2 A;  3RN9 C;  1LGR A;  2JSV X;  2NPT B;  1E7U A;  2YVC A;  3VRA B;  2I06 A;  1QQR A;  1WYG A;  1L2N A;  1EWY C;  4LJP B;  4MSQ B;  3ETR A;  2Y50 A;  2WWZ A;  4WH4 A;  3BIN A;  5EDS A;  3M63 B;  2D3A A;  1JRU A;  2ACZ B;  1EF1 A;  1TGZ B;  2Q5W D;  2ASQ A;  4NPN A;  2HTM E;  4DWF A;  4E3C A;  4K7W A;  4A6Q A;  3ZW7 A;  1I4R A;  1LXD A;  4UDU C;  3TEY A;  5L95 C;  2KT7 A;  2AQ1 B;  5J2R A;  1D6E C;  3PSE B;  4PYU A;  2W55 A;  3SFE B;  1D5M C;  2KTR A;  2BS4 B;  2PPH A;  1WX7 A;  2IUS A;  2LZ6 A;  3AE7 B;  1OFF A;  2AWT A;  1E8W A;  2JZ3 B;  4A90 A;  2KWD A;  3PO0 A;  1TIF A;  2DAJ A;  4WJN A;  3PZD A;  3ECI A;  1QZE A;  4N6E B;  1I4P A;  4YXD B;  3DBR I;  3ZXV A;  2MH7 A;  2N9P C;  1V97 A;  2LXA A;  3EA6 A;  1TTN A;  4B95 A;  2WU2 B;  3NHE B;  2IBI B;  2CU3 A;  4XDD A;  3I7N A;  1FNW A;  2KX0 A;  2MW5 A;  3AH7 A;  1IYF A;  3PLV A;  2CJN A;  4ZRI A;  2KLC A;  3KH0 A;  1KFY B;  1SEB D;  4WJO A;  1IBX B;  2JRH A;  3O65 B;  3A4S C;  4MH0 E;  1GUA B;  4C00 A;  2M0X A;  1TS2 A;  1WE7 A;  2XK5 A;  2LRU A;  2ZCB A;  3U2S C;  3AE6 B;  4QAY A;  3Q8E A;  1UWM A;  1SIJ A;  2ZNV B;  4RNA A;  4ARI A;  5FR3 A;  2GBJ A;  4XR1 A;  2V1Y A;  1SGH A;  4KSK C;  3T3O A;  4FN2 A;  1WJU A;  2LVP A;  2PE9 A;  1WJ4 A;  2PEA A;  5HFY A;  4BOZ B;  2JY6 A;  4US8 A;  1EU4 A;  2LHE A;  5GMV A;  4OVZ A;  3VR9 B;  4C4V A;  3V60 A;  2VRR B;  4IKG A;  2GLS A;  1WRD B;  2WXI A;  5HKH A;  3AV8 A;  5IO9 A;  2VZK B;  4AP4 C;  1FFU A;  4TQ1 A;  4MEM A;  3DBL I;  3BVM A;  3ZVV A;  3AE3 B;  3E9S A;  3VR8 B;  1GOZ A;  4NQK E;  4J6I A;  2WS3 B;  1N5W A;  1RRB A;  4YT0 B;  5DPT A;  3KLS X;  5IA7 A;  4D2K A;  2JU6 X;  4RMA A;  1HZ6 A;  1L0Y B;  5D7G A;  3HIZ A;  4NJ6 A;  2JUO A;  1NDD A;  2L00 B;  1HTO A;  4IOI E;  2DBY A;  5C1Z A;  3RNC C;  1T0Q C;  2G3Q B;  4OHJ A;  5JH5 C;  2N4F A;  4W9E A;  3V3X A;  3D32 A;  3VUX A;  4EE2 A;  3L17 A;  2KTR B;  3E56 A;  4JE3 B;  5AUI A;  1OEY A;  1QOB A;  3AEG B;  2ZZG A;  5HG2 A;  1CJE A;  4AS1 A;  3IG3 A;  4XZ4 A;  4KX6 B;  1KLG D;  4IM0 A;  2IGG A;  4YWG G;  4NY0 A;  4WWN A;  2XEW A;  1YMH E;  4FBJ B;  1N62 A;  1UGM A;  3CSF A;  1F77 A;  1GJZ A;  4JWS C;  2KD0 A;  5CHV C;  4IM2 A;  4HPL B;  4ITK A;  2WDQ B;  3VFK A;  2MCN B;  4L1B A;  5T8I A;  3GZN B;  5JHB A;  1SE3 A;  2LMC A;  2D10 A;  3TSS A;  2BYE A;  3ZW3 A;  1H4R A;  1FMA D;  3NS8 A;  2KVZ A;  2YLM A;  3I7P A;  3PHX B;  2O6V A;  1TYG B;  4URK A;  2XK5 B;  3LYY A;  2RMM A;  4YSZ B;  3N1Z C;  4JQW C;  2G9H D;  2D5G A;  4W9D A;  3DVG X;  2K39 A;  2QMT A;  3PRZ A;  1OGW A;  1UF0 A;  3R7R A;  2KWU B;  4TKN A;  1XLP A;  2D3B A;  2JWU A;  4ZYS A;  3ZDT A;  1YQ3 B;  4HDQ A;  3P1M A;  3UQB A;  4GIV A;  2RPQ A;  4DBG A;  5HI1 A;  2B3A A;  3BK2 A;  1JAL A;  4XWW A;  2PMV A;  2C5L C;  2X38 A;  5JXV A;  2H88 B;  2KJ6 A;  4C4V B;  2ZZE A;  2JYE A;  1WZ3 A;  3MHZ A;  1FNU A;  1AW7 A;  2GBM A;  2IGD A;  3E0C A;  4ZRQ A;  5C3J B;  4G3X B;  3Q3J A;  4ANV A;  1D5X C;  1SE4 A;  2GI9 A;  2KWC A;  4EZK A;  3P4S B;  1T0Y A;  4KIK A;  2W3S A;  1ZDV A;  4W9G A;  3T3N A;  1YJ1 A;  3HVD A;  4A8X C;  4USA A;  1CZP A;  2EWJ A;  3ZTY A;  1SE2 A;  2N7E A;  2ZOS A;  2L76 A;  4W9F A;  1XXG A;  1RFK A;  1WYW B;  2UYZ B;  3RMK C;  4GDK A;  4HJG E;  1L4Z B;  2QCZ A;  3P2B A;  1TBE A;  4YL8 A;  3HHM A;  2WQY B;  1ZOY B;  3OWE B;  2KQ4 X;  2NBV B;  4WWM A;  4ANX A;  3DVG Y;  3MP9 A;  3PZ7 A;  2QIE B;  4JGH B;  3FC4 A;  1EO6 A;  4DXF A;  2FAZ A;  5D3D A;  4FJV B;  1Y8R C;  3RHU A;  2DEN B;  3DWM A;  3C0R B;  2L0F A;  4KDI C;  5HHD G;  2DZI A;  2LJI A;  3VHT C;  5IN7 A;  1XEE A;  3BWU D;  2BF8 B;  2WGS A;  1N60 A;  4KGT A;  4ANW A;  3R7Q A;  2INP E;  4JIO U;  4AQ7 A;  3ZUP A;  3BII D;  3TUO A;  2LGI A;  3WCQ A;  3VH4 B;  3P4Q B;  2WP9 B;  3VTU A;  2IO0 B;  3U30 A;  3DDC B;  4C80 A;  3RNB C;  2JX5 A;  3AU5 A;  3B0A A;  2O6V B;  1WGR A;  4KV2 A;  3H7P A;  1MG8 A;  1Z2M A;  2LVO A;  2N7J A;  5D3I B;  1STE A;  1BXT A;  3RUI B;  1GNU A;  4K81 A;  4N9F 4;  1WGY A;  2WXJ A;  4W9I A;  2QEJ C;  4A08 A;  2WX0 A;  2RDB C;  1JRO A;  5BMI A;  4CQN A;  2V3P A;  1YN5 A;  1QOF A;  2AEH A;  3KQ4 A;  2CJO A;  2BS2 B;  1P7F A;  1QLB B;  1E5W A;  4YTM B;  2C9W B;  4WWP A;  4ZHO A;  1J7B A;  1FPY A;  4NJ7 A;  3MTN B;  3IT6 B;  3ML8 A;  2IPK D;  4F1S A;  2KJH B;  2K3U A;  2KWV B;  2KYW A;  2PKO A;  1F2R C;  4HEA 1;  4A3P A;  4G0N B;  3AI5 A;  1T3Q A;  3SEB A;  1E8X A;  4KIK B;  2KMM A;  3I9V 1;  5LLI A;  1WM2 A;  2LGD A;  1VZ8 A;  1R4N B;  2KC1 A;  4ARE A;  2BKF A;  1I35 A;  3AMZ A;  4G50 A;  4XR3 A;  3N32 A;  3WAM A;  2MP2 A;  2Y5B B;  3VDZ A;  2DYB A;  2C7M B;  1K50 A;  1JRP A;  1LO5 D;  4GDK B;  3MFG A;  5CX3 A;  1J8C A;  1WMH A;  1GC7 A;  3UIP B;  3B08 A;  3PTF C;  3LXF A;  1SE9 A;  2RDH A;  3VUW A;  2K8H A;  1YD8 U;  1PUT A;  3IBE A;  4I6P A;  1ZGU B;  1TT5 B;  1PGB A;  2JRI B;  3NZU A;  4F8C B;  3QAQ A;  1MG4 A;  4YSX B;  1OEY J;  1A70 A;  2KMA A;  3SU8 X;  1FXA A;  3ZTW A;  2LXC A;  4CI1 A;  3I89 A;  3OAW A;  2MX2 A;  3RNF C;  4XWT A;  4BKG A;  3ZO5 B;  5E6N A;  1C78 A;  5E6O A;  1XVI A;  1YX6 B;  2Y3U A;  2KAN A;  2WNM A;  3QK0 A;  4EZL A;  1ZP0 B;  4HRS A;  4YTP B;  3PVL A;  1E7P B;  4MH8 A;  3Q3O C;  2I1K A;  2KFJ A;  1DGJ A;  1S3S G;  5EE1 A;  3DVN V;  1I4Q A;  1SXT A;  3B2G A;  1TS5 A;  2C60 A;  5DPS A;  1S1Q B;  5AZF A;  1V1P A;  1BT0 A;  4W9K A;  4RF0 A;  2C7H A;  1PGX A;  4LDT B;  3MC9 A;  2GRI A;  5J18 A;  3QQ8 B;  2V0G A;  1K51 A;  1XLQ A;  4IUM B;  3W2D A;  3H7P B;  1UNS A;  4HPP A;  5G55 A;  3QX1 A;  2IND C;  4E54 A;  1IGC A;  1SSN A;  5H92 C;  4JL9 A;  3EI3 A;  1QT9 A;  3RFZ B;  3L10 B;  4X57 B;  3QA8 A;  2KAC A;  2ZVN A;  1TY2 A;  4LLG M;  1N63 A;  3RUL A;  1HA5 A;  4AR8 A;  4J3O D;  4HDO A;  2MSE D;  2DYM A;  3R3M A;  1ECR A;  1FEH A;  4S0R A;  4BVU C;  2FID A;  5D94 A;  5G5H A;  2MBB B;  1NEK B;  2BW2 A;  3DHG C;  4MGZ E;  2EKE C;  3N3K B;  2J0M A;  3WAP A;  3N30 A;  2D07 B;  3MC0 B;  2IYD B;  2L32 A;  1FM0 D;  3GP7 A;  3H6N A;  4BKS D;  3QC8 B;  3VXW A;  2NBU A;  1TZO A;  4JLC A;  3KWL A;  2L3Z A;  3TJP A;  3AN1 A;  4LK0 M;  2JXX A;  3GS2 A;  4O1N A;  4BBN C;  1X1M A;  2ZW0 A;  3WAL A;  3AE9 B;  4CHK A;  3L08 A;  1K52 A;  5CHW A;  1C9F A;  5FQD A;  3C19 A;  2G4D B;  1C1Y B;  3ZTC A;  5LXI B;  2INN E;  2BB5 A;  2E6X A;  2MP2 B;  3P63 A;  3V05 A;  2KQ7 A;  1I7H A;  2WDV B;  3WIM A;  3RNA C;  1WMH B;  1EU3 A;  4MM3 A;  4HJK A;  3A9K A;  3RNG C;  4PT5 A;  3CST A;  2WX1 A;  2XN9 C;  4KKI A;  1MHH E;  4WAF A;  1FO4 A;  3DBH I;  2WXN A;  3UIO B;  1NVI D;  1WR6 E;  3ML9 A;  3L54 A;  4ANU A;  3Q3F A;  3MJ5 A;  2REX A;  2WXP A;  4KKJ A;  2GOW A;  1FFV A;  2TSS A;  3LDZ E;  2L7R A;  3A4R A;  3KVF B;  2K25 A;  2W9N A;  2KO3 A;  4WIP A;  3ZNZ B;  2INC C;  4HKZ E;  2LJ5 A;  4HKQ A;  1I4X A;  1WI0 A;  4AJY B;  1TS3 A;  4PK1 A;  1EM7 A;  3I8C A;  2GBK A;  1U4A A;  2CHZ A;  2LGS A;  2KC2 A;  2BGF A;  3TIX A;  3RPF C;  1R4M I;  3HRD D;  1WRI A;  2KXJ A;  4M00 A;  1N61 A;  1VDV A;  3EFU A;  4GXB A;  4EFO A;  4FA6 A;  2K6D B;  1JWU D;  1V1P B;  2KFK A;  1MPE A;  4OZC A;  2BT6 A;  3LJ3 A;  4A11 A;  4MJS A;  3H9D A;  5D2M B;  1P3Q U;  1ROE A;  1WY8 A;  4OW0 A;  2FBW B;  2J7Q B;  3AB5 A;  1WXM A;  4ARC A;  1RFA A;  3A33 B;  2WXO A;  3P4P B;  2KDF B;  3NS1 A;  3OJ3 A;  4FJY A;  3SDL C;  3EFC A;  3NZS A;  5JHA A;  1PDX A;  1IUE A;  4ICU A;  2QIL A;  2G4S A;  4RGN A;  4EEW A;  4W9L A;  2K6Q A;  4IDI A;  1WWT A;  1J7C A;  2ZCC A;  3TEZ A;  2N1V A;  5KHO A;  3RT3 B;  1ZXI A;  4B9K A;  3LB8 C;  1JWB D;  5G2N A;  4WJP A;  3PS6 A;  3ZYY X;  2HJ8 A;  4ZHP A;  3I57 A;  2JZZ A;  1WJ6 A;  3VQI A;  3VAW A;  2KVR A;  4TSS A;  3AEA B;  4US9 A;  3N9Y C;  1C77 A;  3DQV A;  2QC8 A;  3CF6 E;  3M62 B;  4GDL A;  3L4P A;  3DOW A;  1VRA B;  4M8N A;  4WQM A;  2KN4 A;  1V5O A;  3ZRC A;  2ZZP B;  1C76 A;  4NAM A;  2BS3 B;  1MHX A;  1R7S A;  4MM3 B;  5I4D A;  3A9K B;  4IW0 A;  4RGM A;  2PE6 B;  1I4H A;  1TS4 A;  3APD A;  1EUV B;  2MHJ A;  3R66 C;  2DNF A;  2LGX A;  4MGK E;  1UBI A;  4DHZ E;  3T9L A;  4B0M A;  2W3R A;  1WR1 A;  1QKZ A;  3UF8 A;  4TZ4 A;  1SJH D;  2BQQ A;  4BAX A;  1YJI A;  1ENF A;  2B76 B;  1DOI A;  1JWS D;  2I2Y A;  2OJW A;  4ZRJ A;  1QF6 A;  2EEL A;  3ZX5 A;  1P7E A;  1KJT A;  3HVZ A;  4RGO S;  1L4D B;  1P98 A;  3TBL D;  2M0A A;  4P1C C;  4A3O A;  2CS4 A;  1SJE D;  4HCN B;  2UU7 A;  1M4V A;  2FCQ A;  4W9C A;  3TEW A;  1RWS A;  2KFK B;  4PS3 A;  1F9J A;  3GB1 A;  3NZ3 A;  4MJS B;  2KK8 A;  4XE0 A;  3AM9 A;  4HXD A;  2HJ1 A;  2IUU A;  2KJR A;  5IKC M;  4CI2 A;  4XDC A;  2KOX A;  3AEF B;  4M0W A;  1UZX B;  5BMG A;  4MEL A;  2OED A;  1KLV A;  2Y5C A;  4G11 A;  1HEZ E;  4OZB A;  3CMM B;  2Z0E B;  4GGQ A;  3RNE C;  2V4L A;  1WSP A;  1LFD A;  1DOY A;  4R3D A;  3EHV A;  3KUZ A;  3FKY A;  2NBW B;  1AYF A;  2MWS B;  5AZH A;  4GU2 A;  4RM9 A;  1RLF A;  4GN1 A;  4ASW C;  1L6V A;  1GB4 A;  1F0Z A;  4K7S A;  1WIA A;  1YQ4 B;  3ZIM A;  5J17 A;  1J0G A;  4M02 A;  2WHI A;  1OTR B;  3ALB A;  4TMA B;  2H89 B;  1MJD A;  2NMQ A;  4HVB A;  4GDL B;  2J52 A;  4RM8 A;  2YEP B;  1WM3 A;  2K1F A;  2LI5 A;  3OLM D;  3QAR A;  1K53 A;  1HQR D;  3AUL A;  2UWQ A;  4FLH A;  2WLB A;  4DXA B;  5D6J B;  3ENE A;  2A5U A;  4FHJ A;  3W1S A;  3L0W B;  3RD2 A;  4C56 C;  2BB6 A;  1Q0W B;  3SD5 A;  2M4N A;  1MFW A;  2C7N B;  2WXF A;  1TY0 A;  1B1Z A;  1SF0 A;  5GXG B;  2MBO A;  1L5P A;  3NVZ A;  2DZJ A;  2J53 A;  3DPD A;  4BKT A;  4EKU A;  4RFB A;  3P42 A;  1J19 A;  3Q3M C;  3W5U B;  2JT4 B;  3ZUN A;  4LNO A;  1D4B A;  3PRM B;  2KDB A;  3DBS A;  3I5J C;  1YNT E;  3AXC A;  4NZL B;  2EMS A;  1GG3 A;  1UH6 A;  2HDE A;  3V6C B;  3I7H A;  4E74 A;  2FCM A;  1PGA A;  2L05 A;  3KW5 B;  3TEX A;  3CWI A;  3NG0 A;  4M0W B;  4GMV A;  1YN3 A;  3ZXR A;  3N1Y C;  2D3C A;  3NVV A;  3DBH B;  2RGF A;  1JW9 D;  2BKR B;  3ZDM C;  1FRD A;  1QOA A;  2L83 A;  3DBR B;  4AR9 A;  2X8X X;  4W9H A;  2WU5 B;  3H1U A;  4PS8 A;  2L1A A;  4TUU A;  1XD3 B;  4A09 A;  1XQQ A;  3L16 A;  1AWD A;  1B9R A;  4P1B C;  3X23 A;  4LCD E;  2RSU A;  5DPR A;  5FR6 A;  4GOC A;  4EOY A;  3U7Z A;  3ZNI D;  1R4M B;  1TKG A;  1UD7 A;  3IAM 1;  2AL6 A;  5TR5 A;  2N7D A;  3PRP B;  1HXY D;  4MDK E;  2QHO A;  3ZJV A;  2FUH B;  2IDY A;  3EI1 A;  3BZD B;  3BVG A;  3ZGZ A;  1OQR A;  2Z8L A;  1HZ5 A;  1NI2 A;  4HRO A;  5DCN A;  1NYQ A;  1EWC A;  3ZU6 A;  2M8S A;  3DHH C;  4MGY E;  3A9J A;  1KM7 A;  1XO3 A;  1MVK A;  3NVW A;  2VZK D;  1V80 A;  3H7S A;  1YIW A;  2WXL A;  2KMC A;  1KF6 B;  1XF5 L;  2LRW A;  1WZC A;  4I6N B;  5TSS A;  1XLO A;  2MJ3 A;  3DBL B;  3FIL A;  3DVN U;  2BPS A;  1V1O A;  3RCZ A;  2WXK A;  2WXG A;  4LNF A;  3Q8F A;  2DHZ A;  2RPV A;  4JWU C;  1UBQ A;  3I7O A;  1WXA A;  1MI0 A;  2KDM A;  3ABV B;  4ZYN A;  1UWX A;  3ZKJ C;  4DK5 A;  2XNA C;  1V9J A;  2JZP A;  2N1W A;  3URY A;  1LM8 B;  4E5Z A;  2IUT A;  3WAO A;  5AUK A;  1LQB A;  3U52 E;  1JQ4 A;  2I05 A;  2SAK A;  4BOS C;  2A4Z A;  1CQV A;  3PHW B;  4LTU A;  2WDR B;  4GB9 A;  1WGK A;  2L52 A;  3NUH B;  4W9J A;  2BYV E;  4LNK A;  5IOI A;  2EKI A;  2AX5 A;  2CU1 A;  1JML A;  2JWZ A;  4L23 A;  3R8B A;  2HE7 A;  2V9H A;  1TKE A;  4IWO A;  3KUD B;  3RFN A;  2WYQ A;  3RZW C;  4A0A A;  3JSV A;  1I42 A;  2KHW B;  2Y3A A;  4DDG D;  4CI3 A;  3Q8C A;  1RAX A;  3FAH A;  4XR2 A;  3V61 A;  3ZLZ A;  1E6E B;  2RD0 A;  3IT4 B;  1IPG A;  2MBQ A;  3CIR B;  1WJN A;  2N9X A;  2B5L A;  4KSL C;  2IY0 B;  5BMH A;  4DHJ D;  2PVG C;  1E90 A;  1E0Z A;  4S17 A;  5EE3 A;  3S2A A;  4N58 A;  4DHZ B;  3W1Y A;  3APF A;  1V8C A;  5H8Y E;  1HE8 A;  1WF9 A;  1WZ0 A;  4M8M A;  4KGR A;  3T8M A;  4KZ0 A;  1T5X D;  3K9O B;  4HCP B;  5IP4 D;  2DZM A;  1V81 A;  2J4X A;  2Y5P A;  1GB1 A;  1XCQ L;  2MJD A;  2ZW1 A;  2Z59 B;  1KRH A;  1H8C A;  2LUE A;  5BO4 B;  2J0K A;  5AZG A;  3EI2 A;  4WJQ A;  2O2V A;  3AE8 B;  4BFR A;  2IZV B;  4BBN F;  3BY4 B;  4K7U A;  3A9J B;  1P9D U;  3AE5 B;  1ZW7 A;  2WXH A;  3KUC B;  1L6U A;  1JWM D;  4IWP A;  5CTR C;  4YSY B;  2MJE A;  1TZ1 A;  2VH1 A;  4MT5 A;  3AE1 B;  4HLE A;  3Q8A A;  1V4P A;  3KYC D;  1KLU D;  4DXG A;  1T0S C;  3B1L X;  1DYQ A;  2M56 B;  3FIL B;  3GE8 C;  2E3T A;  4FXC A;  3PT2 B;  1YX5 B;  2FE8 A;  1C4C A;  5AEK B;  3AEE B;  4HWI B;  5EE0 A;  4AR1 A;  2AQ2 B;  1WXO A;  3UGB B;  1E9M A;  4BKS A;  4DDI D;  3EUB 2;  3KYD D;  1R4N I;  4KVG B;  3ZWD A;  3W5V B;  2N9K A;  3WQZ A;  3Q2A C;  2NTT A;  1ZDX A;  4PS7 A;  2JXT A;  1NI3 A;  3I3T B;  3BYT B;  1YN4 A;  2AQ3 B;  2NCN A;  4NJC A;  4IG7 B;  1C79 A;  2PVO D;  3NRZ A;  2QJL A;  4A0B A;  1WNU A;  3Q8B A;  4JX1 C;  3VH3 B;  1F52 A;  1N6Z A;  4DQO C;  2D11 A;  5FKA C;  3QJZ A;  5FK9 C;  4NNJ B;  5BYS A;  2ONQ A;  2HD5 B;  1L0V B;  4XYC A;  4K1R B;  2WXQ A;  1Q1O A;  1V49 A;  4CYE A;  2ZPY A;  2ZVO A;  3JSV B;  3MC8 A;  3SR6 A;  1PYW D;  3HM3 A;  3V6E B;  2SEB D;  2HTH A;  3UI3 A;  1G6J A;  2NVU I;  2MA9 B;  3ZTD A;  2RDG A;  2O6V D;  4XGA B;  2OHF A;  1Z5S B;  2AL3 A;  1VZ6 A;  2ON8 A;  2OJR A;  1ZPS A;  3ZJU A;  1Q5W B;  3Q69 A;  5L83 A;  1V7O A;  4I6L B;  1L0X B;  1YJJ A;  3QCA A;  1ZKH A;  2IO1 B;  4TV3 A;  1ZUD 2;  4AUQ C;  4LNI A;  1C4A A;  1TKY A;  3ZNG C;  5BYR A;  1WXQ A;  1IP9 A;  2YEP F;  2JVC A;  4Q2J A;  2K9X A;  3NOB A;  1WX9 A;  1KOT A;  2GMI C;  4NAW A;  3QIJ A;  3TCA A;  2O2V B;  5LXH A;  4FUL A;  4A9A A;  3A1Q A;  4L2Y A;  2B5M A;  1WH3 A;  1P0R A;  1D3Z A;  1SBB B;  4N59 A;  1T0R C;  4II3 B;  3SHQ A;  4C7Y A;  1YOV B;  2KDI A;  1UEL A;  2EMT A;  2HYE A;  1ZE3 D;  1ET6 A;  2FIF A;  2FUG 1;  2L0T A;  3JYU A;  1FIQ A;  3PGE A;  4GSW A;  4B6W A;  1NEN B;  4XR0 A;  1L7Y A;  1F1H A;  3UIN B;  3H8H A;  1SB3 C;  1VR9 A;  3U7D A;  2LD9 A;  4YTN B;  3NY5 A;  2KN5 A;  3WAN A; 
#chains in the Genus database with same CATH homology
 1JCK B;  1TS2 A;  2HDE A;  1PGX A;  3I7H A;  2GRI A;  1FCC C;  1K51 A;  1XLQ A;  2V0G A;  3W2D A;  1UGJ A;  1UNS A;  3U2S C;  3AE6 B;  1PGA A;  4E54 A;  3Q8E A;  1IGC A;  1NYR A;  3TEX A;  1SSN A;  1UWM A;  2LHD A;  1FNV A;  1SIJ A;  3CWI A;  4RNA A;  5H92 C;  1F2R I;  3BK1 A;  3EI3 A;  1QT9 A;  4ARI A;  3RFZ B;  5FR3 A;  1YN3 A;  4XR1 A;  1DOX A;  3T3O A;  2KAC A;  3NVV A;  1JW9 D;  1FRD A;  1TY2 A;  4LLG M;  1N63 A;  1QOA A;  4P6V F;  1HA5 A;  2L83 A;  4AR8 A;  4AR9 A;  4J3O D;  3C8Y A;  5HFY A;  1T6B X;  4US8 A;  2DYM A;  2WU5 B;  1EU4 A;  2LHE A;  1ECR A;  4OVZ A;  1FEH A;  5G5H A;  2L1A A;  2LEK A;  1NEK B;  3VR9 B;  2BW2 A;  2K22 A;  1BML C;  1ACC A;  2LFI A;  3HUI A;  1BUI C;  4A09 A;  1CK1 A;  4A55 A;  1XLN A;  4IKG A;  1AWD A;  3MC0 B;  2L32 A;  1FM0 D;  1B9R A;  2WXI A;  3AV8 A;  3GP7 A;  2IGH A;  2VZK B;  1TZO A;  3KWL A;  1FFU A;  4TQ1 A;  3AN1 A;  4LK0 M;  3GS2 A;  4O1N A;  3U7Z A;  1TKG A;  3BVM A;  3IAM 1;  2ZW0 A;  3AE3 B;  3AE9 B;  3E9S A;  3VR8 B;  1GOZ A;  1HXY D;  1K52 A;  3ZJV A;  4RH6 A;  2WS3 B;  1N5W A;  4YT0 B;  1C9F A;  2IDY A;  5FQD A;  3KLS X;  1C4P A;  2JU6 X;  4D2K A;  1HZ6 A;  1L0Y B;  3EI1 A;  2INN E;  2BB5 A;  2E6X A;  3P63 A;  4WUR A;  5D7G A;  3V05 A;  2BTE A;  1OQQ A;  3BZD B;  3BVG A;  3KWV A;  5EE9 A;  2W54 A;  3O13 A;  1I7H A;  4IOI E;  3J9C A;  2DBY A;  2WDV B;  3EI4 A;  4OHJ A;  1EU3 A;  2Y6I A;  1D5Z C;  3ZGZ A;  1OQR A;  4RGT A;  3V3X A;  2Z8L A;  4EE2 A;  1HZ5 A;  4PT5 A;  2K0P A;  3E56 A;  2XN9 C;  2PIA A;  4JE3 B;  2ZZF A;  4HRO A;  4KKI A;  1NYQ A;  1EWC A;  4NAW B;  5AUI A;  1MHH E;  1QOB A;  3AEG B;  2ZZG A;  4WAF A;  1FO4 A;  2ICI A;  1KTK A;  5HG2 A;  2WXN A;  3I7K A;  3R2T A;  1CJE A;  1NVI D;  1XO3 A;  1MVK A;  4KGS A;  4AS1 A;  2PTL A;  3MJ5 A;  3IAS 1;  3NVW A;  4ZOH C;  2QSD A;  4KX6 B;  3W9C B;  1UUP A;  1KLG D;  2VZK D;  2WXP A;  4KKJ A;  2IGG A;  2WXL A;  5MPO A;  4YWG G;  3B2F A;  3AED B;  2JYT A;  1FFV A;  3ZQ4 A;  2TSS A;  1KF6 B;  1XF5 L;  1FCL A;  1YMH E;  1N62 A;  4WIP A;  2W82 A;  1F77 A;  4HKZ E;  4JWS C;  4HKQ A;  5TSS A;  1I4X A;  1TS3 A;  1XLO A;  2MJ3 A;  3B9J A;  4C7Z A;  1EM7 A;  3I8C A;  3FIL A;  1V1O A;  4ITK A;  2IJ0 A;  2WDQ B;  1I4G A;  2M19 A;  4RF1 A;  2J42 A;  2WXK A;  2WXG A;  1ESF A;  4MAC A;  4L1B A;  1VJK A;  3RPF C;  3Q8F A;  2RPV A;  4JWU C;  5T8I A;  1SE3 A;  2LMC A;  3HRD D;  3TSS A;  1WRI A;  3KEW A;  1N61 A;  1VDV A;  4REZ A;  3I7O A;  1MI0 A;  2KDM A;  1JWU D;  1V1P B;  3ABV B;  1FMA D;  1MPE A;  1UWX A;  4OZC A;  3I7P A;  2XNA C;  2BT6 A;  2BYT A;  3AEB B;  4A11 A;  2JZP A;  3BYY B;  1TYG B;  3URY A;  1FXI A;  3LYY A;  2RMM A;  4E5Z A;  1ROE A;  4YSZ B;  1QOG A;  4OW0 A;  2V3N A;  2IUT A;  1Q10 A;  2FBW B;  2D5G A;  2G9H D;  5AUK A;  3AB5 A;  1JWA D;  3U52 E;  4ARC A;  2QMT A;  1JQ4 A;  2I05 A;  2SAK A;  2WXO A;  3P4P B;  4B0E A;  3NS1 A;  1CQV A;  2R61 A;  2KAJ A;  4LTU A;  2WDR B;  1XLP A;  1WGK A;  2L52 A;  3NUH B;  1PFD A;  1PDX A;  1IUE A;  2QIL A;  2EKI A;  2AX5 A;  4RGN A;  2JWU A;  4ZYS A;  1JML A;  1TJE A;  4L23 A;  5BYQ A;  1YQ3 B;  3R8B A;  4JPS A;  3P1M A;  4IDI A;  1TKE A;  1WWT A;  1J7C A;  3TEZ A;  3RFN A;  4A0A A;  5HI1 A;  3BK2 A;  1JAL A;  4XWW A;  2PMV A;  3I8E A;  2Y3A A;  2X38 A;  3BVZ A;  5JXV A;  2H88 B;  2JQR B;  2ZZE A;  2JYE A;  3MHZ A;  3Q8C A;  1ZXI A;  1FNU A;  3FAH A;  5E6J A;  4XR2 A;  4CI3 A;  1AW7 A;  3LB8 C;  2IGD A;  1E6E B;  3E0C A;  4ZRQ A;  3IT4 B;  1JWB D;  5C3J B;  2MEK A;  3AE2 B;  3CIR B;  1D5X C;  1SE4 A;  2GI9 A;  3ZYY X;  4ZHP A;  3I57 A;  2B5L A;  2V4I B;  2K5P A;  5BMH A;  3P4S B;  2PVG C;  3VQI A;  1E0Z A;  2W3S A;  4TSS A;  1ZDV A;  3AEA B;  5EE3 A;  4N58 A;  4US9 A;  3T3N A;  1FRR A;  3N9Y C;  3HVD A;  3AE4 B;  1C77 A;  4A8X C;  1V8C A;  2WXM A;  4ZRP A;  4USA A;  5H8Y E;  1CZP A;  3ZJT A;  2EWJ A;  1SE2 A;  4KGR A;  1AN8 A;  1T5X D;  2GB1 A;  2WXR A;  3L4P A;  1IGD A;  2J4X A;  2PLP A;  2Y5P A;  5LNK 1;  1XCQ L;  1XXG A;  1GB1 A;  1ZXH A;  2MJD A;  1VRA B;  4OZA A;  1RFK A;  2ZW1 A;  4WQM A;  2KN4 A;  3PZ8 A;  4P16 A;  5C2T B;  2G1E A;  1KRH A;  4HJG E;  1L4Z B;  4TQ0 A;  4ARF A;  1VZ7 A;  1C76 A;  4NAM A;  2BBC A;  2BS3 B;  1N5X A;  1MHX A;  1R7S A;  4MM3 B;  1VLB A;  2WQY B;  5I4D A;  1ZOY B;  3OWE B;  4RGM A;  3VRB B;  2KQ4 X;  3EI2 A;  4WWM A;  1I4H A;  1ET9 A;  1Y56 A;  1TS4 A;  3MP9 A;  3PZ7 A;  2QIE B;  3AE8 B;  5G5G A;  3FC4 A;  4DXF A;  1KH0 A;  5D3D A;  2W3R A;  4B0M A;  1E10 A;  3AE5 B;  3R2I A;  1QKZ A;  4TZ4 A;  1SJH D;  3RHU A;  2WXH A;  1L6U A;  1JWM D;  2N0S B;  2N9L A;  1YJI A;  3DWM A;  3NVY A;  1ENF A;  2B76 B;  4YSY B;  1DOI A;  2E1B A;  2MJE A;  5HHD G;  1JWS D;  2LJI A;  4MT5 A;  3AE1 B;  3Q8A A;  3SFD B;  1V4P A;  2I2Y A;  4YTN B;  1KLU D;  1XEE A;  3BWU D;  4DXG A;  1GPX A;  1QF6 A;  1N60 A;  4KGT A;  2EEL A;  1DYQ A;  2INP E;  1P7E A;  3HVZ A;  4RGO S;  2LUM A;  1L4D B;  2M56 B;  2E3T A;  3FIL B;  4AQ7 A;  2M0A A;  2DLB A;  4FXC A;  3BII D;  1FD6 A;  1XCT L;  2FE8 A;  1SJE D;  1GAQ B;  1M4V A;  2LGI A;  3TUO A;  3WCQ A;  1C4C A;  3AEE B;  2WP9 B;  3P4Q B;  5EE0 A;  1J7A A;  3P4R B;  4AR1 A;  2AQ2 B;  3AEC B;  1IBX A;  1WXO A;  3TEW A;  1E9M A;  4H2A A;  1RWS A;  4C80 A;  1RM6 C;  2JX5 A;  3EUB 2;  3GB1 A;  3NZ3 A;  2DYO A;  3U4E G;  2DWQ A;  4XE0 A;  3W5V B;  2N9K A;  1RYJ A;  3WQZ A;  2NTT A;  3AM9 A;  1ZDX A;  2I38 A;  2IUU A;  2N7J A;  2JXT A;  1NI3 A;  3BYT B;  5D3I B;  4CI2 A;  1STE A;  4XDC A;  1BXT A;  1YN4 A;  2AQ3 B;  3IXS A;  3AEF B;  1C79 A;  3DWG C;  2PVO D;  3NRZ A;  2QJL A;  4M0W A;  4NJC A;  5BMG A;  3I7L A;  4A0B A;  2OED A;  2WXJ A;  1WNU A;  3Q8B A;  2Y5C A;  2QEJ C;  4A08 A;  4JX1 C;  1HEZ E;  4OZB A;  1JRO A;  4DQO C;  5FKA C;  5BMI A;  4CQN A;  1QIL A;  2V3P A;  1YN5 A;  5FK9 C;  4GLS C;  5BYS A;  2ONQ A;  1QOF A;  2PW9 A;  1WSP A;  1L0V B;  3KQ4 A;  2CJO A;  2BS2 B;  4RCO A;  1P7F A;  2NTS A;  1DOY A;  2WXQ A;  1QLB B;  4R3D A;  2ZTG A;  4YTM B;  3EGR A;  4ZHO A;  1J7B A;  1AYF A;  3SR6 A;  3IT6 B;  1PYW D;  2IPK D;  2SEB D;  2JSV X;  2K3U A;  2PKO A;  3UI3 A;  3VRA B;  2I06 A;  1QQR A;  1L6V A;  1WYG A;  1F2R C;  4HEA 1;  1GB4 A;  2RDG A;  1EWY C;  1F0Z A;  1T3Q A;  3ETR A;  2Y50 A;  1YQ4 B;  2OHF A;  3SEB A;  4WH4 A;  1VZ6 A;  2KMM A;  3I9V 1;  1VZ8 A;  2ON8 A;  1ZPS A;  2ACZ B;  3ZJU A;  2Q5W D;  3Q69 A;  4TMA B;  1V7O A;  4ARE A;  2H89 B;  3AMZ A;  1L0X B;  1YJJ A;  2NMQ A;  4XR3 A;  2HTM E;  4GDL B;  2J52 A;  1ZUD 2;  4A6Q A;  1I4R A;  2YEP B;  4UDU C;  1C4A A;  1TKY A;  1K50 A;  3TEY A;  1JRP A;  1LO5 D;  4GDK B;  5BYR A;  2AQ1 B;  3MFG A;  1D6E C;  1K53 A;  1WXQ A;  1HQR D;  2W55 A;  2YEP F;  4Q2J A;  2K9X A;  1D5M C;  3LXF A;  2RDH A;  2WLB A;  3SFE B;  2BS4 B;  2IUS A;  1PUT A;  3AE7 B;  1OFF A;  1PGB A;  4A90 A;  3W1S A;  2KWD A;  3PO0 A;  4A9A A;  4L2Y A;  2B5M A;  4YSX B;  1A70 A;  4C56 C;  1FXA A;  2BB6 A;  1SBB B;  4CI1 A;  4N6E B;  3I89 A;  1I4P A;  4N59 A;  4YXD B;  4XWT A;  2WXF A;  2MH7 A;  4C7Y A;  1V97 A;  1TY0 A;  3EA6 A;  1B1Z A;  1C78 A;  1SF0 A;  5GXG B;  1L5P A;  3NVZ A;  2J53 A;  2Y3U A;  2HYE A;  1ZE3 D;  1ET6 A;  4RFB A;  2WNM A;  3P42 A;  2FUG 1;  2WU2 B;  3W5U B;  1FIQ A;  2CU3 A;  4XDD A;  1D4B A;  3I7N A;  1FNW A;  1ZP0 B;  4HRS A;  4YTP B;  1NEN B;  4XR0 A;  3AH7 A;  1E7P B;  4MH8 A;  2CJN A;  1DGJ A;  3H8H A;  5EE1 A;  1I4Q A;  1KFY B;  1SEB D;  1SB3 C;  1SXT A;  1TS5 A;  3B2G A;  1VR9 A;  1IBX B;  1V1P A;  1YNT E;  4NZL B;  4RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...