1TKGA

Crystal structure of the editing domain of threonyl-trna synthetase complexed with an analog of seryladenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Threonyl-tRNA synthetase
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tkgA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tkgA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tkgA02
2BS2B 5AUIA 1SB3C 1VDVA 3NVZA 4WQMA 4YTPB 3LXFA 4YSZB 3KEWA 4A9AA 1WXQA 1NI3A 2OHFA 2DWQA 3VRBB 1RWSA 3AEEB 1JQ4A 3W5UB 3HUIA 1F0ZA 1FXAA 4US8A 1NVID 3WQZA 2ZZGA 3AEAB 4N58A 5EE3A 2L52A 4P6VF 1FO4A 5EE9A 3AECB 1ZXIA 3AE3B 2K5PA 1JWAD 1E9MA 1PFDA 2N0SB 4HROA 2E3TA 1QOAA 2Q5WD 1FFUA 3P4PB 2ZZEA 3AN1A 3NRZA 4IDIA 1ZP0B 3VRAB 1IUEA 2CU3A 2BT6A 3PO0A 3LB8C 3AE6B 1VJKA 2PVGC 3B2FA 2PIAA 4YT0B 4JX1C 4KX6B 2ZTGA 2CJNA 3AE2B 3AM9A 5G5HA 5C2TB 3AEGB 1QOFA 1KF6B 1FFVA 2W3RA 2PVOD 1PDXA 1OFFA 1JW9D 1KRHA 1N62A 2H89B 1QOGA 4ZOHC 1E6EB 1NYRA 2AX5A 2WDQB 1QF6A 4YTNB 1CZPA 1KFYB 4C80A 2JX5A 2ACZB 2JQRB 3AEDB 1DOIA 5H92C 1V4PA 1E7PB 3P1MA 3FC4A 3P4SB 2H88B 1WXOA 2G1EA 3B9JA 2W3SA 3NVVA 3W5VB 4WWMA 1JALA 3EUB2 5MPOA 1NYQA 1QOBA 1DGJA 1A70A 3AE1B 2ZZFA 2MH7A 4ZHPA 2WS3B 4USAA 5GXGB 1FRDA 4N59A 1QLBB 1N5WA 5G5GA 1B9RA 3DWGC 1AWDA 3P63A 2W54A 1XLPA 2WU2B 3NS1A 2PKOA 4YSXB 4YTMB 2M19A 2EKIA 1DOYA 2BS3B 3AE4B 1GAQB 3AEFB 3P4QB 1DOXA 4JWUC 5AUKA 1L6UA 1WYGA 2QJLA 1SF0A 1YQ4B 2MJDA 1V97A 1XLNA 1I7HA 1PUTA 3ZYYX 1GPXA 2QIEB 4ITKA 1TKYA 3FAHA 1TKGA 2WQYB 3AV8A 4YSYB 2HTME 3RPFC 1AYFA 1FRRA 4ZHOA 3RFNA 3AEBB 3VR9B 1E10A 3SR6A 1L0VB 1N60A 1UWMA 1VLBA 3NVWA 1EWYC 3BIID 1XO3A 2Y5CA 2K9XA 2WLBA 3HRDD 1FXIA 3ETRA 2LEKA 1N63A 1RM6C 2KAJA 1ZUD2 1QT9A 1JROA 1TYGB 1TJEA 2MJ3A 1NEKB 3AMZA 3AH7A 3HVZA 3VR8B 1RFKA 5EE1A 1J7CA 3RHUA 2FBWB 1WNUA 3P4RB 1T3QA 1WRIA 4FXCA 5EE0A 3AE7B 2M56B 3DWMA 1N5XA 3CIRB 1NENB 3AE8B 2BS4B 1L6VA 1YQ3B 1OQRA 2WDRB 3WCQA 2W55A 1N61A 1XLOA 3L4PA 1YJJA 3B2GA 2CJOA 1SIJA 3W9CB 4C7ZA 1FMAD 1RYJA 1TKEA 1OQQA 2DBYA 2KMMA 4YXDB 1YJIA 3AE5B 1JRPA 1V7OA 2L83A 4HRSA 4LTUA 1CJEA 3NVYA 3AB5A 1J7BA 3SFDB 1L5PA 3ABVB 4JWSC 4N6EB 4C7YA 5C3JB 1JWBD 1ZOYB 2WDVB 3SFEB 1FIQA 1XLQA 2K22A 2WP9B 4US9A 3AE9B 2E1BA 5H8YE 1E0ZA 1J7AA 3KWLA 1FM0D 1WGKA 1WWTA 1V8CA 2WU5B 3CWIA 2MJEA 1ROEA 2B76B 1R7SA
chains in the Genus database with same CATH superfamily
1UELA 2D3CA 2YEPF 5L83A 5JHAA 1I4GA 4TQ0A 1YJ1A 1SBBB 5G55A 4N58A 1Y8RC 1I42A 1M94A 1WE6A 4PS8A 2GBKA 2WXMA 1IUEA 3JVZX 3VUWA 3I57A 2BB6A 2N9LA 4WIPA 3AE6B 1C3TA 3ALBA 2HDEA 2LVOA 4AS1A 2KACA 1P9DU 1WR6E 2O6VD 3KUCB 4YTNB 1OEYA 1D6EC 3Q14C 3SEBA 4FLHA 4RM8A 3P1MA 1V4PA 4A08A 1YX6B 2QEJC 2NBUA 4A0BA 4XWTA 1H4RA 1EU3A 5G5GA 1X1MA 3NJTA 4EFOA 4BKTA 4IOIE 3ZNHB 2FCQA 2KLCA 3V62A 2RD0A 3L0WB 2KDEB 2XK5A 2OEDA 3DOWA 5DPSA 1TKYA 3RNEC 1FRRA 3T9LA 1IBXA 2GLSA 2KC1A 2IUTA 3QX1A 2J7QB 4M0WA 2QHOA 4BOSC 2V4LA 2INNE 3UGBB 3EI2A 3ZQ4A 1TJEA 3VR8B 5HG2A 2M0AA 2FBWB 3QARA 1N5XA 2DENB 1YQ3B 2UU7A 3I7HA 2KK8A 1TZOA 1RYJA 3BZDB 4IWPA 2IGHA 3L13A 4A3PA 4DBGA 2D5GA 4MT5A 2PJHA 4CYEA 2I1JA 3ZTDA 1XLQA 5BMHA 3TIXA 4US9A 3DBHB 3PRPB 2D10A 1PGAA 2LJIA 1UD7A 1FD6A 4A9AA 1TGZB 1P7FA 4HEA1 4OZBA 1JQ4A 3W5UB 4XGAB 3ZW7A 3WQZA 3VUYA 3P2BA 4P6VF 1F2RC 2LASA 3AE3B 4I6LB 1WXAA 1IGDA 1C4CA 2LGDA 3AN1A 4NQKE 2D3AA 3A33B 2GB1A 1YQBA 2O6VB 1GNUA 3IFWB 5LXIB 4CI3A 4WJPA 1M4VA 3AE2B 3EFCA 2AEHA 3SDLC 2LXCA 1ACCA 1JW9D 2H89B 5E6OA 1KH0A 2CS4A 1CZPA 2JQRB 5C23A 1P0RA 2XK5B 3P4SB 2NR2A 2K0PA 1YNTE 4WWMA 5MPOA 1V80A 4REZA 3Q3OC 4K7SA 5FR6A 4A8XC 2ZZFA 4XR0A 3EC8A 4GDLA 4M0WB 1MG8A 2PKOA 2GBMA 1E90A 1T0RC 4MEMA 2DYMA 4HVBA 1WXSA 4FJYA 4YSYB 2I1KA 2FCNA 1OEYJ 4A09A 2QC8A 4S0RA 3TCAA 4WQOB 3ZTCA 4I6PA 1EWCA 1N63A 1WM2A 1SE4A 2BW2A 3AH7A 4UDUC 2Y5BB 3MHSD 4IW0A 3BVGA 2BYFA 2KTRA 2K8HA 2WX0A 1SIJA 1E8ZA 1ESFA 2DBYA 2IO1B 3W9CB 5JH5C 4XWWA 2DZJA 4HRSA 4WH4A 3U7ZA 3L16A 2K22A 4G11A 5CTRC 3CWIA 3PS6A 1XEEA 2B3AA 2KMAA 1GC6A 2KN4A 2LUMA 1NI3A 2N9KA 1WZ3A 2GBRA 1ENFA 1F0ZA 4US8A 5HHDG 4A3OA 4OZCA 2EWJA 2BYEA 1ZXIA 3AECB 4HROA 4MM3B 2INPE 4ZYNA 4OVVA 3W1YA 4FBJB 4AP4C 2X8XX 2MP2B 2FNJB 4AREA 3N32A 4GDLB 1WMHB 2ZEQA 2G45B 1L7YA 1YX5B 4K1RB 2J52A 4A11A 5CHVC 3X23A 3TEYA 4CO7A 4C80A 2GMIC 2H88B 4IWOA 1JALA 3TSSA 2C60A 3A9KA 1WY8A 2CHZA 3ZLZA 3RUIB 1E8WA 2W54A 3EGRA 3N1ZC 3X0WA 2BTEA 1CMXB 1L6UA 1C4AA 2A5UA 1LFDA 1VD2A 2KT7A 2QDFA 1P98A 3IXSA 4B0MA 1AYFA 3QHTA 3Q8BA 3E9SA 3VH4B 4ZRIA 2NPTA 2SAKA 2L8JA 3HRDD 2WXRA 2KDIA 1YN3A 2HE7A 3AMZA 5E6JA 2KVRA 3UQAA 3AE8B 2L3ZA 1UNSA 2INCC 3ZO5B 1TY0A 1YJJA 3RNAC 2I38A 2TSSA 5HKHA 1ZPSA 3CMMB 4ICUA 1L0XB 2K25A 2WP9B 3DHHC 3AE9B 4B0EA 1ET9A 5TR5A 1E7UA 3ZUPA 2D3BA 1WGKA 2WU5B 3I3TB 3QK0A 3NUHB 4NPNA 3K9OB 3I7NA 1VZ7A 1JRUA 1SE3A 1NBFC 2LWPA 4E3CA 2V0GA 2DAFA 3HUIA 2FE8A 2LVQA 4IC7B 2N0SB 3MC9A 3PZDA 4RM9A 3NRZA 2ZNVB 1ZP0B 4IM0A 3I63C 1V86A 5JZEB 1UF0A 2ZTGA 4W9LA 5DPRA 4L1BA 5D94A 3T3OA 4CQNA 4OW0A 4WAAA 4FJZA 3U4EG 3T8MA 4WURA 1QILA 5J18A 3C0RB 3BK1A 4AR1A 4M01A 1VCBA 3I7PA 4EZJA 3R3MA 4RF0A 2MW5A 1S1QB 5LLIA 2N4FA 1V5OA 3EA6A 3RPFC 2L1AA 3DBLI 1HXYD 4G0NB 4MACA 3WIMA 5IOIA 5D6JB 2C7NB 1ET6A 4HDOA 1SEBD 2KQ4X 2HTHA 2KWCA 5EE0A 2ZNVC 3ZNID 1WJUA 4XDDA 2LGXA 2WDRB 1UGJA 2JRHA 2LUEA 1FMAD 1OQQA 1JWMD 1MG4A 2R61A 4QAYA 1J7BA 3DPDA 4C7YA 3H1UA 1TY2A 2IO0B 2JSVX 3E56A 1FIQA 4C56C 2E1BA 2UWQA 1RLFA 1YIWA 5AZHA 2AQ2B 1T6BX 3Q3MC 4LNFA 4YSZB 1WYWB 1C79A 4W9EA 2BWES 3BWUD 3Q8CA 1TT5B 4G50A 2J0JA 4GLSC 1V81A 2AL6A 4XR3A 2R2QA 2OJWA 2Q5WD 3MFGA 4GU2A 2KJ6A 2REXA 2LRUA 4HCPB 4P7IA 4NJ6A 2PVGC 3B08A 1LO5D 4AOFA 1FCCC 3EFUA 2JPHA 4ZRKA 2PLPA 2MHJA 1JWUD 4N9F4 4IKGA 2EELA 3AEDB 3UQBA 4EUTA 5GMVA 3U2SC 4HJKA 3QCAA 3AXCA 5IKCM 2MH7A 4W9KA 1IGCA 2KQ7A 1V1PB 3P63A 3WAMA 2WU2B 4LLGM 1J0GA 3RULA 2EKIA 1L0YB 3AEFB 4AJYB 2K39A 2RPQA 4GN1A 1TBEA 4RFBA 2QIEB 4ITKA 3TL5A 3QIJA 3RFNA 4NAMA 1Q10A 1T5XD 3RD2A 1UWMA 3RN9C 3K9PB 3IAM1 3I89A 4XYCA 1PGBA 3ML9A 2IDYA 3BVZA 1YD8U 4FXCA 4RGTA 2RSUA 3A1QA 3MC0B 3WCQA 2J42A 2CJOA 4NQLB 4YXDB 4GMVA 4PYUA 2PE9A 2L0TA 3BVMA 2K8BA 2IY0B 2O2VB 1UGMA 3ZRCA 4W9HA 1VDVA 4WQMA 4HWIB 3VAWA 3DHIC 3Q3FA 2MSED 1KLGD 2Z8LA 5TSSA 2RGFA 1FEHA 3LB8C 2ZCCA 1WXMA 3GE3C 2PIAA 2R2OA 1ZDVA 2PE6B 3R2TA 2RDGA 2G4DB 2IUUA 1S3SG 4XX5A 2ACZB 3W1SA 5BYRA 5D3IB 2HJ8A 5H92C 1WH3A 4PK1A 1EF5A 1WR1A 2V9HA 3BK2A 2DX5B 2W3SA 1JWSD 2KDMA 4KSKC 1P3QU 1STEA 1DGJA 3S2AA 5CHFA 2KJRA 3R66C 3Q8FA 3IAS1 1DOYA 2KN5A 1TS4A 2XEWA 1SF0A 1LXDA 3I9V1 4KDLB 3WANA 4BAXA 1GPXA 5L95C 2BYTA 3A1QB 2MX2A 2FIDA 2VRRB 3EECA 4NY0A 4HK2A 1EUVB 2JVCA 2Y5CA 2WLBA 3EI4A 1QT9A 2AQ1B 2MEKA 2LZ6A 4M8NA 1C78A 1EO6A 1HE8A 2FIFA 4Q2JA 2MBQA 3B2GA 2NS5A 1MJDA 3H6NA 4JWSC 2BVCA 4EOYA 4DWFA 3PRMB 4MSQB 3L10B 1BT0A 3H7SA 4DDGD 2EKEC 1WWTA 4FHKA 4GSWA 2J53A 3GS2A 1ROEA 4BBNF 1Z2MA 3M63B 4HPLB 3MP9A 4YTPB 3ZX4A 2M1MA 3CSTA 3AEEB 4S17A 1NI2A 3KQ4A 1VR9A 4MH8A 3AEAB 3Q69A 4XZ4A 5DPWA 1PGXA 4HLEA 4AR9A 1ZW7A 2K8CA 1JWAD 3U8ZA 3KUZA 3I7KA 4MGYE 2QCZA 4KV2A 3VQIA 2CU1A 2KTFA 4F7ZA 3OJ3A 3GZNI 1HTQA 2EMTA 4P16A 1V9JA 2YVCA 2MA9B 2ZOSA 3DVNU 1QOFA 4C4VA 1KRHA 2WXOA 1QF6A 3NY5A 3MHZA 3RCZA 4RNAA 4E54A 5HFYA 3SHQA 1Z5SB 2JF5A 4N59A 1FCLA 2LHEA 2MWSB 1ZDXA 1K8RB 4F8CB 4ASWC 1GAQB 1HEZE 3Q3NC 4ZYSA 4WWPA 3ZYYX 1LM8B 1TKGA 3AV8A 3NS8A 2MBHA 2C7HA 5BYSA 5D2MB 2C7MB 3NVWA 1WGDA 4II3B 4DK5A 5CX3A 1IBXB 2LEKA 3J9CA 2KLGA 3UINB 3ZXVA 3RHUA 4LNOA 4MJSA 1WRIA 2OOBB 4A6QA 2ZPNA 3TEXA 1OTRB 4F1SA 1YJIA 5C1ZA 3NVYA 2JT4B 3SFEB 4YWGG 1IYFA 5BO4B 1SIFA 4C00A 3HM6X 3W2DA 3QQ8B 3LXFA 2AL3A 2JUOA 2BB5A 3VRBB 2Z59B 4W9FA 2J4XA 4EKUA 1E5WA 1XF5L 2L00B 2KMCA 4LK0M 1BUIC 3ENEA 3DBRI 1F9JA 1MPEA 1E7VA 1AN8A 2LMCA 3ML8A 3Q8AA 2IO3B 4KDIC 3V60A 1VZ8A 1KM7A 3ZKJC 1ZKHA 1F1HA 2N9EB 2IJ0A 1E8XA 1WGGA 4KZ0A 4HXDA 2WHIA 4GOCA 4DDID 1WJ6A 4I6NB 1UH6A 4KGRA 2JY6A 2WS3B 3ZWDA 4H2AA 4RGNA 2YLMA 2JWZA 4ZRJA 3URYA 3APCA 2N7EA 1TTNA 5EDSA 5I4DA 3P4QB 3PV1A 3MJWA 1SSNA 1WYGA 3QA8A 3MTNB 1PUTA 1D3ZA 4G3XB 3ZDMC 2ZW0A 4TV3A 4WJQA 1N60A 2BQQA 1FXTB 3JW0X 4GXBA 2GRIA 3ETRA 1QZEA 2C9WB 3PHXB 4FA6A 4GB9A 1ZGUB 5EE1A 3VFKA 3N3KB 3AE7B 1UBIA 4TZ4A 1ZXHA 1UUPA 2KX0A 4TMAB 3APFA 4J3OD 2B5LA 2ZW1A 4K81A 2KTRB 4W9GA 2KFKA 3PTFC 1D5ZC 2JXTA 2NBVB 1ZOYB 3V3XA 1WZ0A 3TUOA 3GP7A 2KNBA 3WAOA 1Q0WB 1C77A 1WE7A 4XC2A 5AUIA 3RZFA 5AEKB 1WFYA 5BYQA 2DHZA 1TS3A 2JYEA 3PVLA 1QQRA 2L52A 2G3QB 1YN4A 4LJOB 2V4IB 4A0AA 4XDCA 4KX6B 2KO3A 4AUQC 2W3RA 2PVOD 1PDXA 3MJ5A 4AQ7A 2N1VA 4TUUA 2KX3A 3QWZB 4GDKA 4DHZE 4EZKA 2DNFA 1XCQL 1B1ZA 2VH2A 3EUB2 5HI1A 5J17A 3ZDTA 2CKHB 1FNVA 4GGQA 3KYDD 1RAXA 1Y56A 3A9KB 3QJZA 1R4NI 1DOXA 1YQ4B 4JLCA 2GI9A 2MRPA 3OWEB 1P7EA 3D32A 4FHJA 3H8HA 1EU4A 1SXTA 1VLBA 2QMTA 5BMGA 1KTKA 4BOZB 3DDCB 1HZ5A 4DXAB 2NPTB 4HKQA 3HVZA 1J7CA 3I7OA 1CK1A 1WXVA 5IAAC 3FILA 4CHKA 2VZKD 2Y6IA 4IWQA 2BKFA 4CI2A 4L23A 1TKEA 1MHHE 2D3GA 4ACFA 3KW5B 3ZJUA 4II2B 2D2QA 2GBJA 4LTUA 3AB5A 1T0QC 3ABVB 3TMPB 3RZWC 1K51A 3RNCC 2IGGA 3ZUNA 2B76B 2IO2B 1R7SA 1SE9A 2ICIA 4XR1A 4IUMB 3DBSA 3IVFA 4EZLA 3V6EB 1MHXA 2N7JA 4GDKB 2I05A 3N1XC 3ZIMA 2LFIA 2BGFA 2JZZA 4PT5A 2KDFB 3CF6E 3ZW3A 3AEGB 1H8CA 2MBOA 3DBLB 4R3DA 1R4MI 2L76A 2X38A 1WX9A 1V2YA 2G1EA 3B9JA 3ZNZB 2WWZA 1XCTL 4ANVA 3RMKC 2GOWA 4W9CA 2WGSA 4E74A 2V3PA 3UIOB 1XT9B 4LJPB 1WJNA 3RFZB 4KKIA 3IHPC 2M19A 2KOXA 2FCMA 2LHDA 5AUKA 2J0MA 3FILB 2KFJA 2V3SA 1WIAA 4X57B 2WXQA 3O65B 3SR6A 1L0VB 3JYUA 2VZKB 3APDA 2WXNA 2NTTA 4BFRA 2KZRA 3ZJTA 5AZFA 2C5LC 1VRAB 1L6VA 1N61A 3IT6B 1FNUA 1C9FA 2IBIB 1AW7A 3AI5A 3ZGZA 3PSEB 2BYVE 3PREA 3JSVA 4ICVA 2KC2A 3RYTA 1XVIA 4ZRQA 3C19A 3NVZA 3PHWB 3KEWA 4AR8A 2XN9C 2DYBA 3LYYA 2A4ZA 1FXAA 4J6IA 2Y3AA 1C76A 1KJTA 5EE3A 1FO4A 2IUSA 4KZCA 1WSPA 2K6QA 1FFUA 3P4PB 3KUDB 1DYQA 3KH0A 3LJ3A 1WM3A 3RNFC 1MVKA 1YOVB 2CR5A 4LNIA 4PS3A 4M00A 2UYZB 3KLSX 3Q8EA 1GC7A 4LDTD 4ZOHC 1NYRA 2KDBA 2ZCBA 3A4RA 4RGMA 2PTLA 1T0YA 1WXOA 3ZTYA 2ZJDA 3W5VB 3ZU6A 2JZ3B 5J2RA 4ZHPA 5IN7A 4CI1A 4MH0E 4WAFA 1V1OA 3VTVA 1D5XC 4JWUC 2LRWA 5G2NA 1P1AA 2Y5PA 4JL9A 4MELA 3BINA 1IPGA 2MLBA 3OJ4B 3HK0A 3VR9B 3PLUA 1LQBA 4YL8A 3ZX5A 3VVWB 3EI1A 3BIID 3SD5A 4P1BC 4DXGA 1UWXA 2I2YA 4TSSA 1WNUA 1SE2A 5KHOA 2MCNB 3JSVB 3DWMA 3PZ7A 2HJ1A 3CIRB 3L54A 2BS4B 1V5TA 1TS2A 3I8EA 4C7ZA 1JRPA 2L83A 1F2RI 1CJEA 1YMHE 1L5PA 2KHWB 4OZAA 5T8IA 2NBWB 4IM3A 1J7AA 2FUG1 4M02A 1L4ZB 2VH1A 2I06A 3HHMA 4W9JA 3UF8A 3WAPA 2KYWA 1WX7A 2DWQA 3Q2AC 4EEWA 4K7UA 2KXJA 5EE9A 3ONSA 2G4SA 2K5PA 3PPAA 2QILA 2O6VA 3AU4A 2M0XA 2CU3A 4LDTB 1ISNA 2BT6A 1UZXB 2JU6X 1TZ1A 3V6CB 3DHGC 1I4RA 2ZVNA 3DBHI 2IPKD 5C2TB 1PQSA 3M3JA 5AZGA 2K1FA 1KFYB 2OJRA 4ZRPA 1K50A 1E7PB 3T3NA 1WJ4A 3PZ8A 1QOBA 3MC8A 3IG3A 5DCNA 3NZUA 1A5RA 4OHJA 1AWDA 1L4DB 3KYCD 1E8YA 1KOTA 2WXGA 1V97A 4ARCA 2HTME 2NCNA 4JGHB 2ZZPB 2M8SA 1SJED 4WJNA 5D3DA 3GOEA 3H7PA 4HJGE 1Q5WB 2IY1B 3P42A 2KWDA 1FXIA 4FADA 5E6PA 3KWVA 2QSDA 3ECIA 1WX8A 2LGIA 3N30A 1U4AA 2WNMA 5DPTA 4BZAA 3EHVA 2Y50A 4K7WA 4KKJA 2NVUI 1TS5A 3GZNB 2K6DB 1I4PA 5C3JB 2FAZA 3M62B 4DHJD 3DVGY 1G6JA 2LGYA 2KWVB 1V8CA 3W1SC 5JHBA 3TJPA 2RDBC 2XNAC 3C8YA 2WXKA 2DZMA 3I5JC 3TEZA 2OHFA 2JZPA 4MM3A 2ZZGA 2KKCA 4DHZB 2BPSA 4KGTA 1E9MA 3VH3B 2MP2A 3R7QA 2D11A 2Z0DB 2JWUA 3VRAB 2INDC 3PO0A 4WJOA 1WMHA 5D7GA 2JYTA 2LXAA 4KIKA 1FFVA 1WF9A 4IM2A 1OFFA 3U7DA 3NOBA 2WDQB 3ZNGC 2WXJA 4C4VB 3R7RA 2NTSA 3NVVA 1GJZA 3PGEA 1J19A 3DVNV 2FCSA 4XR2A 3OLMD 3N9YC 3H7PB 5CHWA 2M4NA 3O13A 1FRDA 1N5WA 1OGWA 2JRIB 1B9RA 3DWGC 2JXXA 3NS1A 3EI3A 3U52E 2MJDA 2AWTA 3RI7C 1MFWA 2PW9A 3UI3A 2NMQA 2WQYB 1CQVA 2LJ5A 4K3BA 1L2NA 2IYDB 2W9NA 2N1WA 1E10A 3HM3A 2IGDA 1XO3A 2KANA 2FUHB 2K9XA 5LNK1 2ON8A 3BYYB 2KAJA 1NEKB 2BF8B 4ANXA 3P4RB 1T3QA 1GUAB 2RMMA 3Q6BA 3GB1A 4MDKE 4MJSB 1XLOA 4LNKA 4FN2A 4HPPA 1ZE3D 3AE5B 4DHJB 3DBRB 4FULA 1V7OA 1HQRD 2CHWA 4JPSA 2L0FA 1WRDB 3VUXA 2MBBB 3PT2B 2KWUB 3B1LX 4FJVB 2DAJA 1JCKB 2E6XA 2BKRB 3I7LA 3BY4B 2MJEA 4A55A 4PS7A 4JQWC 1WXQA 4RGOS 1QKZA 4KIKB 1RWSA 3VDZA 1NVID 3ZTWA 4NNJB 2Y3UA 4XE0A 3QAQA 1IP9A 2E3TA 4EE2A 2ZZEA 4IDIA 2DZIA 1XXGA 2WYQA 3V61A 1VJKA 4NJ7A 5G5HA 1F52A 2GBNA 1AARA 1KF6B 2CHXA 2PEAA 1N62A 2SEBD 2W82A 2D07B 1DOIA 1K53A 1VZ6A 1GB4A 2ONQA 1ECRA 3N1YC 3HIZA 4BKSD 1QLBB 4DQOC 1WGRA 3QC8B 4YTMB 2G9HD 3V05A 3M95A 2HYEA 4BKSA 5FQDA 3FAHA 3RT3B 2LGSA 3UIPB 2MBEA 1KLVA 3U30A 1I4QA 5KHQA 2HD5B 2PPHA 2KJHB 4HCNB 3VXWA 4RCOA 2LD9A 2M56B 1BMLC 2BWFA 3L4PA 2J0KA 1T0SC 1HZ6A 1YN5A 2M17A 2EMSA 5BMIA 4B6WA 2WDTB 2B5MA 1TIFA 4NZLB 4N6EB 4E71A 4D2KA 1UBQA 2N7DA 2KFKB 3NZSA 4TKNA 2N9PC 2RPVA 2BS2B 2L7RA 1OQYA 2AQ3B 1PYWD 3GE8C 2WXPA 4PYZA 2KVZA 1Q1OA 1EM7A 2DYOA 1R4NB 5IP4D 1C4PA 4AJWA 2DLBA 2RDHA 3AM9A 1GG3A 4W9IA 1WZCA 4KVGB 2WXFA 4B95A 1XD3B 3WA0A 1E6EB 2AX5A 2IZVB 2WXHA 3Q3JA 2JX5A 3ZXRA 4W9DA 1D5MC 4ARIA 4M8MA 3DCGA 1NYQA 1V1PA 3IBEA 2N9XA 3AE1B 4HKZE 5FKAC 4AWJA 5GXGB 4OVZA 3IT4B 3R2IA 1BXTA 1K52A 1V6EA 4DXFA 2BS3B 4MGKE 3NHEB 4IG7B 4B9KA 4NAWA 1F77A 3A9JA 2YEPB 3SU8X 2V1YA 1EWYC 4ARFA 1RM6C 1ZUD2 1JROA 1MI0A 1TYGB 2MJ3A 2ASQA 1RFKA 3N20C 1I4HA 1N6ZA 4HDQA 5IA7A 1NENB 5JXVA 1C1YB 3RNGC 4MSMB 5E6NA 4A90A 2KMMA 3A4SC 1I35A 4O1NA 1XQQA 1GB1A 1WGHA 1FPYA 4OVUA 3R8BA 2O2VA 1JWBD 3AULA 2WDVB 2AYOB 2V3NA 1E0ZA 3KWLA 4ZDVA 1FM0D 2L32A 4E5ZA 3AU5A 1JMLA 1R4MB 1SB3C 3VHTC 3RNBC 1HA5A 4KGSA 4NJCA 2L05A 4LCDE 1GOZA 3CSFA 2MQJA 2ZPYA 3WALA 3ZRFA 4TQ1A 1FNWA 3I8CA 4ANUA 3LDZE 3ZJVA 1PFDA 5IO9A 1QOAA 4BKGA 2BBCA 2WXLA 3OG5A 3NZ3A 3B2FA 3KVFB 4KSLC 4YT0B 4JX1C 4L2YA 2CJNA 1D4BA 1WGYA 4RMAA 2KD0A 1RRBA 1QOGA 4WWNA 1NDDA 1I4XA 3H9DA 3VTUA 3PLVA 3NG0A 3FC4A 2LVPA 3DVGX 5LXHA 3PRZA 4NAWB 5FK9C 3B0AA 4BVUC 3A9JB 2K3UA 1V49A 4JE3B 4WWOA 1A70A 2KQSA 4HPMB 5FR3A 4MGIE 4USAA 4RF1A 1KLUD 4GIVA 4RH6A 4ANWA 1SJHD 4YSXB 1XLPA 3AE4B 3E0CA 2DZKA 1WI0A 2QJLA 3VTWA 3L17A 1XLNA 1I7HA 2WXIA 2LI5A 2RR9A 4URKA 4ZHOA 3AEBB 4P1CC 4LNNA 4MGZE 3FKYA 3ZWKA 2ZVOA 4JIOU 1SGHA 1EF1A 4K3CA 3HVDA 1OQRA 4A20A 1LGRA 2W55A 1J8CA 2PMVA 3BYTB 1HTOA 3TEWA 3TBLD 2WX1A 3L08A 3ZVVA 3SFDB 3DQVA 4BBNC 5H8YE 2Z0EB 3OAWA 2XBBC 1RFAA
chains in the Genus database with same CATH topology
2AQ2B 1T6BX 2XNAC 5AUIA 2YEPF 4YSZB 3C8YA 1C79A 5BYQA 2WXKA 3BWUD 3Q8CA 1I4GA 3TEZA 2OHFA 2JZPA 4TQ0A 1TS3A 2JYEA 4GLSC 1SBBB 2ZZGA 4N58A 1QQRA 2L52A 4XR3A 1YN4A 4KGTA 1E9MA 2Q5WD 3MFGA 2JWUA 2V4IB 2WXMA 3VRAB 1IUEA 4A0AA 3I57A 3PO0A 2BB6A 2N9LA 4XDCA 5D7GA 4WIPA 3AE6B 2PVGC 1LO5D 4KX6B 2HDEA 2JYTA 1FCCC 1FFVA 4AS1A 2KACA 2W3RA 2PLPA 2PVOD 1PDXA 1JWUD 1OFFA 3MJ5A 4AQ7A 2WDQB 4YTNB 2WXJA 4IKGA 1D6EC 2EELA 3AEDB 3SEBA 3U2SC 1V4PA 3P1MA 2NTSA 4A08A 1XCQL 3NVVA 1B1ZA 3EUB2 5HI1A 2QEJC 4XR2A 4A0BA 4XWTA 1FNVA 2MH7A 3N9YC 1EU3A 3O13A 1IGCA 1FRDA 1N5WA 5G5GA 1V1PB 3DWGC 1Y56A 3P63A 4IOIE 3NS1A 2WU2B 1B9RA 4LLGM 2EKIA 1L0YB 3AEFB 1DOXA 3U52E 3EI3A 1YQ4B 2MJDA 4RFBA 2PW9A 2GI9A 2OEDA 2QIEB 4ITKA 3UI3A 1TKYA 1P7EA 3OWEB 2NMQA 2WQYB 1CQVA 1FRRA 3RFNA 3H8HA 1IBXA 4NAMA 1E10A 1Q10A 1EU4A 1SXTA 1T5XD 1VLBA 1UWMA 2QMTA 2IGDA 5BMGA 2IUTA 1KTKA 1XO3A 2K9XA 3IAM1 4M0WA 3I89A 5LNK1 1HZ5A 2ON8A 3BYYB 2KAJA 3EI2A 2INNE 1PGBA 3ZQ4A 1TJEA 2IDYA 1NEKB 3BVZA 5HG2A 3HVZA 2M0AA 3VR8B 4HKQA 1J7CA 3I7OA 1CK1A 2FBWB 3P4RB 1T3QA 3FILA 4FXCA 2RMMA 2VZKD 4RGTA 1N5XA 3GB1A 1YQ3B 3MC0B 3WCQA 2Y6IA 2J42A 4CI2A 1XLOA 3I7HA 2CJOA 1TZOA 4L23A 1RYJA 1TKEA 1MHHE 3BZDB 4YXDB 1ZE3D 3AE5B 3ZJUA 1V7OA 2IGHA 1HQRD 4JPSA 2D5GA 4LTUA 3AB5A 4MT5A 3ABVB 3BVMA 1XLQA 5BMHA 4US9A 1JCKB 1K51A 2E6XA 1PGAA 3I7LA 2LJIA 2IGGA 2MJEA 2B76B 4A55A 1R7SA 1VDVA 4WQMA 1FD6A 4A9AA 1WXQA 2ICIA 1P7FA 4HEA1 4OZBA 4RGOS 4XR1A 1QKZA 1RWSA 1JQ4A 3W5UB 1NVID 3WQZA 4P6VF 1MHXA 2N7JA 1KLGD 1F2RC 2Y3UA 4XE0A 4GDKB 3AE3B 1IGDA 2E3TA 4EE2A 1C4CA 2I05A 2Z8LA 5TSSA 2ZZEA 3AN1A 4IDIA 2GB1A 1XXGA 1FEHA 3LB8C 2LFIA 4PT5A 1VJKA 2PIAA 4CI3A 1M4VA 3AE2B 5G5HA 3AEGB 1ACCA 1ZDVA 1KF6B 3R2TA 2RDGA 1JW9D 2H89B 1N62A 2IUUA 2SEBD 2W82A 1KH0A 4R3DA 1CZPA 2X38A 2ACZB 3W1SA 2JQRB 1DOIA 5D3IB 5H92C 5BYRA 1K53A 1VZ6A 3P4SB 2K0PA 1GB4A 2G1EA 3B9JA 1YNTE 2W3SA 3BK2A 1JWSD 1XCTL 4WWMA 5MPOA 2KDMA 4REZA 1STEA 2ONQA 1ECRA 1DGJA 4A8XC 2ZZFA 4XR0A 2V3PA 1QLBB 4DQOC 3Q8FA 4YTMB 4KKIA 3IAS1 3RFZB 2G9HD 2PKOA 3V05A 2M19A 1DOYA 1TS4A 2LHDA 5AUKA 2HYEA 3FILB 1SF0A 3I9V1 2DYMA 1GPXA 5FQDA 2BYTA 3FAHA 4YSYB 2WXQA 4A09A 3SR6A 1L0VB 2VZKB 1I4QA 2Y5CA 1EWCA 2WLBA 2WXNA 1N63A 2NTTA 3EI4A 1QT9A 3ZJTA 2AQ1B 2MEKA 1SE4A 2BW2A 3AH7A 4UDUC 4RCOA 1C78A 2M56B 1VRAB 4Q2JA 1L6VA 3BVGA 1BMLC 1N61A 3IT6B 3L4PA 3B2GA 3W9CB 1SIJA 1ESFA 2DBYA 1FNUA 1HZ6A 1YN5A 4XWWA 5BMIA 4HRSA 4WH4A 1C9FA 2B5MA 3U7ZA 4NZLB 1AW7A 4JWSC 4N6EB 3ZGZA 4D2KA 2K22A 1WWTA 3CWIA 2J53A 2RPVA 3GS2A 1ROEA 4ZRQA 2BS2B 3NVZA 1XEEA 3MP9A 4YTPB 3KEWA 2KN4A 2LUMA 4AR8A 1NI3A 2N9KA 2AQ3B 3AEEB 3KQ4A 1PYWD 2XN9C 3LYYA 1VR9A 1ENFA 1FXAA 4US8A 2Y3AA 1F0ZA 2WXPA 5HHDG 4MH8A 3AEAB 1C76A 3Q69A 4OZCA 5EE3A 1FO4A 1PGXA 2EWJA 3AECB 1ZXIA 4MM3B 4HROA 2IUSA 1JWAD 2INPE 4AR9A 3I7KA 1WSPA 3VQIA 1FFUA 3P4PB 1EM7A 2DYOA 1DYQA 1C4PA 4P16A 4AREA 2DLBA 2RDHA 3AM9A 4GDLB 1MVKA 1QOFA 2WXFA 3KLSX 3Q8EA 2J52A 4A11A 1KRHA 2WXOA 4ZOHC 1E6EB 1NYRA 2AX5A 3TEYA 1QF6A 2WXHA 4C80A 2JX5A 3MHZA 4RGMA 2PTLA 2H88B 1D5MC 1WXOA 3W5VB 1JALA 4ARIA 3TSSA 4RNAA 4E54A 1NYQA 1V1PA 5HFYA 3AE1B 4ZHPA 4HKZE 5FKAC 4CI1A 5GXGB 4N59A 1FCLA 2LHEA 4WAFA 4OVZA 3IT4B 1V1OA 2W54A 3EGRA 3R2IA 1BXTA 1K52A 1D5XC 1ZDXA 4DXFA 2BTEA 2BS3B 1GAQB 1HEZE 4JWUC 1L6UA 4ZYSA 2Y5PA 1C4AA 3ZYYX 1TKGA 3AV8A 3IXSA 4B0MA 1F77A 1AYFA 5BYSA 3Q8BA 3VR9B 2YEPB 3E9SA 3NVWA 1EWYC 3EI1A 2SAKA 3BIID 1IBXB 3HRDD 2WXRA 2LEKA 4ARFA 1RM6C 1ZUD2 3J9CA 1JROA 1MI0A 4DXGA 1TYGB 1UWXA 1YN3A 2MJ3A 3AMZA 2I2YA 1RFKA 5E6JA 3RHUA 1I4HA 4TSSA 1WNUA 1SE2A 1WRIA 3DWMA 3PZ7A 3CIRB 1NENB 3AE8B 5JXVA 2BS4B 4A6QA 1UNSA 3TEXA 1TS2A 1TY0A 1YJJA 4A90A 4C7ZA 3I8EA 2KMMA 2I38A 4O1NA 1GB1A 2TSSA 1YJIA 1JRPA 1ZPSA 2L83A 1F2RI 1CJEA 3NVYA 1L0XB 1YMHE 1L5PA 3R8BA 1JWBD 2WDVB 4OZAA 2WP9B 2V3NA 3SFEB 5T8IA 3AE9B 4YWGG 4B0EA 1ET9A 1E0ZA 1J7AA 3KWLA 1FM0D 1WGKA 2L32A 2FUG1 2WU5B 4E5ZA 1L4ZB 3W2DA 2I06A 1JMLA 3NUHB 1SB3C 3I7NA 1VZ7A 3LXFA 1HA5A 4KGSA 1SE3A 4NJCA 2BB5A 2DWQA 3VRBB 2V0GA 3HUIA 2FE8A 1GOZA 2J4XA 4TQ1A 1FNWA 5EE9A 1XF5L 3I8CA 2K5PA 3ZJVA 1PFDA 2N0SB 2QILA 4LK0M 1QOAA 1BUIC 3NRZA 1ZP0B 2BBCA 2CU3A 2BT6A 2WXLA 1MPEA 2JU6X 3NZ3A 3B2FA 1AN8A 2LMCA 3Q8AA 1I4RA 4YT0B 4JX1C 4L2YA 4L1BA 2CJNA 2ZTGA 3T3OA 4CQNA 2IPKD 5C2TB 1VZ8A 1D4BA 1QOGA 4OW0A 1KFYB 2IJ0A 1I4XA 3U4EG 4ZRPA 1K50A 1E7PB 4WURA 3FC4A 3T3NA 4NAWB 1QILA 5FK9C 3PZ8A 2K3UA 1QOBA 4JE3B 1A70A 4KGRA 3BK1A 5FR3A 4AR1A 2WS3B 4USAA 4RF1A 1KLUD 4H2AA 4RGNA 4RH6A 4OHJA 1SJHD 1AWDA 4YSXB 1XLPA 1L4DB 3URYA 3I7PA 4RF0A 3AE4B 5I4DA 3P4QB 3E0CA 1SSNA 1WYGA 2QJLA 2WXGA 1V97A 1XLNA 1I7HA 1PUTA 4ARCA 2WXIA 3EA6A 3RPFC 2HTME 2L1AA 1HXYD 4ZHOA 4MACA 3AEBB 2ZW0A 1SJED 1N60A 5D3DA 3P42A 4HJGE 2KWDA 1FXIA 2GRIA 3ETRA 1ET6A 1SEBD 2KQ4X 3KWVA 2QSDA 5EE1A 5EE0A 3AE7B 4TZ4A 4XDDA 1ZXHA 3HVDA 2LGIA 2WNMA 1OQRA 1UUPA 2WDRB 1UGJA 2W55A 4TMAB 2PMVA 1FMAD 3BYTB 1OQQA 3TEWA 4J3OD 2B5LA 2Y50A 1JWMD 2ZW1A 4KKJA 2R61A 1TS5A 1J7BA 3SFDB 1I4PA 1D5ZC 2JXTA 4C7YA 5C3JB 1ZOYB 1TY2A 2JSVX 3E56A 3V3XA 1FIQA 3TUOA 4C56C 5H8YE 2E1BA 3GP7A 1C77A 1V8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS2 B;  5AUI A;  1SB3 C;  1VDV A;  3NVZ A;  4WQM A;  4YTP B;  3LXF A;  4YSZ B;  3KEW A;  4A9A A;  1WXQ A;  1NI3 A;  2OHF A;  2DWQ A;  3VRB B;  1RWS A;  3AEE B;  1JQ4 A;  3W5U B;  3HUI A;  1F0Z A;  1FXA A;  4US8 A;  1NVI D;  3WQZ A;  2ZZG A;  3AEA B;  4N58 A;  5EE3 A;  2L52 A;  4P6V F;  1FO4 A;  5EE9 A;  3AEC B;  1ZXI A;  3AE3 B;  2K5P A;  1JWA D;  1E9M A;  1PFD A;  2N0S B;  4HRO A;  2E3T A;  1QOA A;  2Q5W D;  1FFU A;  3P4P B;  2ZZE A;  3AN1 A;  3NRZ A;  4IDI A;  1ZP0 B;  3VRA B;  1IUE A;  2CU3 A;  2BT6 A;  3PO0 A;  3LB8 C;  3AE6 B;  1VJK A;  2PVG C;  3B2F A;  2PIA A;  4YT0 B;  4JX1 C;  4KX6 B;  2ZTG A;  2CJN A;  3AE2 B;  3AM9 A;  5G5H A;  5C2T B;  3AEG B;  1QOF A;  1KF6 B;  1FFV A;  2W3R A;  2PVO D;  1PDX A;  1OFF A;  1JW9 D;  1KRH A;  1N62 A;  2H89 B;  1QOG A;  4ZOH C;  1E6E B;  1NYR A;  2AX5 A;  2WDQ B;  1QF6 A;  4YTN B;  1CZP A;  1KFY B;  4C80 A;  2JX5 A;  2ACZ B;  2JQR B;  3AED B;  1DOI A;  5H92 C;  1V4P A;  1E7P B;  3P1M A;  3FC4 A;  3P4S B;  2H88 B;  1WXO A;  2G1E A;  3B9J A;  2W3S A;  3NVV A;  3W5V B;  4WWM A;  1JAL A;  3EUB 2;  5MPO A;  1NYQ A;  1QOB A;  1DGJ A;  1A70 A;  3AE1 B;  2ZZF A;  2MH7 A;  4ZHP A;  2WS3 B;  4USA A;  5GXG B;  1FRD A;  4N59 A;  1QLB B;  1N5W A;  5G5G A;  1B9R A;  3DWG C;  1AWD A;  3P63 A;  2W54 A;  1XLP A;  2WU2 B;  3NS1 A;  2PKO A;  4YSX B;  4YTM B;  2M19 A;  2EKI A;  1DOY A;  2BS3 B;  3AE4 B;  1GAQ B;  3AEF B;  3P4Q B;  1DOX A;  4JWU C;  5AUK A;  1L6U A;  1WYG A;  2QJL A;  1SF0 A;  1YQ4 B;  2MJD A;  1V97 A;  1XLN A;  1I7H A;  1PUT A;  3ZYY X;  1GPX A;  2QIE B;  4ITK A;  1TKY A;  3FAH A;  1TKG A;  2WQY B;  3AV8 A;  4YSY B;  2HTM E;  3RPF C;  1AYF A;  1FRR A;  4ZHO A;  3RFN A;  3AEB B;  3VR9 B;  1E10 A;  3SR6 A;  1L0V B;  1N60 A;  1UWM A;  1VLB A;  3NVW A;  1EWY C;  3BII D;  1XO3 A;  2Y5C A;  2K9X A;  2WLB A;  3HRD D;  1FXI A;  3ETR A;  2LEK A;  1N63 A;  1RM6 C;  2KAJ A;  1ZUD 2;  1QT9 A;  1JRO A;  1TYG B;  1TJE A;  2MJ3 A;  1NEK B;  3AMZ A;  3AH7 A;  3HVZ A;  3VR8 B;  1RFK A;  5EE1 A;  1J7C A;  3RHU A;  2FBW B;  1WNU A;  3P4R B;  1T3Q A;  1WRI A;  4FXC A;  5EE0 A;  3AE7 B;  2M56 B;  3DWM A;  1N5X A;  3CIR B;  1NEN B;  3AE8 B;  2BS4 B;  1L6V A;  1YQ3 B;  1OQR A;  2WDR B;  3WCQ A;  2W55 A;  1N61 A;  1XLO A;  3L4P A;  1YJJ A;  3B2G A;  2CJO A;  1SIJ A;  3W9C B;  4C7Z A;  1FMA D;  1RYJ A;  1TKE A;  1OQQ A;  2DBY A;  2KMM A;  4YXD B;  1YJI A;  3AE5 B;  1JRP A;  1V7O A;  2L83 A;  4HRS A;  4LTU A;  1CJE A;  3NVY A;  3AB5 A;  1J7B A;  3SFD B;  1L5P A;  3ABV B;  4JWS C;  4N6E B;  4C7Y A;  5C3J B;  1JWB D;  1ZOY B;  2WDV B;  3SFE B;  1FIQ A;  1XLQ A;  2K22 A;  2WP9 B;  4US9 A;  3AE9 B;  2E1B A;  5H8Y E;  1E0Z A;  1J7A A;  3KWL A;  1FM0 D;  1WGK A;  1WWT A;  1V8C A;  2WU5 B;  3CWI A;  2MJE A;  1ROE A;  2B76 B;  1R7S A; 
#chains in the Genus database with same CATH topology
 1UEL A;  2D3C A;  2YEP F;  5L83 A;  5JHA A;  1I4G A;  4TQ0 A;  1YJ1 A;  1SBB B;  5G55 A;  4N58 A;  1Y8R C;  1I42 A;  1M94 A;  1WE6 A;  4PS8 A;  2GBK A;  2WXM A;  1IUE A;  3JVZ X;  3VUW A;  3I57 A;  2BB6 A;  2N9L A;  4WIP A;  3AE6 B;  1C3T A;  3ALB A;  2HDE A;  2LVO A;  4AS1 A;  2KAC A;  1P9D U;  1WR6 E;  2O6V D;  3KUC B;  4YTN B;  1OEY A;  1D6E C;  3Q14 C;  3SEB A;  4FLH A;  4RM8 A;  3P1M A;  1V4P A;  4A08 A;  1YX6 B;  2QEJ C;  2NBU A;  4A0B A;  4XWT A;  1H4R A;  1EU3 A;  5G5G A;  1X1M A;  3NJT A;  4EFO A;  4BKT A;  4IOI E;  3ZNH B;  2FCQ A;  2KLC A;  3V62 A;  2RD0 A;  3L0W B;  2KDE B;  2XK5 A;  2OED A;  3DOW A;  5DPS A;  1TKY A;  3RNE C;  1FRR A;  3T9L A;  1IBX A;  2GLS A;  2KC1 A;  2IUT A;  3QX1 A;  2J7Q B;  4M0W A;  2QHO A;  4BOS C;  2V4L A;  2INN E;  3UGB B;  3EI2 A;  3ZQ4 A;  1TJE A;  3VR8 B;  5HG2 A;  2M0A A;  2FBW B;  3QAR A;  1N5X A;  2DEN B;  1YQ3 B;  2UU7 A;  3I7H A;  2KK8 A;  1TZO A;  1RYJ A;  3BZD B;  4IWP A;  2IGH A;  3L13 A;  4A3P A;  4DBG A;  2D5G A;  4MT5 A;  2PJH A;  4CYE A;  2I1J A;  3ZTD A;  1XLQ A;  5BMH A;  3TIX A;  4US9 A;  3DBH B;  3PRP B;  2D10 A;  1PGA A;  2LJI A;  1UD7 A;  1FD6 A;  4A9A A;  1TGZ B;  1P7F A;  4HEA 1;  4OZB A;  1JQ4 A;  3W5U B;  4XGA B;  3ZW7 A;  3WQZ A;  3VUY A;  3P2B A;  4P6V F;  1F2R C;  2LAS A;  3AE3 B;  4I6L B;  1WXA A;  1IGD A;  1C4C A;  2LGD A;  3AN1 A;  4NQK E;  2D3A A;  3A33 B;  2GB1 A;  1YQB A;  2O6V B;  1GNU A;  3IFW B;  5LXI B;  4CI3 A;  4WJP A;  1M4V A;  3AE2 B;  3EFC A;  2AEH A;  3SDL C;  2LXC A;  1ACC A;  1JW9 D;  2H89 B;  5E6O A;  1KH0 A;  2CS4 A;  1CZP A;  2JQR B;  5C23 A;  1P0R A;  2XK5 B;  3P4S B;  2NR2 A;  2K0P A;  1YNT E;  4WWM A;  5MPO A;  1V80 A;  4REZ A;  3Q3O C;  4K7S A;  5FR6 A;  4A8X C;  2ZZF A;  4XR0 A;  3EC8 A;  4GDL A;  4M0W B;  1MG8 A;  2PKO A;  2GBM A;  1E90 A;  1T0R C;  4MEM A;  2DYM A;  4HVB A;  1WXS A;  4FJY A;  4YSY B;  2I1K A;  2FCN A;  1OEY J;  4A09 A;  2QC8 A;  4S0R A;  3TCA A;  4WQO B;  3ZTC A;  4I6P A;  1EWC A;  1N63 A;  1WM2 A;  1SE4 A;  2BW2 A;  3AH7 A;  4UDU C;  2Y5B B;  3MHS D;  4IW0 A;  3BVG A;  2BYF A;  2KTR A;  2K8H A;  2WX0 A;  1SIJ A;  1E8Z A;  1ESF A;  2DBY A;  2IO1 B;  3W9C B;  5JH5 C;  4XWW A;  2DZJ A;  4HRS A;  4WH4 A;  3U7Z A;  3L16 A;  2K22 A;  4G11 A;  5CTR C;  3CWI A;  3PS6 A;  1XEE A;  2B3A A;  2KMA A;  1GC6 A;  2KN4 A;  2LUM A;  1NI3 A;  2N9K A;  1WZ3 A;  2GBR A;  1ENF A;  1F0Z A;  4US8 A;  5HHD G;  4A3O A;  4OZC A;  2EWJ A;  2BYE A;  1ZXI A;  3AEC B;  4HRO A;  4MM3 B;  2INP E;  4ZYN A;  4OVV A;  3W1Y A;  4FBJ B;  4AP4 C;  2X8X X;  2MP2 B;  2FNJ B;  4ARE A;  3N32 A;  4GDL B;  1WMH B;  2ZEQ A;  2G45 B;  1L7Y A;  1YX5 B;  4K1R B;  2J52 A;  4A11 A;  5CHV C;  3X23 A;  3TEY A;  4CO7 A;  4C80 A;  2GMI C;  2H88 B;  4IWO A;  1JAL A;  3TSS A;  2C60 A;  3A9K A;  1WY8 A;  2CHZ A;  3ZLZ A;  3RUI B;  1E8W A;  2W54 A;  3EGR A;  3N1Z C;  3X0W A;  2BTE A;  1CMX B;  1L6U A;  1C4A A;  2A5U A;  1LFD A;  1VD2 A;  2KT7 A;  2QDF A;  1P98 A;  3IXS A;  4B0M A;  1AYF A;  3QHT A;  3Q8B A;  3E9S A;  3VH4 B;  4ZRI A;  2NPT A;  2SAK A;  2L8J A;  3HRD D;  2WXR A;  2KDI A;  1YN3 A;  2HE7 A;  3AMZ A;  5E6J A;  2KVR A;  3UQA A;  3AE8 B;  2L3Z A;  1UNS A;  2INC C;  3ZO5 B;  1TY0 A;  1YJJ A;  3RNA C;  2I38 A;  2TSS A;  5HKH A;  1ZPS A;  3CMM B;  4ICU A;  1L0X B;  2K25 A;  2WP9 B;  3DHH C;  3AE9 B;  4B0E A;  1ET9 A;  5TR5 A;  1E7U A;  3ZUP A;  2D3B A;  1WGK A;  2WU5 B;  3I3T B;  3QK0 A;  3NUH B;  4NPN A;  3K9O B;  3I7N A;  1VZ7 A;  1JRU A;  1SE3 A;  1NBF C;  2LWP A;  4E3C A;  2V0G A;  2DAF A;  3HUI A;  2FE8 A;  2LVQ A;  4IC7 B;  2N0S B;  3MC9 A;  3PZD A;  4RM9 A;  3NRZ A;  2ZNV B;  1ZP0 B;  4IM0 A;  3I63 C;  1V86 A;  5JZE B;  1UF0 A;  2ZTG A;  4W9L A;  5DPR A;  4L1B A;  5D94 A;  3T3O A;  4CQN A;  4OW0 A;  4WAA A;  4FJZ A;  3U4E G;  3T8M A;  4WUR A;  1QIL A;  5J18 A;  3C0R B;  3BK1 A;  4AR1 A;  4M01 A;  1VCB A;  3I7P A;  4EZJ A;  3R3M A;  4RF0 A;  2MW5 A;  1S1Q B;  5LLI A;  2N4F A;  1V5O A;  3EA6 A;  3RPF C;  2L1A A;  3DBL I;  1HXY D;  4G0N B;  4MAC A;  3WIM A;  5IOI A;  5D6J B;  2C7N B;  1ET6 A;  4HDO A;  1SEB D;  2KQ4 X;  2HTH A;  2KWC A;  5EE0 A;  2ZNV C;  3ZNI D;  1WJU A;  4XDD A;  2LGX A;  2WDR B;  1UGJ A;  2JRH A;  2LUE A;  1FMA D;  1OQQ A;  1JWM D;  1MG4 A;  2R61 A;  4QAY A;  1J7B A;  3DPD A;  4C7Y A;  3H1U A;  1TY2 A;  2IO0 B;  2JSV X;  3E56 A;  1FIQ A;  4C56 C;  2E1B A;  2UWQ A;  1RLF A;  1YIW A;  5AZH A;  2AQ2 B;  1T6B X;  3Q3M C;  4LNF A;  4YSZ B;  1WYW B;  1C79 A;  4W9E A;  2BWE S;  3BWU D;  3Q8C A;  1TT5 B;  4G50 A;  2J0J A;  4GLS C;  1V81 A;  2AL6 A;  4XR3 A;  2R2Q A;  2OJW A;  2Q5W D;  3MFG A;  4GU2 A;  2KJ6 A;  2REX A;  2LRU A;  4HCP B;  4P7I A;  4NJ6 A;  2PVG C;  3B08 A;  1LO5 D;  4AOF A;  1FCC C;  3EFU A;  2JPH A;  4ZRK A;  2PLP A;  2MHJ A;  1JWU D;  4N9F 4;  4IKG A;  2EEL A;  3AED B;  3UQB A;  4EUT A;  5GMV A;  3U2S C;  4HJK A;  3QCA A;  3AXC A;  5IKC M;  2MH7 A;  4W9K A;  1IGC A;  2KQ7 A;  1V1P B;  3P63 A;  3WAM A;  2WU2 B;  4LLG M;  1J0G A;  3RUL A;  2EKI A;  1L0Y B;  3AEF B;  4AJY B;  2K39 A;  2RPQ A;  4GN1 A;  1TBE A;  4RFB A;  2QIE B;  4ITK A;  3TL5 A;  3QIJ A;  3RFN A;  4NAM A;  1Q10 A;  1T5X D;  3RD2 A;  1UWM A;  3RN9 C;  3K9P B;  3IAM 1;  3I89 A;  4XYC A;  1PGB A;  3ML9 A;  2IDY A;  3BVZ A;  1YD8 U;  4FXC A;  4RGT A;  2RSU A;  3A1Q A;  3MC0 B;  3WCQ A;  2J42 A;  2CJO A;  4NQL B;  4YXD B;  4GMV A;  4PYU A;  2PE9 A;  2L0T A;  3BVM A;  2K8B A;  2IY0 B;  2O2V B;  1UGM A;  3ZRC A;  4W9H A;  1VDV A;  4WQM A;  4HWI B;  3VAW A;  3DHI C;  3Q3F A;  2MSE D;  1KLG D;  2Z8L A;  5TSS A;  2RGF A;  1FEH A;  3LB8 C;  2ZCC A;  1WXM A;  3GE3 C;  2PIA A;  2R2O A;  1ZDV A;  2PE6 B;  3R2T A;  2RDG A;  2G4D B;  2IUU A;  1S3S G;  4XX5 A;  2ACZ B;  3W1S A;  5BYR A;  5D3I B;  2HJ8 A;  5H92 C;  1WH3 A;  4PK1 A;  1EF5 A;  1WR1 A;  2V9H A;  3BK2 A;  2DX5 B;  2W3S A;  1JWS D;  2KDM A;  4KSK C;  1P3Q U;  1STE A;  1DGJ A;  3S2A A;  5CHF A;  2KJR A;  3R66 C;  3Q8F A;  3IAS 1;  1DOY A;  2KN5 A;  1TS4 A;  2XEW A;  1SF0 A;  1LXD A;  3I9V 1;  4KDL B;  3WAN A;  4BAX A;  1GPX A;  5L95 C;  2BYT A;  3A1Q B;  2MX2 A;  2FID A;  2VRR B;  3EEC A;  4NY0 A;  4HK2 A;  1EUV B;  2JVC A;  2Y5C A;  2WLB A;  3EI4 A;  1QT9 A;  2AQ1 B;  2MEK A;  2LZ6 A;  4M8N A;  1C78 A;  1EO6 A;  1HE8 A;  2FIF A;  4Q2J A;  2MBQ A;  3B2G A;  2NS5 A;  1MJD A;  3H6N A;  4JWS C;  2BVC A;  4EOY A;  4DWF A;  3PRM B;  4MSQ B;  3L10 B;  1BT0 A;  3H7S A;  4DDG D;  2EKE C;  1WWT A;  4FHK A;  4GSW A;  2J53 A;  3GS2 A;  1ROE A;  4BBN F;  1Z2M A;  3M63 B;  4HPL B;  3MP9 A;  4YTP B;  3ZX4 A;  2M1M A;  3CST A;  3AEE B;  4S17 A;  1NI2 A;  3KQ4 A;  1VR9 A;  4MH8 A;  3AEA B;  3Q69 A;  4XZ4 A;  5DPW A;  1PGX A;  4HLE A;  4AR9 A;  1ZW7 A;  2K8C A;  1JWA D;  3U8Z A;  3KUZ A;  3I7K A;  4MGY E;  2QCZ A;  4KV2 A;  3VQI A;  2CU1 A;  2KTF A;  4F7Z A;  3OJ3 A;  3GZN I;  1HTQ A;  2EMT A;  4P16 A;  1V9J A;  2YVC A;  2MA9 B;  2ZOS A;  3DVN U;  1QOF A;  4C4V A;  1KRH A;  2WXO A;  1QF6 A;  3NY5 A;  3MHZ A;  3RCZ A;  4RNA A;  4E54 A;  5HFY A;  3SHQ A;  1Z5S B;  2JF5 A;  4N59 A;  1FCL A;  2LHE A;  2MWS B;  1ZDX A;  1K8R B;  4F8C B;  4ASW C;  1GAQ B;  1HEZ E;  3Q3N C;  4ZYS A;  4WWP A;  3ZYY X;  1LM8 B;  1TKG A;  3AV8 A;  3NS8 A;  2MBH A;  2C7H A;  5BYS A;  5D2M B;  2C7M B;  3NVW A;  1WGD A;  4II3 B;  4DK5 A;  5CX3 A;  1IBX B;  2LEK A;  3J9C A;  2KLG A;  3UIN B;  3ZXV A;  3RHU A;  4LNO A;  4MJS A;  1WRI A;  2OOB B;  4A6Q A;  2ZPN A;  3TEX A;  1OTR B;  4F1S A;  1YJI A;  5C1Z A;  3NVY A;  2JT4 B;  3SFE B;  4YWG G;  1IYF A;  5BO4 B;  1SIF A;  4C00 A;  3HM6 X;  3W2D A;  3QQ8 B;  3LXF A;  2AL3 A;  2JUO A;  2BB5 A;  3VRB B;  2Z59 B;  4W9F A;  2J4X A;  4EKU A;  1E5W A;  1XF5 L;  2L00 B;  2KMC A;  4LK0 M;  1BUI C;  3ENE A;  3DBR I;  1F9J A;  1MPE A;  1E7V A;  1AN8 A;  2LMC A;  3ML8 A;  3Q8A A;  2IO3 B;  4KDI C;  3V60 A;  1VZ8 A;  1KM7 A;  3ZKJ C;  1ZKH A;  1F1H A;  2N9E B;  2IJ0 A;  1E8X A;  1WGG A;  4KZ0 A;  4HXD A;  2WHI A;  4GOC A;  4DDI D;  1WJ6 A;  4I6N B;  1UH6 A;  4KGR A;  2JY6 A;  2WS3 B;  3ZWD A;  4H2A A;  4RGN A;  2YLM A;  2JWZ A;  4ZRJ A;  3URY A;  3APC A;  2N7E A;  1TTN A;  5EDS A;  5I4D A;  3P4Q B;  3PV1 A;  3MJW A;  1SSN A;  1WYG A;  3QA8 A;  3MTN B;  1PUT A;  1D3Z A;  4G3X B;  3ZDM C;  2ZW0 A;  4TV3 A;  4WJQ A;  1N60 A;  2BQQ A;  1FXT B;  3JW0 X;  4GXB A;  2GRI A;  3ETR A;  1QZE A;  2C9W B;  3PHX B;  4FA6 A;  4GB9 A;  1ZGU B;  5EE1 A;  3VFK A;  3N3K B;  3AE7 B;  1UBI A;  4TZ4 A;  1ZXH A;  1UUP A;  2KX0 A;  4TMA B;  3APF A;  4J3O D;  2B5L A;  2ZW1 A;  4K81 A;  2KTR B;  4W9G A;  2KFK A;  3PTF C;  1D5Z C;  2JXT A;  2NBV B;  1ZOY B;  3V3X A;  1WZ0 A;  3TUO A;  3GP7 A;  2KNB A;  3WAO A;  1Q0W B;  1C77 A;  1WE7 A;  4XC2 A;  5AUI A;  3RZF A;  5AEK B;  1WFY A;  5BYQ A;  2DHZ A;  1TS3 A;  2JYE A;  3PVL A;  1QQR A;  2L52 A;  2G3Q B;  1YN4 A;  4LJO B;  2V4I B;  4A0A A;  4XDC A;  4KX6 B;  2KO3 A;  4AUQ C;  2W3R A;  2PVO D;  1PDX A;  3MJ5 A;  4AQ7 A;  2N1V A;  4TUU A;  2KX3 A;  3QWZ B;  4GDK A;  4DHZ E;  4EZK A;  2DNF A;  1XCQ L;  1B1Z A;  2VH2 A;  3EUB 2;  5HI1 A;  5J17 A;  3ZDT A;  2CKH B;  1FNV A;  4GGQ A;  3KYD D;  1RAX A;  1Y56 A;  3A9K B;  3QJZ A;  1R4N I;  1DOX A;  1YQ4 B;  4JLC A;  2GI9 A;  2MRP A;  3OWE B;  1P7E A;  3D32 A;  4FHJ A;  3H8H A;  1EU4 A;  1SXT A;  1VLB A;  2QMT A;  5BMG A;  1KTK A;  4BOZ B;  3DDC B;  1HZ5 A;  4DXA B;  2NPT B;  4HKQ A;  3HVZ A;  1J7C A;  3I7O A;  1CK1 A;  1WXV A;  5IAA C;  3FIL A;  4CHK A;  2VZK D;  2Y6I A;  4IWQ A;  2BKF A;  4CI2 A;  4L23 A;  1TKE A;  1MHH E;  2D3G A;  4ACF A;  3KW5 B;  3ZJU A;  4II2 B;  2D2Q A;  2GBJ A;  4LTU A;  3AB5 A;  1T0Q C;  3ABV B;  3TMP B;  3RZW C;  1K51 A;  3RNC C;  2IGG A;  3ZUN A;  2B76 B;  2IO2 B;  1R7S A;  1SE9 A;  2ICI A;  4XR1 A;  4IUM B;  3DBS A;  3IVF A;  4EZL A;  3V6E B;  1MHX A;  2N7J A;  4GDK B;  2I05 A;  3N1X C;  3ZIM A;  2LFI A;  2BGF A;  2JZZ A;  4PT5 A;  2KDF B;  3CF6 E;  3ZW3 A;  3AEG B;  1H8C A;  2MBO A;  3DBL B;  4R3D A;  1R4M I;  2L76 A;  2X38 A;  1WX9 A;  1V2Y A;  2G1E A;  3B9J A;  3ZNZ B;  2WWZ A;  1XCT L;  4ANV A;  3RMK C;  2GOW A;  4W9C A;  2WGS A;  4E74 A;  2V3P A;  3UIO B;  1XT9 B;  4LJP B;  1WJN A;  3RFZ B;  4KKI A;  3IHP C;  2M19 A;  2KOX A;  2FCM A;  2LHD A;  5AUK A;  2J0M A;  3FIL B;  2KFJ A;  2V3S A;  1WIA A;  4X57 B;  2WXQ A;  3O65 B;  3SR6 A;  1L0V B;  3JYU A;  2VZK B;  3APD A;  2WXN A;  2NTT A;  4BFR A;  2KZR A;  3ZJT A;  5AZF A;  2C5L C;  1VRA B;  1L6V A;  1N61 A;  3IT6 B;  1FNU A;  1C9F A;  2IBI B;  1AW7 A;  3AI5 A;  3ZGZ A;  3PSE B;  2BYV E;  3PRE A;  3JSV A;  4ICV A;  2KC2 A;  3RYT A;  1XVI A;  4ZRQ A;  3C19 A;  3NVZ A;  3PHW B;  3KEW A;  4AR8 A;  2XN9 C;  2DYB A;  3LYY A;  2A4Z A;  1FXA A;  4J6I A;  2Y3A A;  1C76 A;  1KJT A;  5EE3 A;  1FO4 A;  2IUS A;  4KZC A;  1WSP A;  2K6Q A;  1FFU A;  3P4P B;  3KUD B;  1DYQ A;  3KH0 A;  3LJ3 A;  1WM3 A;  3RNF C;  1MVK A;  1YOV B;  2CR5 A;  4LNI A;  4PS3 A;  4M00 A;  2UYZ B;  3KLS X;  3Q8E A;  1GC7 A;  4LDT D;  4ZOH C;  1NYR A;  2KDB A;  2ZCB A;  3A4R A;  4RGM A;  2PTL A;  1T0Y A;  1WXO A;  3ZTY A;  2ZJD A;  3W5V B;  3ZU6 A;  2JZ3 B;  5J2R A;  4ZHP A;  5IN7 A;  4CI1 A;  4MH0 E;  4WAF A;  1V1O A;  3VTV A;  1D5X C;  4JWU C;  2LRW A;  5G2N A;  1P1A A;  2Y5P A;  4JL9 A;  4MEL A;  3BIN A;  1IPG A;  2MLB A;  3OJ4 B;  3HK0 A;  3VR9 B;  3PLU A;  1LQB A;  4YL8 A;  3ZX5 A;  3VVW B;  3EI1 A;  3BII D;  3SD5 A;  4P1B C;  4DXG A;  1UWX A;  2I2Y A;  4TSS A;  1WNU A;  1SE2 A;  5KHO A;  2MCN B;  3JSV B;  3DWM A;  3PZ7 A;  2HJ1 A;  3CIR B;  3L54 A;  2BS4 B;  1V5T A;  1TS2 A;  3I8E A;  4C7Z A;  1JRP A;  2L83 A;  1F2R I;  1CJE A;  1YMH E;  1L5P A;  2KHW B;  4OZA A;  5T8I A;  2NBW B;  4IM3 A;  1J7A A;  2FUG 1;  4M02 A;  1L4Z B;  2VH1 A;  2I06 A;  3HHM A;  4W9J A;  3UF8 A;  3WAP A;  2KYW A;  1WX7 A;  2DWQ A;  3Q2A C;  4EEW A;  4K7U A;  2KXJ A;  5EE9 A;  3ONS A;  2G4S A;  2K5P A;  3PPA A;  2QIL A;  2O6V A;  3AU4 A;  2M0X A;  2CU3 A;  4LDT B;  1ISN A;  2BT6 A;  1UZX B;  2JU6 X;  1TZ1 A;  3V6C B;  3DHG C;  1I4R A;  2ZVN A;  3DBH I;  2IPK D;  5C2T B;  1PQS A;  3M3J A;  5AZG A;  2K1F A;  1KFY B;  2OJR A;  4ZRP A;  1K50 A;  1E7P B;  3T3N A;  1WJ4 A;  3PZ8 A;  1QOB A;  3MC8 A;  3IG3 A;  5DCN A;  3NZU A;  1A5R A;  4OHJ A;  1AWD A;  1L4D B;  3KYC D;  1E8Y A;  1KOT A;  2WXG A;  1V97 A;  4ARC A;  2HTM E;  2NCN A;  4JGH B;  2ZZP B;  2M8S A;  1SJE D;  4WJN A;  5D3D A;  3GOE A;  3H7P A;  4HJG E;  1Q5W B;  2IY1 B;  3P42 A;  2KWD A;  1FXI A;  4FAD A;  5E6P A;  3KWV A;  2QSD A;  3ECI A;  1WX8 A;  2LGI A;  3N30 A;  1U4A A;  2WNM A;  5DPT A;  4BZA A;  3EHV A;  2Y50 A;  4K7W A;  4KKJ A;  2NVU I;  1TS5 A;  3GZN B;  2K6D B;  1I4P A;  5C3J B;  2FAZ A;  3M62 B;  4DHJ D;  3DVG Y;  1G6J A;  2LGY A;  2KWV B;  1V8C A;  3W1S C;  5JHB A;  3TJP A;  2RDB C;  2XNA C;  3C8Y A;  2WXK A;  2DZM A;  3I5J C;  3TEZ A;  2OHF A;  2JZP A;  4MM3 A;  2ZZG A;  2KKC A;  4DHZ B;  2BPS A;  4KGT A;  1E9M A;  3VH3 B;  2MP2 A;  3R7Q A;  2D11 A;  2Z0D B;  2JWU A;  3VRA B;  2IND C;  3PO0 A;  4WJO A;  1WMH A;  5D7G A;  2JYT A;  2LXA A;  4KIK A;  1FFV A;  1WF9 A;  4IM2 A;  1OFF A;  3U7D A;  3NOB A;  2WDQ B;  3ZNG C;  2WXJ A;  4C4V B;  3R7R A;  2NTS A;  3NVV A;  1GJZ A;  3PGE A;  1J19 A;  3DVN V;  2FCS A;  4XR2 A;  3OLM D;  3N9Y C;  3H7P B;  5CHW A;  2M4N A;  3O13 A;  1FRD A;  1N5W A;  1OGW A;  2JRI B;  1B9R A;  3DWG C;  2JXX A;  3NS1 A;  3EI3 A;  3U52 E;  2MJD A;  2AWT A;  3RI7 C;  1MFW A;  2PW9 A;  3UI3 A;  2NMQ A;  2WQY B;  1CQV A;  2LJ5 A;  4K3B A;  1L2N A;  2IYD B;  2W9N A;  2N1W A;  1E10 A;  3HM3 A;  2IGD A;  1XO3 A;  2KAN A;  2FUH B;  2K9X A;  5LNK 1;  2ON8 A;  3BYY B;  2KAJ A;  1NEK B;  2BF8 B;  4ANX A;  3P4R B;  1T3Q A;  1GUA B;  2RMM A;  3Q6B A;  3GB1 A;  4MDK E;  4MJS B;  1XLO A;  4LNK A;  4FN2 A;  4HPP A;  1ZE3 D;  3AE5 B;  4DHJ B;  3DBR B;  4FUL A;  1V7O A;  1HQR D;  2CHW A;  4JPS A;  2L0F A;  1WRD B;  3VUX A;  2MBB B;  3PT2 B;  2KWU B;  3B1L X;  4FJV B;  2DAJ A;  1JCK B;  2E6X A;  2BKR B;  3I7L A;  3BY4 B;  2MJE A;  4A55 A;  4PS7 A;  4JQW C;  1WXQ A;  4RGO S;  1QKZ A;  4KIK B;  1RWS A;  3VDZ A;  1NVI D;  3ZTW A;  4NNJ B;  2Y3U A;  4XE0 A;  3QAQ A;  1IP9 A;  2E3T A;  4EE2 A;  2ZZE A;  4IDI A;  2DZI A;  1XXG A;  2WYQ A;  3V61 A;  1VJK A;  4NJ7 A;  5G5H A;  1F52 A;  2GBN A;  1AAR A;  1KF6 B;  2CHX A;  2PEA A;  1N62 A;  2SEB D;  2W82 A;  2D07 B;  1DOI A;  1K53 A;  1VZ6 A;  1GB4 A;  2ONQ A;  1ECR A;  3N1Y C;  3HIZ A;  4BKS D;  1QLB B;  4DQO C;  1WGR A;  3QC8 B;  4YTM B;  2G9H D;  3V05 A;  3M95 A;  2HYE A;  4BKS A;  5FQD A;  3FAH A;  3RT3 B;  2LGS A;  3UIP B;  2MBE A;  1KLV A;  3U30 A;  1I4Q A;  5KHQ A;  2HD5 B;  2PPH A;  2KJH B;  4HCN B;  3VXW A;  4RCO A;  2LD9 A;  2M56 B;  1BML C;  2BWF A;  3L4P A;  2J0K A;  1T0S C;  1HZ6 A;  1YN5 A;  2M17 A;  2EMS A;  5BMI A;  4B6W A;  2WDT B;  2B5M A;  1TIF A;  4NZL B;  4N6E B;  4E71 A;  4D2K A;  1UBQ A;  2N7D A;  2KFK B;  3NZS A;  4TKN A;  2N9P C;  2RPV A;  2BS2 B;  2L7R A;  1OQY A;  2AQ3 B;  1PYW D;  3GE8 C;  2WXP A;  4PYZ A;  2KVZ A;  1Q1O A;  1EM7 A;  2DYO A;  1R4N B;  5IP4 D;  1C4P A;  4AJW A;  2DLB A;  2RDH A;  3AM9 A;  1GG3 A;  4W9I A;  1WZC A;  4KVG B;  2WXF A;  4B95 A;  1XD3 B;  3WA0 A;  1E6E B;  2AX5 A;  2IZV B;  2WXH A;  3Q3J A;  2JX5 A;  3ZXR A;  4W9D A;  1D5M C;  4ARI A;  4M8M A;  3DCG A;  1NYQ A;  1V1P A;  3IBE A;  2N9X A;  3AE1 B;  4HKZ E;  5FKA C;  4AWJ A;  5GXG B;  4OVZ A;  3IT4 B;  3R2I A;  1BXT A;  1K52 A;  1V6E A;  4DXF A;  2BS3 B;  4MGK E;  3NHE B;  4IG7 B;  4B9K A;  4NAW A;  1F77 A;  3A9J A;  2YEP B;  3SU8 X;  2V1Y A;  1EWY C;  4ARF A;  1RM6 C;  1ZUD 2;  1JRO A;  1MI0 A;  1TYG B;  2MJ3 A;  2ASQ A;  1RFK A;  3N20 C;  1I4H A;  1N6Z A;  4HDQ A;  5IA7 A;  1NEN B;  5JXV A;  1C1Y B;  3RNG C;  4MSM B;  5E6N A;  4A90 A;  2KMM A;  3A4S C;  1I35 A;  4O1N A;  1XQQ A;  1GB1 A;  1WGH A;  1FPY A;  4OVU A;  3R8B A;  2O2V A;  1JWB D;  3AUL A;  2WDV B;  2AYO B;  2V3N A;  1E0Z A;  3KWL A;  4ZDV A;  1FM0 D;  2L32 A;  4E5Z A;  3AU5 A;  1JML A;  1R4M B;  1SB3 C;  3VHT C;  3RNB C;  1HA5 A;  4KGS A;  4NJC A;  2L05 A;  4LCD E;  1GOZ A;  3CSF A;  2MQJ A;  2ZPY A;  3WAL A;  3ZRF A;  4TQ1 A;  1FNW A;  3I8C A;  4ANU A;  3LDZ E;  3ZJV A;  1PFD A;  5IO9 A;  1QOA A;  4BKG A;  2BBC A;  2WXL A;  3OG5 A;  3NZ3 A;  3B2F A;  3KVF B;  4KSL C;  4YT0 B;  4JX1 C;  4L2Y A;  2CJN A;  1D4B A;  1WGY A;  4RMA A;  2KD0 A;  1RRB A;  1QOG A;  4WWN A;  1NDD A;  1I4X A;  3H9D A;  3VTU A;  3PLV A;  3NG0 A;  3FC4 A;  2LVP A;  3DVG X;  5LXH A;  3PRZ A;  4NAW B;  5FK9 C;  3B0A A;  4BVU C;  3A9J B;  2K3U A;  1V49 A;  4JE3 B;  4WWO A;  1A70 A;  2KQS A;  4HPM B;  5FR3 A;  4MGI E;  4USA A;  4RF1 A;  1KLU D;  4GIV A;  4RH6 A;  4ANW A;  1SJH D;  4YSX B;  1XLP A;  3AE4 B;  3E0C A;  2DZK A;  1WI0 A;  2QJL A;  3VTW A;  3L17 A;  1XLN A;  1I7H A;  2WXI A;  2LI5 A;  2RR9 A;  4URK A;  4ZHO A;  3AEB B;  4P1C C;  4LNN A;  4MGZ E;  3FKY A;  3ZWK A;  2ZVO A;  4JIO U;  1SGH A;  1EF1 A;  4K3C A;  3HVD A;  1OQR A;  4A20 A;  1LGR A;  2W55 A;  1J8C A;  2PMV A;  3BYT B;  1HTO A;  3TEW A;  3TBL D;  2WX1 A;  3L08 A;  3ZVV A;  3SFD B;  3DQV A;  4BBN C;  5H8Y E;  2Z0E B;  3OAW A;  2XBB C;  1RFA A; 
#chains in the Genus database with same CATH homology
 2AQ2 B;  1T6B X;  2XNA C;  5AUI A;  2YEP F;  4YSZ B;  3C8Y A;  1C79 A;  5BYQ A;  2WXK A;  3BWU D;  3Q8C A;  1I4G A;  3TEZ A;  2OHF A;  2JZP A;  4TQ0 A;  1TS3 A;  2JYE A;  4GLS C;  1SBB B;  2ZZG A;  4N58 A;  1QQR A;  2L52 A;  4XR3 A;  1YN4 A;  4KGT A;  1E9M A;  2Q5W D;  3MFG A;  2JWU A;  2V4I B;  2WXM A;  3VRA B;  1IUE A;  4A0A A;  3I57 A;  3PO0 A;  2BB6 A;  2N9L A;  4XDC A;  5D7G A;  4WIP A;  3AE6 B;  2PVG C;  1LO5 D;  4KX6 B;  2HDE A;  2JYT A;  1FCC C;  1FFV A;  4AS1 A;  2KAC A;  2W3R A;  2PLP A;  2PVO D;  1PDX A;  1JWU D;  1OFF A;  3MJ5 A;  4AQ7 A;  2WDQ B;  4YTN B;  2WXJ A;  4IKG A;  1D6E C;  2EEL A;  3AED B;  3SEB A;  3U2S C;  1V4P A;  3P1M A;  2NTS A;  4A08 A;  1XCQ L;  3NVV A;  1B1Z A;  3EUB 2;  5HI1 A;  2QEJ C;  4XR2 A;  4A0B A;  4XWT A;  1FNV A;  2MH7 A;  3N9Y C;  1EU3 A;  3O13 A;  1IGC A;  1FRD A;  1N5W A;  5G5G A;  1V1P B;  3DWG C;  1Y56 A;  3P63 A;  4IOI E;  3NS1 A;  2WU2 B;  1B9R A;  4LLG M;  2EKI A;  1L0Y B;  3AEF B;  1DOX A;  3U52 E;  3EI3 A;  1YQ4 B;  2MJD A;  4RFB A;  2PW9 A;  2GI9 A;  2OED A;  2QIE B;  4ITK A;  3UI3 A;  1TKY A;  1P7E A;  3OWE B;  2NMQ A;  2WQY B;  1CQV A;  1FRR A;  3RFN A;  3H8H A;  1IBX A;  4NAM A;  1E10 A;  1Q10 A;  1EU4 A;  1SXT A;  1T5X D;  1VLB A;  1UWM A;  2QMT A;  2IGD A;  5BMG A;  2IUT A;  1KTK A;  1XO3 A;  2K9X A;  3IAM 1;  4M0W A;  3I89 A;  5LNK 1;  1HZ5 A;  2ON8 A;  3BYY B;  2KAJ A;  3EI2 A;  2INN E;  1PGB A;  3ZQ4 A;  1TJE A;  2IDY A;  1NEK B;  3BVZ A;  5HG2 A;  3HVZ A;  2M0A A;  3VR8 B;  4HKQ A;  1J7C A;  3I7O A;  1CK1 A;  2FBW B;  3P4R B;  1T3Q A;  3FIL A;  4FXC A;  2RMM A;  2VZK D;  4RGT A;  1N5X A;  3GB1 A;  1YQ3 B;  3MC0 B;  3WCQ A;  2Y6I A;  2J42 A;  4CI2 A;  1XLO A;  3I7H A;  2CJO A;  1TZO A;  4L23 A;  1RYJ A;  1TKE A;  1MHH E;  3BZD B;  4YXD B;  1ZE3 D;  3AE5 B;  3ZJU A;  1V7O A;  2IGH A;  1HQR D;  4JPS A;  2D5G A;  4LTU A;  3AB5 A;  4MT5 A;  3ABV B;  3BVM A;  1XLQ A;  5BMH A;  4US9 A;  1JCK B;  1K51 A;  2E6X A;  1PGA A;  3I7L A;  2LJI A;  2IGG A;  2MJE A;  2B76 B;  4A55 A;  1R7S A;  1VDV A;  4WQM A;  1FD6 A;  4A9A A;  1WXQ A;  2ICI A;  1P7F A;  4HEA 1;  4OZB A;  4RGO S;  4XR1 A;  1QKZ A;  1RWS A;  1JQ4 A;  3W5U B;  1NVI D;  3WQZ A;  4P6V F;  1MHX A;  2N7J A;  1KLG D;  1F2R C;  2Y3U A;  4XE0 A;  4GDK B;  3AE3 B;  1IGD A;  2E3T A;  4EE2 A;  1C4C A;  2I05 A;  2Z8L A;  5TSS A;  2ZZE A;  3AN1 A;  4IDI A;  2GB1 A;  1XXG A;  1FEH A;  3LB8 C;  2LFI A;  4PT5 A;  1VJK A;  2PIA A;  4CI3 A;  1M4V A;  3AE2 B;  5G5H A;  3AEG B;  1ACC A;  1ZDV A;  1KF6 B;  3R2T A;  2RDG A;  1JW9 D;  2H89 B;  1N62 A;  2IUU A;  2SEB D;  2W82 A;  1KH0 A;  4R3D A;  1CZP A;  2X38 A;  2ACZ B;  3W1S A;  2JQR B;  1DOI A;  5D3I B;  5H92 C;  5BYR A;  1K53 A;  1VZ6 A;  3P4S B;  2K0P A;  1GB4 A;  2G1E A;  3B9J A;  1YNT E;  2W3S A;  3BK2 A;  1JWS D;  1XCT L;  4WWM A;  5MPO A;  2KDM A;  4REZ A;  1STE A;  2ONQ A;  1ECR A;  1DGJ A;  4A8X C;  2ZZF A;  4XR0 A;  2V3P A;  1QLB B;  4DQO C;  3Q8F A;  4YTM B;  4KKI A;  3IAS 1;  3RFZ B;  2G9H D;  2PKO A;  3V05 A;  2M19 A;  1DOY A;  1TS4 A;  2LHD A;  5AUK A;  2HYE A;  3FIL B;  1SF0 A;  3I9V 1;  2DYM A;  1GPX A;  5FQD A;  2BYT A;  3FAH A;  4YSY B;  2WXQ A;  4A09 A;  3SR6 A;  1L0V B;  2VZK B;  1I4Q A;  2Y5C A;  1EWC A;  2WLB A;  2WXN A;  1N63 A;  2NTT A;  3EI4 A;  1QT9 A;  3ZJT A;  2AQ1 B;  2MEK A;  1SE4 A;  2BW2 A;  3AH7 A;  4UDU C;  4RCO A;  1C78 A;  2M56 B;  1VRA B;  4Q2J A;  1L6V A;  3BVG A;  1BML C;  1N61 A;  3IT6 B;  3L4P A;  3B2G A;  3W9C B;  1SIJ A;  1ESF A;  2DBY A;  1FNU A;  1HZ6 A;  1YN5 A;  4XWW A;  5BMI A;  4HRS A;  4WH4 A;  1C9F A;  2B5M A;  3U7Z A;  4NZL B;  1AW7 A;  4JWS C;  4N6E B;  3ZGZ A;  4D2K A;  2K22 A;  1WWT A;  3CWI A;  2J53 A;  2RPV A;  3GS2 A;  1ROE A;  4ZRQ A;  2BS2 B;  3NVZ A;  1XEE A;  3MP9 A;  4YTP B;  3KEW A;  2KN4 A;  2LUM A;  4AR8 A;  1NI3 A;  2N9K A;  2AQ3 B;  3AEE B;  3KQ4 A;  1PYW D;  2XN9 C;  3LYY A;  1VR9 A;  1ENF A;  1FXA A;  4US8 A;  2Y3A A;  1F0Z A;  2WXP A;  5HHD G;  4MH8 A;  3AEA B;  1C76 A;  3Q69 A;  4OZC A;  5EE3 A;  1FO4 A;  1PGX A;  2EWJ A;  3AEC B;  1ZXI A;  4MM3 B;  4HRO A;  2IUS A;  1JWA D;  2INP E;  4AR9 A;  3I7K A;  1WSP A;  3VQI A;  1FFU A;  3P4P B;  1EM7 A;  2DYO A;  1DYQ A;  1C4P A;  4P16 A;  4ARE A;  2DLB A;  2RDH A;  3AM9 A;  4GDL B;  1MVK A;  1QOF A;  2WXF A;  3KLS X;  3Q8E A;  2J52 A;  4A11 A;  1KRH A;  2WXO A;  4ZOH C;  1E6E B;  1NYR A;  2AX5 A;  3TEY A;  1QF6 A;  2WXH A;  4C80 A;  2JX5 A;  3MHZ A;  4RGM A;  2PTL A;  2H88 B;  1D5M C;  1WXO A;  3W5V B;  1JAL A;  4ARI A;  3TSS A;  4RNA A;  4E54 A;  1NYQ A;  1V1P A;  5HFY A;  3AE1 B;  4ZHP A;  4HKZ E;  5FKA C;  4CI1 A;  5GXG B;  4N59 A;  1FCL A;  2LHE A;  4WAF A;  4OVZ A;  3IT4 B;  1V1O A;  2W54 A;  3EGR A;  3R2I A;  1BXT A;  1K52 A;  1D5X C;  1ZDX A;  4DXF A;  2BTE A;  2BS3 B;  1GAQ B;  1HEZ E;  4JWU C;  1L6U A;  4ZYS A;  2Y5P A;  1C4A A;  3ZYY X;  1TKG A;  3AV8 A;  3IXS A;  4B0M A;  1F77 A;  1AYF A;  5BYS A;  3Q8B A;  3VR9 B;  2YEP B;  3E9S A;  3NVW A;  1EWY C;  3EI1 A;  2SAK A;  3BII D;  1IBX B;  3HRD D;  2WXR A;  2LEK A;  4ARF A;  1RM6 C;  1ZUD 2;  3J9C A;  1JRO A;  1MI0 A;  4DXG A;  1TYG B;  1UWX A;  1YN3 A;  2MJ3 A;  3AMZ A;  2I2Y A;  1RFK A;  5E6J A;  3RHU A;  1I4H A;  4TSS A;  1WNU A;  1SE2 A;  1WRI A;  3DWM A;  3PZ7 A;  3CIR B;  1NEN B;  3AE8 B;  5JXV A;  2BS4 B;  4A6Q A;  1UNS A;  3TEX A;  1TS2 A;  1TY0 A;  1YJJ A;  4A90 A;  4C7Z A;  3I8E A;  2KMM A;  2I38 A;  4O1N A;  1GB1 A;  2TSS A;  1YJI A;  1JRP A;  1ZPS A;  2L83 A;  1F2R I;  1CJE A;  3NVY A;  1L0X B;  1YMH E;  1L5P A;  3R8B A;  1JWB D;  2WDV B;  4OZA A;  2WP9 B;  2V3N A;  3SFE B;  5T8I A;  3AE9 B;  4YWG G;  4B0E A;  1ET9 A;  1E0Z A;  1J7A A;  3KWL A;  1FM0 D;  1WGK A;  2L32 A;  2FUG 1;  2WU5 B;  4E5Z A;  1L4Z B;  3W2D A;  2I06 A;  1JML A;  3NUH B;  1SB3 C;  3I7N A;  1VZ7 A;  3LXF A;  1HA5 A;  4KGS A;  1SE3 A;  4NJC A;  2BB5 A;  2DWQ A;  3VRB B;  2V0G A;  3HUI A;  2FE8 A;  1GOZ A;  2J4X A;  4TQ1 A;  1FNW A;  5EE9 A;  1XF5 L;  3I8C A;  2K5P A;  3ZJV A;  1PFD A;  2N0S B;  2QIL A;  4LK0 M;  1QOA A;  1BUI C;  3NRZ A;  1ZP0 B;  2BBC A;  2CU3 A;  2BT6 A;  2WXL A;  1MPE A;  2JU6 X;  3NZ3 A;  3B2F A;  1AN8 A;  2LMC A;  3Q8A A;  1I4R A;  4YT0 B;  4JX1 C;  4L2Y A;  4L1B A;  2CJN A;  2ZTG A;  3T3O A;  4CQN A;  2IPK D;  5C2T B;  1VZ8 A;  1D4B A;  1QOG A;  4OW0 A;  1KFY B;  2IJ0 A;  1I4X A;  3U4E G;  4ZRP A;  1K50 A;  1E7P B;  4WUR A;  3FC4 A;  3T3N A;  4NAW B;  1QIL A;  5FK9 C;  3PZ8 A;  2K3U A;  1QOB A;  4JE3 B;  1A70 A;  4KGR A;  3BK1 A;  5FR3 A;  4AR1 A;  2WS3 B;  4USA A;  4RF1 A;  1KLU D;  4H2A A;  4RGN A;  4RH6 A;  4OHJ A;  1SJH D;  1AWD A;  4YSX B;  1XLP A;  1L4D B;  3URY A;  3I7P A;  4RF0 A;  3AE4 B;  5I4D A;  3P4Q B;  3E0C A;  1SSN A;  1WYG A;  2QJL A;  2WXG A;  1V97 A;  1XLN A;  1I7H A;  1PUT A;  4ARC A;  2WXI A;  3EA6 A;  3RPF C;  2HTM E;  2L1A A;  1HXY D;  4ZHO A;  4MAC A;  3AEB B;  2ZW0 A;  1SJE D;  1N60 A;  5D3D A;  3P42 A;  4HJG E;  2KWD A;  1FXI A;  2GRI A;  3ETR A;  1ET6 A;  1SEB D;  2KQ4 X;  3KWV A;  2QSD A;  5EE1 A;  5EE0 A;  3AE7 B;  4TZ4 A;  4XDD A;  1ZXH A;  3HVD A;  2LGI A;  2WNM A;  1OQR A;  1UUP A;  2WDR B;  1UGJ A;  2W55 A;  4TMA B;  2PMV A;  1FMA D;  3BYT B;  1OQQ A;  3TEW A;  4J3O D;  2B5L A;  2Y50 A;  1JWM D;  2ZW1 A;  4KKJ A;  2R61 A;  1TS5 A;  1J7B A;  3SFD B;  1I4P A;  1D5Z C;  2JXT A;  4C7Y A;  5C3J B;  1ZOY B;  1TY2 A;  2JSV X;  3E56 A;  3V3X A;  1FIQ A;  3TUO A;  4C56 C;  5H8Y E;  2E1B A;  3GP7 A;  1C77 A;  1V8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...