1TKGA

Crystal structure of the editing domain of threonyl-trna synthetase complexed with an analog of seryladenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
b'MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonyl-tRNA synthetase
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tkgA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tkgA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tkgA02
1V4PA 1JW9D 2WQYB 3AEAB 4HROA 1NVID 2QJLA 1WYGA 3VR9B 2K9XA 3P4RB 2JQRB 4WQMA 3FAHA 3AE1B 3NVWA 2W3RA 1IUEA 5H92C 1JRPA 1N63A 1QOFA 2WDQB 5EE1A 3W5VB 3W9CB 2WDRB 3FC4A 5EE3A 4WWMA 3NVZA 1N5WA 2MH7A 5C2TB 4C7ZA 4JWUC 4USAA 1KRHA 5GXGB 1JQ4A 2ZZGA 1XLQA 2L52A 2WU5B 3B2GA 5EE9A 1TJEA 1DGJA 1DOXA 1AYFA 1KFYB 1RWSA 3AN1A 2K22A 2W55A 1YQ4B 4ZHOA 1FFVA 1WGKA 1JWAD 1QF6A 1YJIA 3KWLA 1TKYA 3CWIA 2DBYA 2G1EA 1GPXA 1SB3C 1UWMA 3NVVA 1T3QA 1PFDA 2MJEA 3ETRA 3AEFB 4YXDB 2WDVB 1N62A 3L4PA 3AE8B 1PDXA 4ITKA 1VDVA 1FXIA 1VLBA 4N58A 1J7AA 2DWQA 5EE0A 2MJ3A 4JX1C 4KX6B 1F0ZA 1QOGA 4YT0B 2BS3B 3HVZA 3EUB2 3RPFC 1ZOYB 4A9AA 1FMAD 1J7BA 3P4SB 2M19A 1JALA 1V97A 3DWGC 2Q5WD 3VR8B 1J7CA 1FO4A 2QIEB 4LTUA 3SFEB 1DOYA 2WS3B 2L83A 1OFFA 2MJDA 2ZTGA 2B76B 1E10A 2WP9B 1DOIA 1L6VA 3AEEB 1L0VB 1WRIA 1FXAA 1N61A 1ZP0B 1QOBA 2W54A 3AV8A 3B2FA 3AE2B 3DWMA 4YTNB 1RM6C 5MPOA 2ZZEA 3AEBB 1TKGA 1FIQA 2KAJA 1FRRA 3HUIA 4N59A 2KMMA 2ZZFA 3AE3B 5G5GA 1FFUA 3VRBB 1A70A 1R7SA 1FRDA 1NI3A 3WQZA 4YTPB 1JROA 1XLOA 1GAQB 3AMZA 5AUIA 1V7OA 2E3TA 1EWYC 3AECB 2LEKA 3AE7B 2W3SA 2E1BA 1E9MA 1I7HA 2PIAA 2CJNA 4C7YA 4YSZB 2AX5A 1CJEA 4FXCA 1WXOA 3LXFA 1QLBB 1XLPA 2N0SB 1RFKA 1RYJA 1QOAA 3NRZA 3SR6A 1SF0A 1E6EB 4IDIA 1YJJA 3ABVB 4JWSC 1CZPA 1TYGB 1XLNA 3AE6B 3BIID 1QT9A 2BT6A 3P4QB 3W5UB 3HRDD 3AEGB 3P63A 4ZHPA 3P1MA 2PKOA 4ZOHC 1NYRA 2FBWB 3WCQA 4HRSA 3RHUA 1VJKA 2OHFA 3RFNA 3VRAB 5G5HA 1V8CA 4US9A 1XO3A 2CU3A 1N60A 1NYQA 2ACZB 1WWTA 2EKIA 4N6EB 5H8YE 2WLBA 1ROEA 3AM9A 4YSYB 1OQQA 3CIRB 2Y5CA 1L5PA 1E7PB 1PUTA 1WNUA 2PVGC 2BS4B 1NENB 3NVYA 4C80A 1KF6B 1JWBD 2WU2B 3AE4B 1SIJA 5C3JB 3P4PB 3AE5B 1OQRA 2M56B 1TKEA 1WXQA 2H88B 2K5PA 4YSXB 1AWDA 4P6VF 1E0ZA 3AB5A 4US8A 3LB8C 3PO0A 3NS1A 3AEDB 3AE9B 3SFDB 2H89B 3KEWA 3ZYYX 3B9JA 1L6UA 1FM0D 2BS2B 1B9RA 5AUKA 4YTMB 1YQ3B 2CJOA 3AH7A 1N5XA 1ZXIA 2PVOD 1ZUD2 1NEKB 2JX5A 2HTME
chains in the Genus database with same CATH superfamily
4C4VA 3BK2A 3FAHA 5BMHA 3BVZA 3OAWA 4NAWA 2O2VA 1QKZA 2N9KA 4RGMA 3KUDB 2FUHB 4W9FA 4OW0A 1MG8A 2INCC 1WGRA 3PRPB 2HYEA 3PT2B 1VLBA 1L4DB 2MJ3A 3VAWA 1K53A 4JQWC 2G4DB 1QOGA 4AR1A 1YJ1A 1L0XB 1WZ3A 2K25A 2AEHA 1DOYA 4HPLB 2O6VB 2HJ8A 1P7FA 3L08A 1FXAA 2ZZEA 4XDDA 1Q1OA 1FIQA 2KAJA 2WYQA 3AE3B 1FFUA 4W9IA 2DZKA 1K52A 2WGSA 4EUTA 1T6BX 2N0SB 2FUG1 1SF0A 3WAPA 1IBXA 3PREA 3HRDD 3GZNI 2VH1A 4MJSB 3RHUA 3VRAB 2FIDA 2ZZPB 3PLUA 1UD7A 2EKIA 2J42A 2CHWA 2GI9A 2J0KA 2JZPA 4KDLB 4AJWA 3Q69A 2BBCA 1E8ZA 1MVKA 4MGYE 4IKGA 3DHIC 2N9XA 3AE4B 3ZTDA 3P4PB 2JWZA 2MBQA 4XR0A 1UELA 4HK2A 2YVCA 2WHIA 5TR5A 1WE6A 2BYVE 3UIPB 5IP4D 2EMSA 4JIOU 5D94A 5LNK1 1G6JA 1F77A 1FM0D 3QC8B 3ZW7A 2BW2A 5DCNA 1E8WA 4TMAB 3ZX4A 3VTVA 2A5UA 3Q8CA 4F8CB 4A0BA 1F9JA 4AP4C 3TMPB 1E7VA 4PT5A 5C1ZA 3IG3A 2C7HA 2LUEA 2V3PA 2BKFA 4N9F4 4KV2A 4HCNB 1P7EA 1TKYA 2M1MA 3L54A 5FK9C 3RFZB 2IUSA 4I6LB 3TEXA 2GRIA 1VDVA 4MELA 2VZKB 2LGYA 3ZW3A 3K9PB 1FMAD 2KFJA 2LXAA 1E7UA 4DHJB 3APDA 1OFFA 4ZRJA 2BYEA 1SXTA 4IM2A 4TUUA 4N58A 2LI5A 1WM3A 2RSUA 3AEBB 2BGFA 2IUUA 1DYQA 4JE3B 4GDKB 5CHFA 1FRDA 5AUIA 3DDCB 3L17A 2LEKA 1KTKA 3X0WA 1R4NB 1KM7A 4DQOC 1ACCA 3VDZA 1ET6A 1ISNA 1TYGB 3N1YC 3PGEA 3AU4A 4AQ7A 5FQDA 4GGQA 3RFNA 2PE6B 2NPTB 5HFYA 2O6VA 3H7PB 3DBRB 3PZ8A 3AI5A 3TUOA 2C7NB 1ZPSA 3ZWDA 1WR6E 3R7RA 3SDLC 3U4EG 3VUWA 1YQ3B 1U4AA 2RPQA 1HXYD 3SEBA 1N6ZA 4X57B 3N1ZC 2AYOB 2PLPA 2IJ0A 2JRHA 3NVWA 2D3GA 4MJSA 3RT3B 1N63A 1QOFA 3W5VB 2WDQB 3MFGA 3VH4B 4RF0A 2NBVB 2JWUA 4JLCA 2PE9A 3DQVA 4AOFA 1KFYB 2YEPB 4XX5A 1WGKA 1I4XA 3L10B 4TQ1A 3PPAA 3L4PA 2QCZA 4GLSC 1WXMA 1ZXHA 4GMVA 1YIWA 1MHXA 2KT7A 3CSTA 2QIEB 3EGRA 4HJGE 2MJDA 1EF1A 4RMAA 2KN4A 4CI3A 3HVDA 2CR5A 3R8BA 1FD6A 1L6VA 1ECRA 3C19A 3P2BA 1RM6C 2KJRA 2WX1A 4EKUA 2M8SA 4NJCA 2NTTA 2DHZA 3RNBC 1XLOA 3T9LA 2E1BA 3QJZA 4KVGB 3X23A 1RAXA 4MGIE 2MW5A 4ICVA 2AQ3B 3P4QB 2E6XA 1GJZA 2JPHA 2FCNA 5KHQA 4TSSA 3ZJVA 2WLBA 2WX0A 1HE8A 4EFOA 1SBBB 1JWBD 1TY2A 2KQ4X 2MQJA 1FNVA 1D5MC 3QHTA 4GDKA 1WGYA 5DPSA 1IP9A 4W9CA 4CYEA 1B9RA 3EI4A 3J9CA 2QILA 4MACA 3M3JA 4LCDE 4NZLB 5E6NA 3Q8EA 3VUXA 1JRUA 4I6PA 4KZ0A 4RM9A 3W9CB 3NY5A 5EE3A 4WWMA 3ALBA 4MH8A 3H7PA 2L52A 3NZ3A 2N1WA 4K3BA 4LLGM 1KLVA 2CS4A 1WJ4A 2KWUB 4W9DA 1YX5B 1WGDA 2ZW1A 4AS1A 4RM8A 4XE0A 2PMVA 4CHKA 1V97A 4P1BC 5JZEB 4I6NB 2QHOA 4A8XC 1E10A 3C0RB 4GB9A 4DHZB 3AEEB 3PS6A 1UWXA 3GB1A 3APCA 4B95A 5HHDG 4D2KA 2ZZFA 2RDBC 3NG0A 1QLBB 1I4HA 4E3CA 1Q5WB 3QIJA 1HQRD 2IPKD 2KK8A 2Y50A 4HCPB 2BYFA 3P1MA 2K39A 2KKCA 4US9A 2ACZB 3KWVA 4FJVB 3CIRB 1WNUA 4L23A 2BS4B 2WXMA 5LLIA 5D2MB 1OQRA 2XN9C 4M00A 1E90A 1V86A 2GBMA 1C9FA 1LO5D 2L76A 2R2OA 3BZDB 5IO9A 1ZUD2 2IO1B 1MHHE 4RGNA 2MBEA 3VR9B 1P98A 2IBIB 3RZWC 2V9HA 4K7UA 3NVZA 5C2TB 2O6VD 3RI7C 3U8ZA 2ZZGA 2ZPNA 4K7WA 1C3TA 1DGJA 3IVFA 1RWSA 2AL3A 1FFVA 1JWAD 2HDEA 3A9JA 2DBYA 1UWMA 1LFDA 4MT5A 2MJEA 2ASQA 4YXDB 3ZXVA 3B0AA 3N32A 3MP9A 3EUB2 4AWJA 2SAKA 2KTRB 3I7NA 1SSNA 2VH2A 3V6EB 1V80A 1YNTE 3H1UA 4BVUC 1R4MI 2R2QA 2N7EA 3DWMA 3U7DA 3DHHC 1CMXB 4XYCA 2G45B 1EWYC 1Q10A 2FAZA 3HM3A 4GIVA 3I3TB 4W9GA 4HVBA 3W1SC 4AUQC 1P9DU 1NI2A 2KO3A 2JZ3B 3C8YA 3ECIA 1TIFA 1EWCA 2DAFA 1F1HA 2LWPA 3MHZA 1JWSD 1TS2A 2KLCA 2L1AA 3NHEB 5G5HA 2WXGA 1WWTA 1E7PB 2V3SA 3WIMA 4ARFA 4FJZA 2KTFA 2ZJDA 4GOCA 2M56B 1TKEA 3PRMB 2N7DA 3DCGA 4KKJA 4LJOB 1E0ZA 3LB8C 2KFKB 1D3ZA 2LVOA 2UU7A 1SE3A 1JCKB 1C1YB 4WQOB 2KOXA 3ZTCA 3I63C 4LNNA 1I35A 2IGDA 2DZJA 2RMMA 5AZGA 2WQYB 5G55A 3Q14C 4XR3A 3HIZA 2KZRA 2Y3UA 4DHJD 1MG4A 4JWUC 2K1FA 2MCNB 3GS2A 3ZIMA 3M62B 4ZRKA 3N1XC 1QF6A 1UZXB 3W2DA 4QAYA 3U2SC 2OJWA 1PDXA 5JHBA 3JSVA 3I7OA 4KX6B 3TL5A 5J18A 3KYDD 2JYEA 2Z59B 1T5XD 3SFEB 4EZKA 1VRAB 1VD2A 1I42A 2SEBD 2PTLA 4YTNB 1TKGA 1JWMD 5G5GA 2W9NA 3GE8C 2ONQA 3VFKA 2E3TA 1I7HA 4C7YA 2D5GA 3EC8A 2I2YA 1NDDA 1RFKA 4CQNA 1ESFA 1HEZE 3KVFB 2N7JA 3Q2AC 1CZPA 3BIID 2LJ5A 1AARA 1ENFA 1TBEA 1GNUA 2KTRA 3N3KB 3DVGY 1XXGA 1WRDB 4G3XB 4S0RA 5KHOA 1VZ7A 1KLGD 1X1MA 4M8MA 3QK0A 2WDTB 2MEKA 1K51A 4DHZE 4DWFA 1OEYA 3RNGC 5C3JB 5DPWA 1HZ5A 3H6NA 1WX9A 4GXBA 1BUIC 3ZU6A 1GC6A 3EI2A 2V4IB 4II2B 5JH5C 1WGGA 3I7LA 1H4RA 1L4ZB 4KSLC 2DYMA 2RR9A 2JX5A 2A4ZA 4O1NA 1F2RI 3H8HA 4HROA 1T0QC 3OWEB 1WJNA 3NOBA 1UUPA 1R4NI 2WWZA 1UGMA 1TZOA 1XT9B 1FXTB 4EE2A 4G11A 4HEA1 2GLSA 3NVVA 1PFDA 1WMHB 2KFKA 1E5WA 4TKNA 4Q2JA 2JU6X 3ML8A 3AE8B 3U7ZA 2GBJA 1EU4A 1XEEA 3T3OA 2KDIA 3HVZA 2KJ6A 1WJ6A 3BK1A 2NCNA 1M94A 2BPSA 2IO0B 2JXTA 1WZCA 4A08A 1ZW7A 3V62A 3PZ7A 4REZA 1J0GA 3WQZA 4JL9A 1C79A 2V4LA 2CKHB 4ZYSA 1SE4A 3VHTC 2EKEC 2KC2A 4XR2A 4XDCA 3KYCD 2KMCA 2KDFB 2KYWA 4RFBA 2V1YA 2JVCA 1XQQA 3ZJUA 2IGGA 3ZJTA 1WZ0A 2AL6A 2LVPA 2JRIB 2ZNVC 1RLFA 3NZUA 2H88B 4KSKC 3IHPC 2I1JA 2D3BA 2H89B 4FJYA 1C4AA 3B9JA 3GZNB 3Q3MC 4OHJA 3GP7A 4JPSA 2R61A 4A0AA 4KZCA 4W9EA 4AREA 3WAOA 2JQRB 1STEA 2W3RA 1N5WA 4PYUA 3A33B 5GXGB 1XLQA 2BB6A 3N9YC 4NQLB 4A09A 4RCOA 3U30A 5D7GA 2PPHA 2LGXA 4LNKA 3ZLZA 1PGBA 1YJIA 1ZGUB 4IOIE 2JUOA 1UH6A 1FCLA 1D5ZC 4G50A 4NJ7A 2KLGA 2YLMA 5L95C 1GB1A 1WR1A 2QDFA 1CK1A 2KDEB 2L8JA 4JX1C 4NQKE 5D6JB 5IOIA 4P1CC 3T8MA 5CHWA 2IGHA 3VQIA 2ZTGA 1XCTL 2LGDA 4LDTD 3RCZA 4DDGD 1N61A 1V5TA 1LM8B 4BKSA 2K6DB 2UYZB 4OVZA 3R3MA 4YTPB 3BVMA 2KHWB 4YSZB 4CI1A 4HXDA 1WMHA 2B5MA 5AZHA 1XF5L 3NRZA 1HTQA 2WXPA 1T0RC 1E6EB 4GU2A 3W5UB 4ANVA 4DXGA 1WJUA 5FR3A 3WCQA 1V8CA 3RNCC 1B1ZA 1BXTA 4WWNA 1L5PA 4IC7B 1TZ1A 3I8EA 2KX0A 3JW0X 3UINB 4GN1A 2QMTA 1PQSA 1CQVA 3U52E 5BYRA 2CJOA 3DBHB 1K50A 2I06A 3PLVA 3A1QB 3ZVVA 1T0SC 1AN8A 2M17A 4EEWA 3Q8AA 4KIKB 3FC4A 2WXIA 4C7ZA 1TJEA 2LD9A 2AWTA 3M95A 4HKZE 2AQ1B 4RGOS 3N30A 1YMHE 1I4PA 1C4PA 2MA9B 1GPXA 1Z2MA 2WDVB 3ZKJC 3HM6X 4MM3B 2IZVB 1YX6B 2KDMA 2QEJC 2M19A 2NMQA 2NPTA 2Z0EB 5CTRC 5HG2A 1DOIA 2KQSA 3DBLI 1WF9A 2KVZA 1ZP0B 1QOBA 3DHGC 3AE2B 1MPEA 2WXNA 4ANXA 4E71A 1WSPA 4S17A 5BMGA 3VRBB 3ZTWA 3L13A 4HJKA 3W1SA 3IXSA 4K7SA 2LASA 2MHJA 2EELA 4HPMB 4M02A 2DZMA 3LXFA 3TEZA 1YJJA 3MTNB 3ABVB 1P3QU 2J53A 4K81A 4LK0M 3AE6B 4PK1A 3R7QA 2BT6A 3AU5A 3AEGB 4YWGG 4ZOHC 3ML9A 2GMIC 2I05A 1XO3A 3A4RA 3O65B 2HD5B 4URKA 3NZSA 3ZNZB 4EZLA 4YSYB 2BB5A 2KNBA 2LMCA 2KVRA 2K5PA 1EM7A 3AB5A 5CHVC 4IM0A 3NS1A 3AEDB 1L7YA 5AEKB 3EA6A 2TSSA 2WXKA 2QC8A 4KGSA 4ICUA 5H92C 1E8YA 3E9SA 4B9KA 4ZRQA 2KWVB 2DX5B 3MC9A 4BFRA 3QAQA 1SE9A 4G0NB 1NBFC 3ONSA 3FKYA 5EE9A 3ZNGC 2HTHA 4E74A 4NJ6A 2K22A 3HK0A 2KMAA 2HJ1A 1OEYJ 1SJHD 2Z0DB 4ZDVA 4PS7A 2G1EA 3NS8A 4KDIC 3Q6BA 5G2NA 4HKQA 2VRRB 2MX2A 2M0XA 4F1SA 4WJOA 4FULA 2IDYA 2AQ2B 3VR8B 4FHJA 2DZIA 3A1QA 3KUCB 4MGKE 3RZFA 2ZVNA 2ZNVB 1WH3A 1FEHA 3MJ5A 1C77A 2IY0B 5MPOA 2C7MB 2Y5PA 5JHAA 1FRRA 5HKHA 3SD5A 1A70A 5JXVA 4HLEA 2QSDA 4LNIA 3I8CA 3JYUA 1PGAA 1TS5A 1WXOA 1V1OA 1KH0A 4IDIA 4JWSC 4MM3A 3V6CB 4FHKA 2KXJA 1F2RC 3Q8BA 3L0WB 4HRSA 3ENEA 2FE8A 4DXAB 4DDID 2MRPA 1P1AA 2ON8A 2DYBA 3PHWB 2GBNA 4BKSD 2OJRA 1I4GA 1GG3A 2MSED 4BKTA 3RD2A 4XC2A 1QQRA 3H9DA 2HTME 3PVLA 4ASWC 4HWIB 5LXHA 4GSWA 2LRUA 4NPNA 2Y6IA 2KANA 2N4FA 4W9HA 1PGXA 4XWWA 3I7KA 2G4SA 2MH7A 3BVGA 4M8NA 4C56C 1LGRA 4P16A 1P0RA 2LRWA 5CX3A 2RDHA 2MBBB 3B08A 3CWIA 1Z5SB 3KQ4A 1EU3A 1LXDA 2WNMA 5D3DA 1IYFA 4K1RB 1FXIA 5EE0A 2VZKD 3OJ4B 4BBNC 2L3ZA 2BS3B 1S1QB 4KGTA 3VTUA 2CHZA 5T8IA 2D11A 1JALA 4KGRA 4ZYNA 4LTUA 2MWSB 2LHEA 2PW9A 3PV1A 5DPTA 5J17A 2XBBC 3R2IA 3WA0A 3QX1A 4KKIA 3AV8A 3B2FA 1MJDA 1QZEA 1Y8RC 2IYDB 1YN3A 3RNAC 5D3IB 3AMZA 4B0EA 3UGBB 2W3SA 3I9V1 1L2NA 1BMLC 5AZFA 1CJEA 2CHXA 3QQ8B 4EZJA 2IO3B 2UWQA 2ZW0A 1R4MB 1QT9A 2KACA 3BINA 4M01A 3TIXA 4BBNF 2IY1B 4GDLB 3GOEA 3O13A 1UNSA 3IT6B 3EHVA 3AM9A 3QA8A 1KOTA 3WAMA 1WXQA 2LHDA 3MJWA 4A90A 4OVVA 3KW5B 1GOZA 2KC1A 4XWTA 2BS2B 3TSSA 1WXSA 4ANUA 3BY4B 1H8CA 4TZ4A 5E6PA 4A55A 2X38A 3R66C 1WYGA 3I7HA 1SJED 3OLMD 3PRZA 2RD0A 2WXHA 4FADA 3QWZB 2WDRB 4A20A 4USAA 4J3OD 1Q0WB 1AYFA 2W55A 3H7SA 1C4CA 4ZHOA 1OQYA 3BYTB 3NUHB 1SB3C 3RNEC 3IAM1 2Y5BB 3AEFB 4ITKA 1AW7A 4E54A 4WWOA 1F0ZA 2JZZA 2K3UA 3V61A 2LGSA 4MDKE 3ZQ4A 1FPYA 2L83A 2OOBB 2DLBA 2RGFA 3RYTA 3ZO5B 4MEMA 3S2AA 2J0MA 4P7IA 3HUIA 1D6EC 5C23A 4TV3A 3UQBA 3IAS1 4NNJB 3DBRI 3VUYA 2L05A 5E6OA 5BYQA 4BAXA 2INNE 4BOZB 3UQAA 1V7OA 3AE7B 4FN2A 1WX8A 2C60A 2G3QB 3D32A 1YQBA 4PYZA 1RYJA 4WJPA 2LVQA 2B3AA 2WXJA 2V3NA 4MSMB 4RGTA 1NYRA 3QCAA 5IKCM 3PTFC 3LDZE 1KLUD 3W1YA 4HDOA 1NYQA 4NAMA 3ZWKA 4RH6A 2Y5CA 4W9KA 4B6WA 1SIJA 2CU1A 4FLHA 3GE3C 3QARA 4OZCA 1AWDA 2BKRB 2NR2A 4ZRIA 4DBGA 2M4NA 1SGHA 2NVUI 2B5LA 4WURA 2Z8LA 1RRBA 3E0CA 2PVOD 4DK5A 2K8HA 1XCQL 2RDGA 2BYTA 2RPVA 4IM3A 3DOWA 4WQMA 2N9EB 4CI2A 1IUEA 2FNJB 3CF6E 4GDLA 3TCAA 3KUZA 4JGHB 2GBKA 3Q8FA 1KRHA 3LYYA 4LJPB 2PEAA 3KH0A 2WXLA 4MH0E 3SU8X 4TQ0A 1C76A 3NJTA 3UIOB 2D10A 3KWLA 4XR1A 3VVWB 4L1BA 4II3B 4WAFA 3MC0B 2LUMA 5DPRA 3ETRA 1UGJA 4LNFA 4MSQB 2MBOA 2NBUA 5IA7A 2L0FA 4YT0B 5J2RA 2HE7A 1EF5A 3ZTYA 2Q5WD 3TEWA 2BWES 4AJYB 1L0VB 2BWFA 1WX7A 3DBHI 5BMIA 2J52A 2M0AA 1GUAB 3CMMB 1R7SA 2L32A 1NI3A 1GC7A 1TS4A 1BT0A 2REXA 4C00A 3RNFC 4A3PA 2G9HD 2AX5A 4W9LA 1QOAA 1T0YA 3I89A 1TS3A 3Q3JA 3TBLD 4YL8A 3P63A 4ZHPA 4M0WB 1WXVA 2J7QB 3T3NA 3LJ3A 3V05A 1V49A 2Y3AA 3TEYA 2ZEQA 2CU3A 2DYOA 5H8YE 1OQQA 3EFCA 3RMKC 3NVYA 1WY8A 2D07B 2DNFA 4US8A 3PO0A 3SFDB 3DPDA 1VZ8A 2L0TA 3KEWA 3WANA 3DVNU 4L2YA 3RULA 4RF1A 3K9OB 1A5RA 1V5OA 4HDQA 4B0MA 1L0YB 2K6QA 4EOYA 1I4RA 3I5JC 1D4BA 3UF8A 2LZ6A 4A11A 3AE1B 4J6IA 3R2TA 3E56A 1WI0A 2DENB 1GB4A 3EI3A 2WU5B 1IGCA 1EO6A 3OG5A 2ZPYA 1I4QA 1SIFA 3I7PA 2N9LA 4WAAA 5FKAC 1RFAA 1ET9A 2MP2B 1N62A 3P42A 1FCCC 5LXIB 3ZDMC 2KQ7A 2K8BA 4A9AA 2FCQA 3P4SB 1JWUD 2ICIA 4IG7B 3UI3A 3EFUA 4FA6A 2KN5A 2B76B 2OEDA 4AR8A 2LJIA 2KX3A 3ZUPA 5BYSA 2NBWB 3A9KB 3L16A 4N59A 4FBJB 2KMMA 2ZCCA 4WJNA 2V0GA 3SHQA 1JMLA 2PJHA 1V1PB 1E9MA 2JSVX 3PZDA 3A9JB 1XLPA 1J8CA 4XZ4A 3PHXB 4OZAA 2X8XX 4MGZE 3RUIB 1VJKA 4CO7A 3M63B 1N60A 4N6EB 3EI1A 3A4SC 3BYYB 2JYTA 1LQBA 4NY0A 3ZUNA 1VR9A 1PUTA 1VCBA 2PVGC 5BO4B 4OZBA 2GB1A 2WU2B 5EDSA 3AE5B 3CSFA 1S3SG 4YSXB 4K3CA 4UDUC 2XK5B 4IW0A 3ZNHB 4F7ZA 3DBSA 3AULA 1F52A 4YTMB 1TT5B 3ZDTA 1SEBD 1Y56A 4BKGA 4A3OA 1J19A 1UBQA 1JW9D 3AEAB 1IPGA 4M0WA 2GBRA 4W9JA 3B2GA 1M4VA 1DOXA 3PSEB 1YQ4B 2WXFA 3ZRFA 2JT4B 4ACFA 2NS5A 1IGDA 5E6JA 2WXRA 2XNAC 3FILB 2LGIA 2EMTA 3MC8A 1J7AA 2DAJA 4WWPA 2D2QA 2I1KA 1YOVB 1TTNA 4IWPA 1UBIA 1ZOYB 3DWGC 2JXXA 3BWUD 1FO4A 1J7CA 3ZX5A 2WP9B 1YN5A 4BOSC 5HI1A 3ZNID 1WXAA 1EUVB 4LDTB 3ZGZA 2K0PA 2KD0A 1C78A 3DVGX 1V2YA 1JROA 1GAQB 2WXQA 1YN4A 3AECB 1WFYA 2CJNA 3APFA 2MP2A 4E5ZA 4FXCA 2ZCBA 3SR6A 1YD8U 4C4VB 1ZDXA 3DBLB 3JSVB 4KIKA 4NAWB 2FBWB 2O2VB 5IAAC 2OHFA 2MLBA 1KJTA 2INPE 3VH3B 4WH4A 2LFIA 3A9KA 4C80A 1WIAA 2XEWA 2D3AA 4P6VF 2KDBA 4ARIA 1FNUA 2KWCA 4AR9A 1V1PA 4IUMB 4ZRPA 1QILA 5AUKA 2FIFA 3AH7A 1N5XA 1ZXIA 4LNOA 2JF5A 3ZRCA 1NEKB 1HTOA 2W54A 3IT4B 4PS8A 1V4PA 1WE7A 1NVID 2QJLA 1MI0A 2K9XA 3P4RB 1OTRB 2N1VA 3Q3NC 3I57A 2GOWA 3WALA 1JRPA 2MBHA 5EE1A 3OJ3A 1JQ4A 2J0JA 3AN1A 5FR6A 2WXOA 2BF8B 1V9JA 1E8XA 2KJHB 2KWDA 5GMVA 3VXWA 4HPPA 1V6EA 3IFWB 4ANWA 1T3QA 1UF0A 2XK5A 4IWQA 1IBXB 4WJQA 4WIPA 3TJPA 2DWQA 4H2AA 1HZ6A 1VZ6A 4PS3A 3RPFC 1J7BA 1V81A 4BZAA 4DXFA 2JY6A 2J4XA 3URYA 4RNAA 2WS3B 3N20C 1MFWA 2I38A 2IUTA 2IO2B 3Q3OC 1WRIA 3AXCA 3MHSD 2INDC 3RN9C 2L00B 2BQQA 2ZOSA 3VTWA 2L7RA 4XGAB 2K8CA 2PIAA 1XD3B 2FCMA 1TGZB 3FILA 1XLNA 3V60A 2C9WB 2BTEA 1XVIA 4OVUA 5L83A 1FNWA 2PKOA 2W82A 3KLSX 1HA5A 3HHMA 3DVNV 5TSSA 1ZKHA 1ROEA 3Q3FA 1WGHA 1NENB 1WYWB 1KF6B 4R3DA 3B1LX 1OGWA 1K8RB 2LXCA 4A6QA 1WM2A 2BVCA 5IN7A 3ZXRA 1PYWD 2D3CA 1D5XC 2EWJA 2FCSA 3AE9B 3JVZX 2N9PC 1SE2A 4ARCA 5I4DA 3ZYYX 1L6UA 3EECA 2YEPF 2ZVOA 1ZE3D 4IWOA 1TY0A 2NTSA 1ZDVA 2C5LC 3V3XA 3IBEA
chains in the Genus database with same CATH topology
2RDGA 2BYTA 4RGNA 2I06A 2RPVA 3VR9B 4WQMA 3BK2A 3FAHA 5BMHA 1IUEA 3BVZA 1AN8A 4CI2A 3Q8AA 1QKZA 3FC4A 2N9KA 4RGMA 3NVZA 2WXIA 5C2TB 4C7ZA 3Q8FA 1KRHA 3LYYA 2ZZGA 4OW0A 1TJEA 1DGJA 1RWSA 2WXLA 4HKZE 4TQ0A 1C76A 1FFVA 2AQ1B 4RGOS 1JWAD 1YMHE 2HDEA 1I4PA 1C4PA 3KWLA 4XR1A 2DBYA 1GPXA 4L1BA 2HYEA 1UWMA 4WAFA 4MT5A 3MC0B 2LUMA 2MJEA 3ETRA 4YXDB 2WDVB 1UGJA 1VLBA 1L4DB 4MM3B 2MJ3A 1K53A 1QOGA 4YT0B 4AR1A 2KDMA 3EUB2 3MP9A 1L0XB 2SAKA 2QEJC 2M19A 2NMQA 2Q5WD 3TEWA 3I7NA 1SSNA 1DOYA 5HG2A 1YNTE 1DOIA 1P7FA 1L0VB 1FXAA 1ZP0B 1QOBA 3DWMA 2ZZEA 3AE2B 4XDDA 1MPEA 5BMIA 2J52A 2WXNA 1FIQA 2KAJA 2M0AA 1WSPA 3AE3B 3VRBB 1FFUA 5BMGA 1R7SA 2L32A 1NI3A 3W1SA 1K52A 1TS4A 1EWYC 1Q10A 3IXSA 2EELA 2G9HD 2AX5A 1T6BX 3LXFA 2N0SB 2FUG1 3TEZA 1QOAA 1SF0A 1IBXA 3C8YA 3I89A 1TS3A 1YJJA 3ABVB 2J53A 1EWCA 4LK0M 3AE6B 2BT6A 3HRDD 3AEGB 4YWGG 3P63A 4ZHPA 3MHZA 4ZOHC 3T3NA 1JWSD 1TS2A 2L1AA 3RHUA 3V05A 2I05A 3VRAB 2Y3AA 3TEYA 5G5HA 1XO3A 2CU3A 2WXGA 2DYOA 2EKIA 1WWTA 2GI9A 2J42A 5H8YE 2JZPA 3Q69A 2BBCA 1OQQA 4YSYB 2BB5A 1MVKA 1E7PB 2LMCA 4ARFA 3NVYA 4IKGA 3AE4B 3P4PB 4XR0A 2M56B 1TKEA 2K5PA 1E0ZA 1EM7A 3AB5A 4KKJA 4US8A 3LB8C 3PO0A 3NS1A 3AEDB 3SFDB 1VZ8A 5LNK1 3KEWA 1SE3A 3EA6A 1F77A 1FM0D 1JCKB 4L2YA 2TSSA 2BW2A 4RF1A 3V3XA 2IGDA 4B0MA 1L0YB 2WXKA 4TMAB 2RMMA 1I4RA 4KGSA 2WQYB 1D4BA 3Q8CA 5H92C 4A11A 4XR3A 3AE1B 3E9SA 3R2TA 4A0BA 3E56A 2Y3UA 4ZRQA 4PT5A 4JWUC 1GB4A 3EI3A 2WU5B 1IGCA 2V3PA 3GS2A 5EE9A 1I4QA 2K22A 3I7PA 2N9LA 5FKAC 1P7EA 1QF6A 1SJHD 1TKYA 1ET9A 2G1EA 3W2DA 5FK9C 3RFZB 2IUSA 4HKQA 1N62A 3P42A 3TEXA 2GRIA 3U2SC 1PDXA 1VDVA 1FCCC 3I7OA 4KX6B 2VZKB 2IDYA 4A9AA 1FMAD 2JYEA 2AQ2B 3P4SB 3VR8B 1T5XD 1JWUD 2ICIA 3SFEB 3UI3A 1OFFA 1VRAB 2B76B 1FEHA 2OEDA 1SXTA 4AR8A 2LJIA 3MJ5A 5BYSA 2SEBD 1C77A 4N58A 5MPOA 2PTLA 4YTNB 3AEBB 1TKGA 2Y5PA 4N59A 1FRRA 2IUUA 2KMMA 1JWMD 1DYQA 5G5GA 4JE3B 4GDKB 1A70A 1FRDA 5JXVA 2V0GA 5AUIA 2ONQA 1JMLA 2E3TA 2LEKA 1KTKA 1V1PB 1E9MA 2JSVX 1I7HA 2QSDA 3I8CA 4C7YA 2D5GA 1MHHE 1PGAA 1TS5A 2I2YA 1WXOA 4DQOC 1XLPA 1ACCA 1RFKA 1V1OA 4CQNA 1ESFA 1HEZE 1KH0A 4IDIA 2N7JA 4JWSC 1ET6A 1CZPA 1TYGB 3BIID 1F2RC 1ENFA 3Q8BA 4OZAA 4AQ7A 5FQDA 4HRSA 1VJKA 3RFNA 1XXGA 2FE8A 1VZ7A 5HFYA 1KLGD 1N60A 3PZ8A 4N6EB 3EI1A 3BYYB 2MEKA 3TUOA 2JYTA 1K51A 1VR9A 1PUTA 2PVGC 4OZBA 2ON8A 2GB1A 2WU2B 5C3JB 3AE5B 1ZPSA 1HZ5A 4YSXB 1I4GA 4UDUC 1BUIC 3U4EG 3EI2A 2V4IB 1QQRA 4YTMB 1YQ3B 1SEBD 3I7LA 1L4ZB 1Y56A 2DYMA 2JX5A 2HTME 1HXYD 3SEBA 1JW9D 1F2RI 3AEAB 4O1NA 3H8HA 4HROA 2PLPA 3OWEB 2Y6IA 1UUPA 2IJ0A 3NVWA 4M0WA 1N63A 1QOFA 3W5VB 2WDQB 1PGXA 3MFGA 1TZOA 4XWWA 3I7KA 4RF0A 2MH7A 3BVGA 2JWUA 4C56C 3B2GA 4EE2A 1M4VA 4P16A 1DOXA 1KFYB 2YEPB 1YQ4B 1WGKA 2RDHA 4HEA1 2WXFA 1I4XA 3CWIA 4TQ1A 1IGDA 3NVVA 3KQ4A 5E6JA 2WXRA 1PFDA 1EU3A 2XNAC 3FILB 4Q2JA 2WNMA 2LGIA 2JU6X 5D3DA 3L4PA 3AE8B 1FXIA 5EE0A 2VZKD 1J7AA 3U7ZA 4GLSC 1EU4A 1XEEA 1ZXHA 3T3OA 2BS3B 3HVZA 4KGTA 1ZOYB 5T8IA 1MHXA 3BK1A 1JALA 3DWGC 4KGRA 3BWUD 1FO4A 1J7CA 2QIEB 3EGRA 4HJGE 4LTUA 2MJDA 2LHEA 2JXTA 2KN4A 3HVDA 4CI3A 2PW9A 4A08A 2WP9B 1YN5A 3R2IA 4KKIA 3R8BA 5HI1A 1FD6A 1L6VA 1ECRA 3ZGZA 3AV8A 3B2FA 2K0PA 1RM6C 3PZ7A 4REZA 1C78A 1YN3A 4NJCA 3WQZA 2NTTA 1JROA 1XLOA 1GAQB 2WXQA 3AMZA 5D3IB 1YN4A 4B0EA 3AECB 1C79A 2W3SA 2E1BA 3I9V1 2CJNA 1BMLC 4ZYSA 1SE4A 4E5ZA 1CJEA 4FXCA 3SR6A 4XR2A 4XDCA 2ZW0A 1QT9A 1ZDXA 2KACA 2AQ3B 3P4QB 2E6XA 4RFBA 4GDLB 4NAWB 2FBWB 2OHFA 2INPE 4TSSA 3ZJVA 3O13A 1UNSA 2IGGA 3IT6B 3ZJUA 2WLBA 3ZJTA 3AM9A 4WH4A 2LFIA 1SBBB 4C80A 1JWBD 1TY2A 2KQ4X 1FNVA 1WXQA 2LHDA 4A90A 2H88B 1D5MC 4P6VF 4ARIA 1GOZA 2H89B 1FNUA 4AR9A 4XWTA 1C4AA 1V1PA 3B9JA 4ZRPA 1B9RA 1QILA 2BS2B 4OHJA 3EI4A 5AUKA 3GP7A 3J9CA 4JPSA 2QILA 4MACA 2R61A 3TSSA 3AH7A 1N5XA 1ZXIA 4A0AA 1NEKB 4AREA 2W54A 3IT4B 1V4PA 4TZ4A 4A55A 2X38A 1NVID 2QJLA 1MI0A 1WYGA 3I7HA 2K9XA 3P4RB 2JQRB 4NZLB 3Q8EA 1SJED 1STEA 2W3RA 3I57A 1JRPA 2WXHA 5EE1A 3W9CB 2WDRB 5EE3A 4WWMA 4MH8A 1N5WA 4USAA 5GXGB 1JQ4A 4J3OD 1XLQA 2BB6A 2L52A 3N9YC 3NZ3A 4A09A 1AYFA 3AN1A 4RCOA 2W55A 2WXOA 1C4CA 5D7GA 4ZHOA 1PGBA 1YJIA 2KWDA 3BYTB 4IOIE 3NUHB 4LLGM 1SB3C 1T3QA 1FCLA 3IAM1 1D5ZC 3AEFB 1IBXB 4ITKA 1GB1A 2ZW1A 4AS1A 4WIPA 2DWQA 1AW7A 4JX1C 4XE0A 1CK1A 4E54A 4H2AA 1F0ZA 1HZ6A 1VZ6A 2K3UA 2PMVA 3RPFC 3ZQ4A 1J7BA 4DXFA 2J4XA 1V97A 3URYA 4RNAA 2WS3B 2IGHA 2L83A 3VQIA 4A8XC 2ZTGA 1XCTL 1E10A 2I38A 2DLBA 2IUTA 3AEEB 1UWXA 1N61A 1WRIA 3GB1A 5HHDG 4D2KA 3HUIA 1D6EC 2ZZFA 4OVZA 3IAS1 5BYQA 4YTPB 2INNE 3BVMA 1V7OA 3AE7B 4YSZB 2PIAA 4CI1A 1QLBB 1I4HA 1RYJA 1XF5L 3FILA 3NRZA 2B5MA 2WXPA 1E6EB 1HQRD 2IPKD 2Y50A 1XLNA 2BTEA 3W5UB 4DXGA 2WXJA 2V3NA 3P1MA 1FNWA 2PKOA 2W82A 4RGTA 1NYRA 5FR3A 3KLSX 3WCQA 1KLUD 1HA5A 1V8CA 4US9A 5TSSA 1NYQA 2ACZB 4NAMA 3KWVA 1B1ZA 1ROEA 4RH6A 1BXTA 3CIRB 2Y5CA 1L5PA 1WNUA 4L23A 2BS4B 2WXMA 1NENB 4R3DA 1KF6B 3I8EA 1SIJA 4A6QA 1OQRA 2XN9C 2QMTA 4OZCA 1CQVA 1PYWD 3U52E 1AWDA 1D5XC 2EWJA 3AE9B 2B5LA 1SE2A 1C9FA 4ARCA 5I4DA 3ZYYX 1L6UA 4WURA 1LO5D 2YEPF 2Z8LA 1ZE3D 5BYRA 1TY0A 2CJOA 3BZDB 3E0CA 2PVOD 2NTSA 1ZUD2 1ZDVA 1K50A 1XCQL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V4P A;  1JW9 D;  2WQY B;  3AEA B;  4HRO A;  1NVI D;  2QJL A;  1WYG A;  3VR9 B;  2K9X A;  3P4R B;  2JQR B;  4WQM A;  3FAH A;  3AE1 B;  3NVW A;  2W3R A;  1IUE A;  5H92 C;  1JRP A;  1N63 A;  1QOF A;  2WDQ B;  5EE1 A;  3W5V B;  3W9C B;  2WDR B;  3FC4 A;  5EE3 A;  4WWM A;  3NVZ A;  1N5W A;  2MH7 A;  5C2T B;  4C7Z A;  4JWU C;  4USA A;  1KRH A;  5GXG B;  1JQ4 A;  2ZZG A;  1XLQ A;  2L52 A;  2WU5 B;  3B2G A;  5EE9 A;  1TJE A;  1DGJ A;  1DOX A;  1AYF A;  1KFY B;  1RWS A;  3AN1 A;  2K22 A;  2W55 A;  1YQ4 B;  4ZHO A;  1FFV A;  1WGK A;  1JWA D;  1QF6 A;  1YJI A;  3KWL A;  1TKY A;  3CWI A;  2DBY A;  2G1E A;  1GPX A;  1SB3 C;  1UWM A;  3NVV A;  1T3Q A;  1PFD A;  2MJE A;  3ETR A;  3AEF B;  4YXD B;  2WDV B;  1N62 A;  3L4P A;  3AE8 B;  1PDX A;  4ITK A;  1VDV A;  1FXI A;  1VLB A;  4N58 A;  1J7A A;  2DWQ A;  5EE0 A;  2MJ3 A;  4JX1 C;  4KX6 B;  1F0Z A;  1QOG A;  4YT0 B;  2BS3 B;  3HVZ A;  3EUB 2;  3RPF C;  1ZOY B;  4A9A A;  1FMA D;  1J7B A;  3P4S B;  2M19 A;  1JAL A;  1V97 A;  3DWG C;  2Q5W D;  3VR8 B;  1J7C A;  1FO4 A;  2QIE B;  4LTU A;  3SFE B;  1DOY A;  2WS3 B;  2L83 A;  1OFF A;  2MJD A;  2ZTG A;  2B76 B;  1E10 A;  2WP9 B;  1DOI A;  1L6V A;  3AEE B;  1L0V B;  1WRI A;  1FXA A;  1N61 A;  1ZP0 B;  1QOB A;  2W54 A;  3AV8 A;  3B2F A;  3AE2 B;  3DWM A;  4YTN B;  1RM6 C;  5MPO A;  2ZZE A;  3AEB B;  1TKG A;  1FIQ A;  2KAJ A;  1FRR A;  3HUI A;  4N59 A;  2KMM A;  2ZZF A;  3AE3 B;  5G5G A;  1FFU A;  3VRB B;  1A70 A;  1R7S A;  1FRD A;  1NI3 A;  3WQZ A;  4YTP B;  1JRO A;  1XLO A;  1GAQ B;  3AMZ A;  5AUI A;  1V7O A;  2E3T A;  1EWY C;  3AEC B;  2LEK A;  3AE7 B;  2W3S A;  2E1B A;  1E9M A;  1I7H A;  2PIA A;  2CJN A;  4C7Y A;  4YSZ B;  2AX5 A;  1CJE A;  4FXC A;  1WXO A;  3LXF A;  1QLB B;  1XLP A;  2N0S B;  1RFK A;  1RYJ A;  1QOA A;  3NRZ A;  3SR6 A;  1SF0 A;  1E6E B;  4IDI A;  1YJJ A;  3ABV B;  4JWS C;  1CZP A;  1TYG B;  1XLN A;  3AE6 B;  3BII D;  1QT9 A;  2BT6 A;  3P4Q B;  3W5U B;  3HRD D;  3AEG B;  3P63 A;  4ZHP A;  3P1M A;  2PKO A;  4ZOH C;  1NYR A;  2FBW B;  3WCQ A;  4HRS A;  3RHU A;  1VJK A;  2OHF A;  3RFN A;  3VRA B;  5G5H A;  1V8C A;  4US9 A;  1XO3 A;  2CU3 A;  1N60 A;  1NYQ A;  2ACZ B;  1WWT A;  2EKI A;  4N6E B;  5H8Y E;  2WLB A;  1ROE A;  3AM9 A;  4YSY B;  1OQQ A;  3CIR B;  2Y5C A;  1L5P A;  1E7P B;  1PUT A;  1WNU A;  2PVG C;  2BS4 B;  1NEN B;  3NVY A;  4C80 A;  1KF6 B;  1JWB D;  2WU2 B;  3AE4 B;  1SIJ A;  5C3J B;  3P4P B;  3AE5 B;  1OQR A;  2M56 B;  1TKE A;  1WXQ A;  2H88 B;  2K5P A;  4YSX B;  1AWD A;  4P6V F;  1E0Z A;  3AB5 A;  4US8 A;  3LB8 C;  3PO0 A;  3NS1 A;  3AED B;  3AE9 B;  3SFD B;  2H89 B;  3KEW A;  3ZYY X;  3B9J A;  1L6U A;  1FM0 D;  2BS2 B;  1B9R A;  5AUK A;  4YTM B;  1YQ3 B;  2CJO A;  3AH7 A;  1N5X A;  1ZXI A;  2PVO D;  1ZUD 2;  1NEK B;  2JX5 A;  2HTM E; 
#chains in the Genus database with same CATH topology
 4C4V A;  3BK2 A;  3FAH A;  5BMH A;  3BVZ A;  3OAW A;  4NAW A;  2O2V A;  1QKZ A;  2N9K A;  4RGM A;  3KUD B;  2FUH B;  4W9F A;  4OW0 A;  1MG8 A;  2INC C;  1WGR A;  3PRP B;  2HYE A;  3PT2 B;  1VLB A;  1L4D B;  2MJ3 A;  3VAW A;  1K53 A;  4JQW C;  2G4D B;  1QOG A;  4AR1 A;  1YJ1 A;  1L0X B;  1WZ3 A;  2K25 A;  2AEH A;  1DOY A;  4HPL B;  2O6V B;  2HJ8 A;  1P7F A;  3L08 A;  1FXA A;  2ZZE A;  4XDD A;  1Q1O A;  1FIQ A;  2KAJ A;  2WYQ A;  3AE3 B;  1FFU A;  4W9I A;  2DZK A;  1K52 A;  2WGS A;  4EUT A;  1T6B X;  2N0S B;  2FUG 1;  1SF0 A;  3WAP A;  1IBX A;  3PRE A;  3HRD D;  3GZN I;  2VH1 A;  4MJS B;  3RHU A;  3VRA B;  2FID A;  2ZZP B;  3PLU A;  1UD7 A;  2EKI A;  2J42 A;  2CHW A;  2GI9 A;  2J0K A;  2JZP A;  4KDL B;  4AJW A;  3Q69 A;  2BBC A;  1E8Z A;  1MVK A;  4MGY E;  4IKG A;  3DHI C;  2N9X A;  3AE4 B;  3ZTD A;  3P4P B;  2JWZ A;  2MBQ A;  4XR0 A;  1UEL A;  4HK2 A;  2YVC A;  2WHI A;  5TR5 A;  1WE6 A;  2BYV E;  3UIP B;  5IP4 D;  2EMS A;  4JIO U;  5D94 A;  5LNK 1;  1G6J A;  1F77 A;  1FM0 D;  3QC8 B;  3ZW7 A;  2BW2 A;  5DCN A;  1E8W A;  4TMA B;  3ZX4 A;  3VTV A;  2A5U A;  3Q8C A;  4F8C B;  4A0B A;  1F9J A;  4AP4 C;  3TMP B;  1E7V A;  4PT5 A;  5C1Z A;  3IG3 A;  2C7H A;  2LUE A;  2V3P A;  2BKF A;  4N9F 4;  4KV2 A;  4HCN B;  1P7E A;  1TKY A;  2M1M A;  3L54 A;  5FK9 C;  3RFZ B;  2IUS A;  4I6L B;  3TEX A;  2GRI A;  1VDV A;  4MEL A;  2VZK B;  2LGY A;  3ZW3 A;  3K9P B;  1FMA D;  2KFJ A;  2LXA A;  1E7U A;  4DHJ B;  3APD A;  1OFF A;  4ZRJ A;  2BYE A;  1SXT A;  4IM2 A;  4TUU A;  4N58 A;  2LI5 A;  1WM3 A;  2RSU A;  3AEB B;  2BGF A;  2IUU A;  1DYQ A;  4JE3 B;  4GDK B;  5CHF A;  1FRD A;  5AUI A;  3DDC B;  3L17 A;  2LEK A;  1KTK A;  3X0W A;  1R4N B;  1KM7 A;  4DQO C;  1ACC A;  3VDZ A;  1ET6 A;  1ISN A;  1TYG B;  3N1Y C;  3PGE A;  3AU4 A;  4AQ7 A;  5FQD A;  4GGQ A;  3RFN A;  2PE6 B;  2NPT B;  5HFY A;  2O6V A;  3H7P B;  3DBR B;  3PZ8 A;  3AI5 A;  3TUO A;  2C7N B;  1ZPS A;  3ZWD A;  1WR6 E;  3R7R A;  3SDL C;  3U4E G;  3VUW A;  1YQ3 B;  1U4A A;  2RPQ A;  1HXY D;  3SEB A;  1N6Z A;  4X57 B;  3N1Z C;  2AYO B;  2PLP A;  2IJ0 A;  2JRH A;  3NVW A;  2D3G A;  4MJS A;  3RT3 B;  1N63 A;  1QOF A;  3W5V B;  2WDQ B;  3MFG A;  3VH4 B;  4RF0 A;  2NBV B;  2JWU A;  4JLC A;  2PE9 A;  3DQV A;  4AOF A;  1KFY B;  2YEP B;  4XX5 A;  1WGK A;  1I4X A;  3L10 B;  4TQ1 A;  3PPA A;  3L4P A;  2QCZ A;  4GLS C;  1WXM A;  1ZXH A;  4GMV A;  1YIW A;  1MHX A;  2KT7 A;  3CST A;  2QIE B;  3EGR A;  4HJG E;  2MJD A;  1EF1 A;  4RMA A;  2KN4 A;  4CI3 A;  3HVD A;  2CR5 A;  3R8B A;  1FD6 A;  1L6V A;  1ECR A;  3C19 A;  3P2B A;  1RM6 C;  2KJR A;  2WX1 A;  4EKU A;  2M8S A;  4NJC A;  2NTT A;  2DHZ A;  3RNB C;  1XLO A;  3T9L A;  2E1B A;  3QJZ A;  4KVG B;  3X23 A;  1RAX A;  4MGI E;  2MW5 A;  4ICV A;  2AQ3 B;  3P4Q B;  2E6X A;  1GJZ A;  2JPH A;  2FCN A;  5KHQ A;  4TSS A;  3ZJV A;  2WLB A;  2WX0 A;  1HE8 A;  4EFO A;  1SBB B;  1JWB D;  1TY2 A;  2KQ4 X;  2MQJ A;  1FNV A;  1D5M C;  3QHT A;  4GDK A;  1WGY A;  5DPS A;  1IP9 A;  4W9C A;  4CYE A;  1B9R A;  3EI4 A;  3J9C A;  2QIL A;  4MAC A;  3M3J A;  4LCD E;  4NZL B;  5E6N A;  3Q8E A;  3VUX A;  1JRU A;  4I6P A;  4KZ0 A;  4RM9 A;  3W9C B;  3NY5 A;  5EE3 A;  4WWM A;  3ALB A;  4MH8 A;  3H7P A;  2L52 A;  3NZ3 A;  2N1W A;  4K3B A;  4LLG M;  1KLV A;  2CS4 A;  1WJ4 A;  2KWU B;  4W9D A;  1YX5 B;  1WGD A;  2ZW1 A;  4AS1 A;  4RM8 A;  4XE0 A;  2PMV A;  4CHK A;  1V97 A;  4P1B C;  5JZE B;  4I6N B;  2QHO A;  4A8X C;  1E10 A;  3C0R B;  4GB9 A;  4DHZ B;  3AEE B;  3PS6 A;  1UWX A;  3GB1 A;  3APC A;  4B95 A;  5HHD G;  4D2K A;  2ZZF A;  2RDB C;  3NG0 A;  1QLB B;  1I4H A;  4E3C A;  1Q5W B;  3QIJ A;  1HQR D;  2IPK D;  2KK8 A;  2Y50 A;  4HCP B;  2BYF A;  3P1M A;  2K39 A;  2KKC A;  4US9 A;  2ACZ B;  3KWV A;  4FJV B;  3CIR B;  1WNU A;  4L23 A;  2BS4 B;  2WXM A;  5LLI A;  5D2M B;  1OQR A;  2XN9 C;  4M00 A;  1E90 A;  1V86 A;  2GBM A;  1C9F A;  1LO5 D;  2L76 A;  2R2O A;  3BZD B;  5IO9 A;  1ZUD 2;  2IO1 B;  1MHH E;  4RGN A;  2MBE A;  3VR9 B;  1P98 A;  2IBI B;  3RZW C;  2V9H A;  4K7U A;  3NVZ A;  5C2T B;  2O6V D;  3RI7 C;  3U8Z A;  2ZZG A;  2ZPN A;  4K7W A;  1C3T A;  1DGJ A;  3IVF A;  1RWS A;  2AL3 A;  1FFV A;  1JWA D;  2HDE A;  3A9J A;  2DBY A;  1UWM A;  1LFD A;  4MT5 A;  2MJE A;  2ASQ A;  4YXD B;  3ZXV A;  3B0A A;  3N32 A;  3MP9 A;  3EUB 2;  4AWJ A;  2SAK A;  2KTR B;  3I7N A;  1SSN A;  2VH2 A;  3V6E B;  1V80 A;  1YNT E;  3H1U A;  4BVU C;  1R4M I;  2R2Q A;  2N7E A;  3DWM A;  3U7D A;  3DHH C;  1CMX B;  4XYC A;  2G45 B;  1EWY C;  1Q10 A;  2FAZ A;  3HM3 A;  4GIV A;  3I3T B;  4W9G A;  4HVB A;  3W1S C;  4AUQ C;  1P9D U;  1NI2 A;  2KO3 A;  2JZ3 B;  3C8Y A;  3ECI A;  1TIF A;  1EWC A;  2DAF A;  1F1H A;  2LWP A;  3MHZ A;  1JWS D;  1TS2 A;  2KLC A;  2L1A A;  3NHE B;  5G5H A;  2WXG A;  1WWT A;  1E7P B;  2V3S A;  3WIM A;  4ARF A;  4FJZ A;  2KTF A;  2ZJD A;  4GOC A;  2M56 B;  1TKE A;  3PRM B;  2N7D A;  3DCG A;  4KKJ A;  4LJO B;  1E0Z A;  3LB8 C;  2KFK B;  1D3Z A;  2LVO A;  2UU7 A;  1SE3 A;  1JCK B;  1C1Y B;  4WQO B;  2KOX A;  3ZTC A;  3I63 C;  4LNN A;  1I35 A;  2IGD A;  2DZJ A;  2RMM A;  5AZG A;  2WQY B;  5G55 A;  3Q14 C;  4XR3 A;  3HIZ A;  2KZR A;  2Y3U A;  4DHJ D;  1MG4 A;  4JWU C;  2K1F A;  2MCN B;  3GS2 A;  3ZIM A;  3M62 B;  4ZRK A;  3N1X C;  1QF6 A;  1UZX B;  3W2D A;  4QAY A;  3U2S C;  2OJW A;  1PDX A;  5JHB A;  3JSV A;  3I7O A;  4KX6 B;  3TL5 A;  5J18 A;  3KYD D;  2JYE A;  2Z59 B;  1T5X D;  3SFE B;  4EZK A;  1VRA B;  1VD2 A;  1I42 A;  2SEB D;  2PTL A;  4YTN B;  1TKG A;  1JWM D;  5G5G A;  2W9N A;  3GE8 C;  2ONQ A;  3VFK A;  2E3T A;  1I7H A;  4C7Y A;  2D5G A;  3EC8 A;  2I2Y A;  1NDD A;  1RFK A;  4CQN A;  1ESF A;  1HEZ E;  3KVF B;  2N7J A;  3Q2A C;  1CZP A;  3BII D;  2LJ5 A;  1AAR A;  1ENF A;  1TBE A;  1GNU A;  2KTR A;  3N3K B;  3DVG Y;  1XXG A;  1WRD B;  4G3X B;  4S0R A;  5KHO A;  1VZ7 A;  1KLG D;  1X1M A;  4M8M A;  3QK0 A;  2WDT B;  2MEK A;  1K51 A;  4DHZ E;  4DWF A;  1OEY A;  3RNG C;  5C3J B;  5DPW A;  1HZ5 A;  3H6N A;  1WX9 A;  4GXB A;  1BUI C;  3ZU6 A;  1GC6 A;  3EI2 A;  2V4I B;  4II2 B;  5JH5 C;  1WGG A;  3I7L A;  1H4R A;  1L4Z B;  4KSL C;  2DYM A;  2RR9 A;  2JX5 A;  2A4Z A;  4O1N A;  1F2R I;  3H8H A;  4HRO A;  1T0Q C;  3OWE B;  1WJN A;  3NOB A;  1UUP A;  1R4N I;  2WWZ A;  1UGM A;  1TZO A;  1XT9 B;  1FXT B;  4EE2 A;  4G11 A;  4HEA 1;  2GLS A;  3NVV A;  1PFD A;  1WMH B;  2KFK A;  1E5W A;  4TKN A;  4Q2J A;  2JU6 X;  3ML8 A;  3AE8 B;  3U7Z A;  2GBJ A;  1EU4 A;  1XEE A;  3T3O A;  2KDI A;  3HVZ A;  2KJ6 A;  1WJ6 A;  3BK1 A;  2NCN A;  1M94 A;  2BPS A;  2IO0 B;  2JXT A;  1WZC A;  4A08 A;  1ZW7 A;  3V62 A;  3PZ7 A;  4REZ A;  1J0G A;  3WQZ A;  4JL9 A;  1C79 A;  2V4L A;  2CKH B;  4ZYS A;  1SE4 A;  3VHT C;  2EKE C;  2KC2 A;  4XR2 A;  4XDC A;  3KYC D;  2KMC A;  2KDF B;  2KYW A;  4RFB A;  2V1Y A;  2JVC A;  1XQQ A;  3ZJU A;  2IGG A;  3ZJT A;  1WZ0 A;  2AL6 A;  2LVP A;  2JRI B;  2ZNV C;  1RLF A;  3NZU A;  2H88 B;  4KSK C;  3IHP C;  2I1J A;  2D3B A;  2H89 B;  4FJY A;  1C4A A;  3B9J A;  3GZN B;  3Q3M C;  4OHJ A;  3GP7 A;  4JPS A;  2R61 A;  4A0A A;  4KZC A;  4W9E A;  4ARE A;  3WAO A;  2JQR B;  1STE A;  2W3R A;  1N5W A;  4PYU A;  3A33 B;  5GXG B;  1XLQ A;  2BB6 A;  3N9Y C;  4NQL B;  4A09 A;  4RCO A;  3U30 A;  5D7G A;  2PPH A;  2LGX A;  4LNK A;  3ZLZ A;  1PGB A;  1YJI A;  1ZGU B;  4IOI E;  2JUO A;  1UH6 A;  1FCL A;  1D5Z C;  4G50 A;  4NJ7 A;  2KLG A;  2YLM A;  5L95 C;  1GB1 A;  1WR1 A;  2QDF A;  1CK1 A;  2KDE B;  2L8J A;  4JX1 C;  4NQK E;  5D6J B;  5IOI A;  4P1C C;  3T8M A;  5CHW A;  2IGH A;  3VQI A;  2ZTG A;  1XCT L;  2LGD A;  4LDT D;  3RCZ A;  4DDG D;  1N61 A;  1V5T A;  1LM8 B;  4BKS A;  2K6D B;  2UYZ B;  4OVZ A;  3R3M A;  4YTP B;  3BVM A;  2KHW B;  4YSZ B;  4CI1 A;  4HXD A;  1WMH A;  2B5M A;  5AZH A;  1XF5 L;  3NRZ A;  1HTQ A;  2WXP A;  1T0R C;  1E6E B;  4GU2 A;  3W5U B;  4ANV A;  4DXG A;  1WJU A;  5FR3 A;  3WCQ A;  1V8C A;  3RNC C;  1B1Z A;  1BXT A;  4WWN A;  1L5P A;  4IC7 B;  1TZ1 A;  3I8E A;  2KX0 A;  3JW0 X;  3UIN B;  4GN1 A;  2QMT A;  1PQS A;  1CQV A;  3U52 E;  5BYR A;  2CJO A;  3DBH B;  1K50 A;  2I06 A;  3PLV A;  3A1Q B;  3ZVV A;  1T0S C;  1AN8 A;  2M17 A;  4EEW A;  3Q8A A;  4KIK B;  3FC4 A;  2WXI A;  4C7Z A;  1TJE A;  2LD9 A;  2AWT A;  3M95 A;  4HKZ E;  2AQ1 B;  4RGO S;  3N30 A;  1YMH E;  1I4P A;  1C4P A;  2MA9 B;  1GPX A;  1Z2M A;  2WDV B;  3ZKJ C;  3HM6 X;  4MM3 B;  2IZV B;  1YX6 B;  2KDM A;  2QEJ C;  2M19 A;  2NMQ A;  2NPT A;  2Z0E B;  5CTR C;  5HG2 A;  1DOI A;  2KQS A;  3DBL I;  1WF9 A;  2KVZ A;  1ZP0 B;  1QOB A;  3DHG C;  3AE2 B;  1MPE A;  2WXN A;  4ANX A;  4E71 A;  1WSP A;  4S17 A;  5BMG A;  3VRB B;  3ZTW A;  3L13 A;  4HJK A;  3W1S A;  3IXS A;  4K7S A;  2LAS A;  2MHJ A;  2EEL A;  4HPM B;  4M02 A;  2DZM A;  3LXF A;  3TEZ A;  1YJJ A;  3MTN B;  3ABV B;  1P3Q U;  2J53 A;  4K81 A;  4LK0 M;  3AE6 B;  4PK1 A;  3R7Q A;  2BT6 A;  3AU5 A;  3AEG B;  4YWG G;  4ZOH C;  3ML9 A;  2GMI C;  2I05 A;  1XO3 A;  3A4R A;  3O65 B;  2HD5 B;  4URK A;  3NZS A;  3ZNZ B;  4EZL A;  4YSY B;  2BB5 A;  2KNB A;  2LMC A;  2KVR A;  2K5P A;  1EM7 A;  3AB5 A;  5CHV C;  4IM0 A;  3NS1 A;  3AED B;  1L7Y A;  5AEK B;  3EA6 A;  2TSS A;  2WXK A;  2QC8 A;  4KGS A;  4ICU A;  5H92 C;  1E8Y A;  3E9S A;  4B9K A;  4ZRQ A;  2KWV B;  2DX5 B;  3MC9 A;  4BFR A;  3QAQ A;  1SE9 A;  4G0N B;  1NBF C;  3ONS A;  3FKY A;  5EE9 A;  3ZNG C;  2HTH A;  4E74 A;  4NJ6 A;  2K22 A;  3HK0 A;  2KMA A;  2HJ1 A;  1OEY J;  1SJH D;  2Z0D B;  4ZDV A;  4PS7 A;  2G1E A;  3NS8 A;  4KDI C;  3Q6B A;  5G2N A;  4HKQ A;  2VRR B;  2MX2 A;  2M0X A;  4F1S A;  4WJO A;  4FUL A;  2IDY A;  2AQ2 B;  3VR8 B;  4FHJ A;  2DZI A;  3A1Q A;  3KUC B;  4MGK E;  3RZF A;  2ZVN A;  2ZNV B;  1WH3 A;  1FEH A;  3MJ5 A;  1C77 A;  2IY0 B;  5MPO A;  2C7M B;  2Y5P A;  5JHA A;  1FRR A;  5HKH A;  3SD5 A;  1A70 A;  5JXV A;  4HLE A;  2QSD A;  4LNI A;  3I8C A;  3JYU A;  1PGA A;  1TS5 A;  1WXO A;  1V1O A;  1KH0 A;  4IDI A;  4JWS C;  4MM3 A;  3V6C B;  4FHK A;  2KXJ A;  1F2R C;  3Q8B A;  3L0W B;  4HRS A;  3ENE A;  2FE8 A;  4DXA B;  4DDI D;  2MRP A;  1P1A A;  2ON8 A;  2DYB A;  3PHW B;  2GBN A;  4BKS D;  2OJR A;  1I4G A;  1GG3 A;  2MSE D;  4BKT A;  3RD2 A;  4XC2 A;  1QQR A;  3H9D A;  2HTM E;  3PVL A;  4ASW C;  4HWI B;  5LXH A;  4GSW A;  2LRU A;  4NPN A;  2Y6I A;  2KAN A;  2N4F A;  4W9H A;  1PGX A;  4XWW A;  3I7K A;  2G4S A;  2MH7 A;  3BVG A;  4M8N A;  4C56 C;  1LGR A;  4P16 A;  1P0R A;  2LRW A;  5CX3 A;  2RDH A;  2MBB B;  3B08 A;  3CWI A;  1Z5S B;  3KQ4 A;  1EU3 A;  1LXD A;  2WNM A;  5D3D A;  1IYF A;  4K1R B;  1FXI A;  5EE0 A;  2VZK D;  3OJ4 B;  4BBN C;  2L3Z A;  2BS3 B;  1S1Q B;  4KGT A;  3VTU A;  2CHZ A;  5T8I A;  2D11 A;  1JAL A;  4KGR A;  4ZYN A;  4LTU A;  2MWS B;  2LHE A;  2PW9 A;  3PV1 A;  5DPT A;  5J17 A;  2XBB C;  3R2I A;  3WA0 A;  3QX1 A;  4KKI A;  3AV8 A;  3B2F A;  1MJD A;  1QZE A;  1Y8R C;  2IYD B;  1YN3 A;  3RNA C;  5D3I B;  3AMZ A;  4B0E A;  3UGB B;  2W3S A;  3I9V 1;  1L2N A;  1BML C;  5AZF A;  1CJE A;  2CHX A;  3QQ8 B;  4EZJ A;  2IO3 B;  2UWQ A;  2ZW0 A;  1R4M B;  1QT9 A;  2KAC A;  3BIN A;  4M01 A;  3TIX A;  4BBN F;  2IY1 B;  4GDL B;  3GOE A;  3O13 A;  1UNS A;  3IT6 B;  3EHV A;  3AM9 A;  3QA8 A;  1KOT A;  3WAM A;  1WXQ A;  2LHD A;  3MJW A;  4A90 A;  4OVV A;  3KW5 B;  1GOZ A;  2KC1 A;  4XWT A;  2BS2 B;  3TSS A;  1WXS A;  4ANU A;  3BY4 B;  1H8C A;  4TZ4 A;  5E6P A;  4A55 A;  2X38 A;  3R66 C;  1WYG A;  3I7H A;  1SJE D;  3OLM D;  3PRZ A;  2RD0 A;  2WXH A;  4FAD A;  3QWZ B;  2WDR B;  4A20 A;  4USA A;  4J3O D;  1Q0W B;  1AYF A;  2W55 A;  3H7S A;  1C4C A;  4ZHO A;  1OQY A;  3BYT B;  3NUH B;  1SB3 C;  3RNE C;  3IAM 1;  2Y5B B;  3AEF B;  4ITK A;  1AW7 A;  4E54 A;  4WWO A;  1F0Z A;  2JZZ A;  2K3U A;  3V61 A;  2LGS A;  4MDK E;  3ZQ4 A;  1FPY A;  2L83 A;  2OOB B;  2DLB A;  2RGF A;  3RYT A;  3ZO5 B;  4MEM A;  3S2A A;  2J0M A;  4P7I A;  3HUI A;  1D6E C;  5C23 A;  4TV3 A;  3UQB A;  3IAS 1;  4NNJ B;  3DBR I;  3VUY A;  2L05 A;  5E6O A;  5BYQ A;  4BAX A;  2INN E;  4BOZ B;  3UQA A;  1V7O A;  3AE7 B;  4FN2 A;  1WX8 A;  2C60 A;  2G3Q B;  3D32 A;  1YQB A;  4PYZ A;  1RYJ A;  4WJP A;  2LVQ A;  2B3A A;  2WXJ A;  2V3N A;  4MSM B;  4RGT A;  1NYR A;  3QCA A;  5IKC M;  3PTF C;  3LDZ E;  1KLU D;  3W1Y A;  4HDO A;  1NYQ A;  4NAM A;  3ZWK A;  4RH6 A;  2Y5C A;  4W9K A;  4B6W A;  1SIJ A;  2CU1 A;  4FLH A;  3GE3 C;  3QAR A;  4OZC A;  1AWD A;  2BKR B;  2NR2 A;  4ZRI A;  4DBG A;  2M4N A;  1SGH A;  2NVU I;  2B5L A;  4WUR A;  2Z8L A;  1RRB A;  3E0C A;  2PVO D;  4DK5 A;  2K8H A;  1XCQ L;  2RDG A;  2BYT A;  2RPV A;  4IM3 A;  3DOW A;  4WQM A;  2N9E B;  4CI2 A;  1IUE A;  2FNJ B;  3CF6 E;  4GDL A;  3TCA A;  3KUZ A;  4JGH B;  2GBK A;  3Q8F A;  1KRH A;  3LYY A;  4LJP B;  2PEA A;  3KH0 A;  2WXL A;  4MH0 E;  3SU8 X;  4TQ0 A;  1C76 A;  3NJT A;  3UIO B;  2D10 A;  3KWL A;  4XR1 A;  3VVW B;  4L1B A;  4II3 B;  4WAF A;  3MC0 B;  2LUM A;  5DPR A;  3ETR A;  1UGJ A;  4LNF A;  4MSQ B;  2MBO A;  2NBU A;  5IA7 A;  2L0F A;  4YT0 B;  5J2R A;  2HE7 A;  1EF5 A;  3ZTY A;  2Q5W D;  3TEW A;  2BWE S;  4AJY B;  1L0V B;  2BWF A;  1WX7 A;  3DBH I;  5BMI A;  2J52 A;  2M0A A;  1GUA B;  3CMM B;  1R7S A;  2L32 A;  1NI3 A;  1GC7 A;  1TS4 A;  1BT0 A;  2REX A;  4C00 A;  3RNF C;  4A3P A;  2G9H D;  2AX5 A;  4W9L A;  1QOA A;  1T0Y A;  3I89 A;  1TS3 A;  3Q3J A;  3TBL D;  4YL8 A;  3P63 A;  4ZHP A;  4M0W B;  1WXV A;  2J7Q B;  3T3N A;  3LJ3 A;  3V05 A;  1V49 A;  2Y3A A;  3TEY A;  2ZEQ A;  2CU3 A;  2DYO A;  5H8Y E;  1OQQ A;  3EFC A;  3RMK C;  3NVY A;  1WY8 A;  2D07 B;  2DNF A;  4US8 A;  3PO0 A;  3SFD B;  3DPD A;  1VZ8 A;  2L0T A;  3KEW A;  3WAN A;  3DVN U;  4L2Y A;  3RUL A;  4RF1 A;  3K9O B;  1A5R A;  1V5O A;  4HDQ A;  4B0M A;  1L0Y B;  2K6Q A;  4EOY A;  1I4R A;  3I5J C;  1D4B A;  3UF8 A;  2LZ6 A;  4A11 A;  3AE1 B;  4J6I A;  3R2T A;  3E56 A;  1WI0 A;  2DEN B;  1GB4 A;  3EI3 A;  2WU5 B;  1IGC A;  1EO6 A;  3OG5 A;  2ZPY A;  1I4Q A;  1SIF A;  3I7P A;  2N9L A;  4WAA A;  5FKA C;  1RFA A;  1ET9 A;  2MP2 B;  1N62 A;  3P42 A;  1FCC C;  5LXI B;  3ZDM C;  2KQ7 A;  2K8B A;  4A9A A;  2FCQ A;  3P4S B;  1JWU D;  2ICI A;  4IG7 B;  3UI3 A;  3EFU A;  4FA6 A;  2KN5 A;  2B76 B;  2OED A;  4AR8 A;  2LJI A;  2KX3 A;  3ZUP A;  5BYS A;  2NBW B;  3A9K B;  3L16 A;  4N59 A;  4FBJ B;  2KMM A;  2ZCC A;  4WJN A;  2V0G A;  3SHQ A;  1JML A;  2PJH A;  1V1P B;  1E9M A;  2JSV X;  3PZD A;  3A9J B;  1XLP A;  1J8C A;  4XZ4 A;  3PHX B;  4OZA A;  2X8X X;  4MGZ E;  3RUI B;  1VJK A;  4CO7 A;  3M63 B;  1N60 A;  4N6E B;  3EI1 A;  3A4S C;  3BYY B;  2JYT A;  1LQB A;  4NY0 A;  3ZUN A;  1VR9 A;  1PUT A;  1VCB A;  2PVG C;  5BO4 B;  4OZB A;  2GB1 A;  2WU2 B;  5EDS A;  3AE5 B;  3CSF A;  1S3S G;  4YSX B;  4K3C A;  4UDU C;  2XK5 B;  4IW0 A;  3ZNH B;  4F7Z A;  3DBS A;  3AUL A;  1F52 A;  4YTM B;  1TT5 B;  3ZDT A;  1SEB D;  1Y56 A;  4BKG A;  4A3O A;  1J19 A;  1UBQ A;  1JW9 D;  3AEA B;  1IPG A;  4M0W A;  2GBR A;  4W9J A;  3B2G A;  1M4V A;  1DOX A;  3PSE B;  1YQ4 B;  2WXF A;  3ZRF A;  2JT4 B;  4ACF A;  2NS5 A;  1IGD A;  5E6J A;  2WXR A;  2XNA C;  3FIL B;  2LGI A;  2EMT A;  3MC8 A;  1J7A A;  2DAJ A;  4WWP A;  2D2Q A;  2I1K A;  1YOV B;  1TTN A;  4IWP A;  1UBI A;  1ZOY B;  3DWG C;  2JXX A;  3BWU D;  1FO4 A;  1J7C A;  3ZX5 A;  2WP9 B;  1YN5 A;  4BOS C;  5HI1 A;  3ZNI D;  1WXA A;  1EUV B;  4LDT B;  3ZGZ A;  2K0P A;  2KD0 A;  1C78 A;  3DVG X;  1V2Y A;  1JRO A;  1GAQ B;  2WXQ A;  1YN4 A;  3AEC B;  1WFY A;  2CJN A;  3APF A;  2MP2 A;  4E5Z A;  4FXC A;  2ZCB A;  3SR6 A;  1YD8 U;  4C4V B;  1ZDX A;  3DBL B;  3JSV B;  4KIK A;  4NAW B;  2FBW B;  2O2V B;  5IAA C;  2OHF A;  2MLB A;  1KJT A;  2INP E;  3VH3 B;  4WH4 A;  2LFI A;  3A9K A;  4C80 A;  1WIA A;  2XEW A;  2D3A A;  4P6V F;  2KDB A;  4ARI A;  1FNU A;  2KWC A;  4AR9 A;  1V1P A;  4IUM B;  4ZRP A;  1QIL A;  5AUK A;  2FIF A;  3AH7 A;  1N5X A;  1ZXI A;  4LNO A;  2JF5 A;  3ZRC A;  1NEK B;  1HTO A;  2W54 A;  3IT4 B;  4PS8 A;  1V4P A;  1WE7 A;  1NVI D;  2QJL A;  1MI0 A;  2K9X A;  3P4R B;  1OTR B;  2N1V A;  3Q3N C;  3I57 A;  2GOW A;  3WAL A;  1JRP A;  2MBH A;  5EE1 A;  3OJ3 A;  1JQ4 A;  2J0J A;  3AN1 A;  5FR6 A;  2WXO A;  2BF8 B;  1V9J A;  1E8X A;  2KJH B;  2KWD A;  5GMV A;  3VXW A;  4HPP A;  1V6E A;  3IFW B;  4ANW A;  1T3Q A;  1UF0 A;  2XK5 A;  4IWQ A;  1IBX B;  4WJQ A;  4WIP A;  3TJP A;  2DWQ A;  4H2A A;  1HZ6 A;  1VZ6 A;  4PS3 A;  3RPF C;  1J7B A;  1V81 A;  4BZA A;  4DXF A;  2JY6 A;  2J4X A;  3URY A;  4RNA A;  2WS3 B;  3N20 C;  1MFW A;  2I38 A;  2IUT A;  2IO2 B;  3Q3O C;  1WRI A;  3AXC A;  3MHS D;  2IND C;  3RN9 C;  2L00 B;  2BQQ A;  2ZOS A;  3VTW A;  2L7R A;  4XGA B;  2K8C A;  2PIA A;  1XD3 B;  2FCM A;  1TGZ B;  3FIL A;  1XLN A;  3V60 A;  2C9W B;  2BTE A;  1XVI A;  4OVU A;  5L83 A;  1FNW A;  2PKO A;  2W82 A;  3KLS X;  1HA5 A;  3HHM A;  3DVN V;  5TSS A;  1ZKH A;  1ROE A;  3Q3F A;  1WGH A;  1NEN B;  1WYW B;  1KF6 B;  4R3D A;  3B1L X;  1OGW A;  1K8R B;  2LXC A;  4A6Q A;  1WM2 A;  2BVC A;  5IN7 A;  3ZXR A;  1PYW D;  2D3C A;  1D5X C;  2EWJ A;  2FCS A;  3AE9 B;  3JVZ X;  2N9P C;  1SE2 A;  4ARC A;  5I4D A;  3ZYY X;  1L6U A;  3EEC A;  2YEP F;  2ZVO A;  1ZE3 D;  4IWO A;  1TY0 A;  2NTS A;  1ZDV A;  2C5L C;  3V3X A;  3IBE A; 
#chains in the Genus database with same CATH homology
 2RDG A;  2BYT A;  4RGN A;  2I06 A;  2RPV A;  3VR9 B;  4WQM A;  3BK2 A;  3FAH A;  5BMH A;  1IUE A;  3BVZ A;  1AN8 A;  4CI2 A;  3Q8A A;  1QKZ A;  3FC4 A;  2N9K A;  4RGM A;  3NVZ A;  2WXI A;  5C2T B;  4C7Z A;  3Q8F A;  1KRH A;  3LYY A;  2ZZG A;  4OW0 A;  1TJE A;  1DGJ A;  1RWS A;  2WXL A;  4HKZ E;  4TQ0 A;  1C76 A;  1FFV A;  2AQ1 B;  4RGO S;  1JWA D;  1YMH E;  2HDE A;  1I4P A;  1C4P A;  3KWL A;  4XR1 A;  2DBY A;  1GPX A;  4L1B A;  2HYE A;  1UWM A;  4WAF A;  4MT5 A;  3MC0 B;  2LUM A;  2MJE A;  3ETR A;  4YXD B;  2WDV B;  1UGJ A;  1VLB A;  1L4D B;  4MM3 B;  2MJ3 A;  1K53 A;  1QOG A;  4YT0 B;  4AR1 A;  2KDM A;  3EUB 2;  3MP9 A;  1L0X B;  2SAK A;  2QEJ C;  2M19 A;  2NMQ A;  2Q5W D;  3TEW A;  3I7N A;  1SSN A;  1DOY A;  5HG2 A;  1YNT E;  1DOI A;  1P7F A;  1L0V B;  1FXA A;  1ZP0 B;  1QOB A;  3DWM A;  2ZZE A;  3AE2 B;  4XDD A;  1MPE A;  5BMI A;  2J52 A;  2WXN A;  1FIQ A;  2KAJ A;  2M0A A;  1WSP A;  3AE3 B;  3VRB B;  1FFU A;  5BMG A;  1R7S A;  2L32 A;  1NI3 A;  3W1S A;  1K52 A;  1TS4 A;  1EWY C;  1Q10 A;  3IXS A;  2EEL A;  2G9H D;  2AX5 A;  1T6B X;  3LXF A;  2N0S B;  2FUG 1;  3TEZ A;  1QOA A;  1SF0 A;  1IBX A;  3C8Y A;  3I89 A;  1TS3 A;  1YJJ A;  3ABV B;  2J53 A;  1EWC A;  4LK0 M;  3AE6 B;  2BT6 A;  3HRD D;  3AEG B;  4YWG G;  3P63 A;  4ZHP A;  3MHZ A;  4ZOH C;  3T3N A;  1JWS D;  1TS2 A;  2L1A A;  3RHU A;  3V05 A;  2I05 A;  3VRA B;  2Y3A A;  3TEY A;  5G5H A;  1XO3 A;  2CU3 A;  2WXG A;  2DYO A;  2EKI A;  1WWT A;  2GI9 A;  2J42 A;  5H8Y E;  2JZP A;  3Q69 A;  2BBC A;  1OQQ A;  4YSY B;  2BB5 A;  1MVK A;  1E7P B;  2LMC A;  4ARF A;  3NVY A;  4IKG A;  3AE4 B;  3P4P B;  4XR0 A;  2M56 B;  1TKE A;  2K5P A;  1E0Z A;  1EM7 A;  3AB5 A;  4KKJ A;  4US8 A;  3LB8 C;  3PO0 A;  3NS1 A;  3AED B;  3SFD B;  1VZ8 A;  5LNK 1;  3KEW A;  1SE3 A;  3EA6 A;  1F77 A;  1FM0 D;  1JCK B;  4L2Y A;  2TSS A;  2BW2 A;  4RF1 A;  3V3X A;  2IGD A;  4B0M A;  1L0Y B;  2WXK A;  4TMA B;  2RMM A;  1I4R A;  4KGS A;  2WQY B;  1D4B A;  3Q8C A;  5H92 C;  4A11 A;  4XR3 A;  3AE1 B;  3E9S A;  3R2T A;  4A0B A;  3E56 A;  2Y3U A;  4ZRQ A;  4PT5 A;  4JWU C;  1GB4 A;  3EI3 A;  2WU5 B;  1IGC A;  2V3P A;  3GS2 A;  5EE9 A;  1I4Q A;  2K22 A;  3I7P A;  2N9L A;  5FKA C;  1P7E A;  1QF6 A;  1SJH D;  1TKY A;  1ET9 A;  2G1E A;  3W2D A;  5FK9 C;  3RFZ B;  2IUS A;  4HKQ A;  1N62 A;  3P42 A;  3TEX A;  2GRI A;  3U2S C;  1PDX A;  1VDV A;  1FCC C;  3I7O A;  4KX6 B;  2VZK B;  2IDY A;  4A9A A;  1FMA D;  2JYE A;  2AQ2 B;  3P4S B;  3VR8 B;  1T5X D;  1JWU D;  2ICI A;  3SFE B;  3UI3 A;  1OFF A;  1VRA B;  2B76 B;  1FEH A;  2OED A;  1SXT A;  4AR8 A;  2LJI A;  3MJ5 A;  5BYS A;  2SEB D;  1C77 A;  4N58 A;  5MPO A;  2PTL A;  4YTN B;  3AEB B;  1TKG A;  2Y5P A;  4N59 A;  1FRR A;  2IUU A;  2KMM A;  1JWM D;  1DYQ A;  5G5G A;  4JE3 B;  4GDK B;  1A70 A;  1FRD A;  5JXV A;  2V0G A;  5AUI A;  2ONQ A;  1JML A;  2E3T A;  2LEK A;  1KTK A;  1V1P B;  1E9M A;  2JSV X;  1I7H A;  2QSD A;  3I8C A;  4C7Y A;  2D5G A;  1MHH E;  1PGA A;  1TS5 A;  2I2Y A;  1WXO A;  4DQO C;  1XLP A;  1ACC A;  1RFK A;  1V1O A;  4CQN A;  1ESF A;  1HEZ E;  1KH0 A;  4IDI A;  2N7J A;  4JWS C;  1ET6 A;  1CZP A;  1TYG B;  3BII D;  1F2R C;  1ENF A;  3Q8B A;  4OZA A;  4AQ7 A;  5FQD A;  4HRS A;  1VJK A;  3RFN A;  1XXG A;  2FE8 A;  1VZ7 A;  5HFY A;  1KLG D;  1N60 A;  3PZ8 A;  4N6E B;  3EI1 A;  3BYY B;  2MEK A;  3TUO A;  2JYT A;  1K51 A;  1VR9 A;  1PUT A;  2PVG C;  4OZB A;  2ON8 A;  2GB1 A;  2WU2 B;  5C3J B;  3AE5 B;  1ZPS A;  1HZ5 A;  4YSX B;  1I4G A;  4UDU C;  1BUI C;  3U4E G;  3EI2 A;  2V4I B;  1QQR A;  4YTM B;  1YQ3 B;  1SEB D;  3I7L A;  1L4Z B;  1Y56 A;  2DYM A;  2JX5 A;  2HTM E;  1HXY D;  3SEB A;  1JW9 D;  1F2R I;  3AEA B;  4O1N A;  3H8H A;  4HRO A;  2PLP A;  3OWE B;  2Y6I A;  1UUP A;  2IJ0 A;  3NVW A;  4M0W A;  1N63 A;  1QOF A;  3W5V B;  2WDQ B;  1PGX A;  3MFG A;  1TZO A;  4XWW A;  3I7K A;  4RF0 A;  2MH7 A;  3BVG A;  2JWU A;  4C56 C;  3B2G A;  4EE2 A;  1M4V A;  4P16 A;  1DOX A;  1KFY B;  2YEP B;  1YQ4 B;  1WGK A;  2RDH A;  4HEA 1;  2WXF A;  1I4X A;  3CWI A;  4TQ1 A;  1IGD A;  3NVV A;  3KQ4 A;  5E6J A;  2WXR A;  1PFD A;  1EU3 A;  2XNA C;  3FIL B;  4Q2J A;  2WNM A;  2LGI A;  2JU6 X;  5D3D A;  3L4P A;  3AE8 B;  1FXI A;  5EE0 A;  2VZK D;  1J7A A;  3U7Z A;  4GLS C;  1EU4 A;  1XEE A;  1ZXH A;  3T3O A;  2BS3 B;  3HVZ A;  4KGT A;  1ZOY B;  5T8I A;  1MHX A;  3BK1 A;  1JAL A;  3DWG C;  4KGR A;  3BWU D;  1FO4 A;  1J7C A;  2QIE B;  3EGR A;  4HJG E;  4LTU A;  2MJD A;  2LHE A;  2JXT A;  2KN4 A;  3HVD A;  4CI3 A;  2PW9 A;  4A08 A;  2WP9 B;  1YN5 A;  3R2I A;  4KKI A;  3R8B A;  5HI1 A;  1FD6 A;  1L6V A;  1ECR A;  3ZGZ A;  3AV8 A;  3B2F A;  2K0P A;  1RM6 C;  3PZ7 A;  4REZ A;  1C78 A;  1YN3 A;  4NJC A;  3WQZ A;  2NTT A;  1JRO A;  1XLO A;  1GAQ B;  2WXQ A;  3AMZ A;  5D3I B;  1YN4 A;  4B0E A;  3AEC B;  1C79 A;  2W3S A;  2E1B A;  3I9V 1;  2CJN A;  1BML C;  4ZYS A;  1SE4 A;  4E5Z A;  1CJE A;  4FXC A;  3SR6 A;  4XR2 A;  4XDC A;  2ZW0 A;  1QT9 A;  1ZDX A;  2KAC A;  2AQ3 B;  3P4Q B;  2E6X A;  4RFB A;  4GDL B;  4NAW B;  2FBW B;  2OHF A;  2INP E;  4TSS A;  3ZJV A;  3O13 A;  1UNS A;  2IGG A;  3IT6 B;  3ZJU A;  2WLB A;  3ZJT A;  3AM9 A;  4WH4 A;  2LFI A;  1SBB B;  4C80 A;  1JWB D;  1TY2 A;  2KQ4 X;  1FNV A;  1WXQ A;  2LHD A;  4A90 A;  2H88 B;  1D5M C;  4P6V F;  4ARI A;  1GOZ A;  2H89 B;  1FNU A;  4AR9 A;  4XWT A;  1C4A A;  1V1P A;  3B9J A;  4ZRP A;  1B9R A;  1QIL A;  2BS2 B;  4OHJ A;  3EI4 A;  5AUK A;  3GP7 A;  3J9C A;  4JPS A;  2QIL A;  4MAC A;  2R61 A;  3TSS A;  3AH7 A;  1N5X A;  1ZXI A;  4A0A A;  1NEK B;  4ARE A;  2W54 A;  3IT4 B;  1V4P A;  4TZ4 A;  4A55 A;  2X38 A;  1NVI D;  2QJL A;  1MI0 A;  1WYG A;  3I7H A;  2K9X A;  3P4R B;  2JQR B;  4NZL B;  3Q8E A;  1SJE D;  1STE A;  2W3R A;  3I57 A;  1JRP A;  2WXH A;  5EE1 A;  3W9C B;  2WDR B;  5EE3 A;  4WWM A;  4MH8 A;  1N5W A;  4USA A;  5GXG B;  1JQ4 A;  4J3O D;  1XLQ A;  2BB6 A;  2L52 A;  3N9Y C;  3NZ3 A;  4A09 A;  1AYF A;  3AN1 A;  4RCO A;  2W55 A;  2WXO A;  1C4C A;  5D7G A;  4ZHO A;  1PGB A;  1YJI A;  2KWD A;  3BYT B;  4IOI E;  3NUH B;  4LLG M;  1SB3 C;  1T3Q A;  1FCL A;  3IAM 1;  1D5Z C;  3AEF B;  1IBX B;  4ITK A;  1GB1 A;  2ZW1 A;  4AS1 A;  4WIP A;  2DWQ A;  1AW7 A;  4JX1 C;  4XE0 A;  1CK1 A;  4E54 A;  4H2A A;  1F0Z A;  1HZ6 A;  1VZ6 A;  2K3U A;  2PMV A;  3RPF C;  3ZQ4 A;  1J7B A;  4DXF A;  2J4X A;  1V97 A;  3URY A;  4RNA A;  2WS3 B;  2IGH A;  2L83 A;  3VQI A;  4A8X C;  2ZTG A;  1XCT L;  1E10 A;  2I38 A;  2DLB A;  2IUT A;  3AEE B;  1UWX A;  1N61 A;  1WRI A;  3GB1 A;  5HHD G;  4D2K A;  3HUI A;  1D6E C;  2ZZF A;  4OVZ A;  3IAS 1;  5BYQ A;  4YTP B;  2INN E;  3BVM A;  1V7O A;  3AE7 B;  4YSZ B;  2PIA A;  4CI1 A;  1QLB B;  1I4H A;  1RYJ A;  1XF5 L;  3FIL A;  3NRZ A;  2B5M A;  2WXP A;  1E6E B;  1HQR D;  2IPK D;  2Y50 A;  1XLN A;  2BTE A;  3W5U B;  4DXG A;  2WXJ A;  2V3N A;  3P1M A;  1FNW A;  2PKO A;  2W82 A;  4RGT A;  1NYR A;  5FR3 A;  3KLS X;  3WCQ A;  1KLU D;  1HA5 A;  1V8C A;  4US9 A;  5TSS A;  1NYQ A;  2ACZ B;  4NAM A;  3KWV A;  1B1Z A;  1ROE A;  4RH6 A;  1BXT A;  3CIR B;  2Y5C A;  1L5P A;  1WNU A;  4L23 A;  2BS4 B;  2WXM A;  1NEN B;  4R3D A;  1KF6 B;  3I8E A;  1SIJ A;  4A6Q A;  1OQR A;  2XN9 C;  2QMT A;  4OZC A;  1CQV A;  1PYW D;  3U52 E;  1AWD A;  1D5X C;  2EWJ A;  3AE9 B;  2B5L A;  1SE2 A;  1C9F A;  4ARC A;  5I4D A;  3ZYY X;  1L6U A;  4WUR A;  1LO5 D;  2YEP F;  2Z8L A;  1ZE3 D;  5BYR A;  1TY0 A;  2CJO A;  3BZD B;  3E0C A;  2PVO D;  2NTS A;  1ZUD 2;  1ZDV A;  1K50 A;  1XCQ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...