1TKGA

Crystal structure of the editing domain of threonyl-trna synthetase complexed with an analog of seryladenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonyl-tRNA synthetase
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tkgA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tkgA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tkgA02
3B9JA 2WDVB 3EUB2 1RWSA 1WYGA 3HRDD 3P4RB 3CWIA 4JX1C 4N6EB 1DOXA 3AE7B 3CIRB 2BS4B 3LXFA 1SF0A 2K5PA 3B2GA 5AUKA 1WRIA 2W54A 1WGKA 3KWLA 4C80A 3ABVB 2ZZFA 1J7AA 3FAHA 4WQMA 4US8A 1L6UA 2CJNA 3W9CB 2M19A 3AEBB 4N58A 1WNUA 3P1MA 4YTNB 1CZPA 2AX5A 1NVID 1IUEA 1TJEA 1E0ZA 1OQQA 2E1BA 1FM0D 2WP9B 3NVWA 1JQ4A 1EWYC 1QF6A 4YTMB 1V4PA 4FXCA 2B76B 3W5UB 1YQ4B 1KFYB 1V97A 3B2FA 3AM9A 2L83A 4ZOHC 3WCQA 3AE9B 3VR8B 1R7SA 3AN1A 2M56B 1SIJA 1NYQA 2Y5CA 3AE8B 2HTME 3WQZA 1E7PB 3NVVA 2WU5B 2ZZGA 3AE3B 1FRRA 5C2TB 1N5WA 1ROEA 3W5VB 1XLNA 2ZTGA 5AUIA 3AEFB 3NVZA 3AE5B 1N61A 1DGJA 4N59A 3SR6A 1AYFA 2ACZB 2FBWB 2WQYB 3FC4A 4YXDB 1QLBB 3BIID 2K9XA 5GXGB 2WDQB 2CU3A 2MJEA 3VR9B 5EE9A 3RHUA 2EKIA 1TYGB 2WS3B 3PO0A 3ZYYX 1XLOA 1QOGA 2W3SA 1OQRA 1VLBA 1QOFA 1YJIA 1PUTA 1WXQA 3P4SB 1CJEA 1A70A 3AE6B 5G5GA 1L0VB 3AEGB 2L52A 3P63A 1ZP0B 1L6VA 1PDXA 1PFDA 1RFKA 1DOYA 1SB3C 2QIEB 3AE1B 4HROA 3NS1A 2BT6A 2PVGC 4USAA 2CJOA 2MH7A 3L4PA 1ZOYB 3AECB 1AWDA 3LB8C 4YTPB 5EE0A 4ZHOA 5MPOA 1YQ3B 3RFNA 1KRHA 1ZUD2 1JROA 1JWBD 1JALA 3AMZA 2G1EA 1NI3A 1L5PA 1UWMA 3HUIA 2MJ3A 3VRAB 3AEEB 3KEWA 1XLPA 2PIAA 1V8CA 2BS3B 3AB5A 4YSXB 2OHFA 1TKGA 2PKOA 2W55A 1F0ZA 1N62A 1KF6B 1FXAA 1WXOA 1QT9A 3AEDB 3AV8A 3ETRA 4JWSC 1GPXA 1TKEA 5EE1A 3SFEB 1J7BA 1FMAD 1NEKB 2KMMA 1E10A 2KAJA 4C7YA 1JWAD 1RM6C 2H89B 1TKYA 1N5XA 4KX6B 1FO4A 1JRPA 5EE3A 1T3QA 1VDVA 2MJDA 2PVOD 1VJKA 2QJLA 3AH7A 4ITKA 4ZHPA 1B9RA 1GAQB 2DBYA 4C7ZA 1FFUA 4P6VF 4YT0B 1N63A 3P4QB 1N60A 1NYRA 2N0SB 1V7OA 1I7HA 1FXIA 4LTUA 1E9MA 1QOAA 2WLBA 5H8YE 2DWQA 1ZXIA 2LEKA 1OFFA 2Q5WD 4WWMA 2WDRB 1WWTA 1JW9D 2ZZEA 3AE2B 3AE4B 4YSYB 5H92C 3DWMA 1YJJA 2BS2B 1J7CA 2E3TA 1XLQA 2JX5A 1XO3A 2JQRB 1FIQA 3HVZA 4US9A 1FRDA 3NRZA 3P4PB 3NVYA 4YSZB 2H88B 5G5HA 4HRSA 4A9AA 2WU2B 1FFVA 5C3JB 1NENB 1QOBA 3DWGC 3RPFC 3SFDB 4IDIA 1DOIA 2W3RA 1RYJA 3VRBB 4JWUC 2K22A 3AEAB 1E6EB
chains in the Genus database with same CATH superfamily
1WX7A 2MBBB 3AE7B 3CIRB 2BWES 2IGHA 4OZCA 4CO7A 3N32A 3H8HA 4IM0A 2JWUA 2JUOA 1IYFA 1IUEA 4AWJA 1SJHD 4PS7A 4URKA 3GE8C 3MFGA 3WCQA 2O6VA 2PTLA 2J0JA 4LDTB 2CU1A 1R4NI 4G11A 1E7PB 2LRUA 5AUIA 3R7QA 1ET6A 4ZRQA 3ZTWA 1AYFA 2KTRA 2WYQA 2NBVB 3PVLA 3U7DA 4TUUA 3RMKC 3X23A 3PO0A 3ZYYX 1OQRA 2VH2A 2RPQA 5HI1A 2JVCA 5EDSA 4WJNA 1V1OA 3W1SA 2BT6A 2LXCA 1KJTA 1WR1A 5MPOA 2KDMA 4MGYE 1AN8A 1L5PA 2XEWA 3HUIA 3WAPA 3ZDTA 2CKHB 3Q8CA 3B1LX 1WXOA 1QT9A 3AULA 1LGRA 3QCAA 3RYTA 2I2YA 4ICVA 1JWAD 3SD5A 2J52A 1T3QA 2MJDA 3DBRB 4DHJB 1GAQB 2WX1A 1OEYJ 3ZNID 4G50A 3DCGA 3BINA 4K81A 1I7HA 1GNUA 4KKIA 3JVZX 3K9PB 4EOYA 4IW0A 3T3OA 2Z8LA 4RM8A 3I7NA 2IYDB 1XD3B 3NRZA 1ZDVA 2B5MA 3L10B 1Q1OA 4WAAA 1YN4A 2C7NB 1L2NA 5EE0A 1BXTA 2RGFA 3A9JB 3ECIA 3DHIC 2KACA 3UIOB 4DXGA 1Q0WB 3V61A 2UU7A 4ARCA 3LXFA 5E6NA 2ZZFA 1TTNA 1AARA 2LGSA 4ANXA 3AEBB 4TMAB 3PZ8A 2OOBB 4A3PA 2IUTA 4IWQA 3O65B 2AL6A 3ZIMA 2BQQA 2KFKB 2INPE 5D2MB 2JRHA 3VQIA 1YN5A 2ZEQA 3BK1A 4RFBA 3AEFB 2KT7A 4OVZA 1LFDA 4Q2JA 2BPSA 3BZDB 2IO2B 2WDQB 2CU3A 3TEXA 1WX9A 2DENB 1K52A 4BKSA 5CTRC 1L7YA 2DYMA 3A9KA 1T5XD 4LCDE 4K7SA 2Y3UA 4A55A 2WXQA 4XZ4A 1JWBD 2KX3A 3DVNV 5DCNA 3KYDD 2OHFA 1U4AA 3E9SA 2BKFA 2RMMA 1FXAA 4JWSC 3TIXA 2C60A 2KAJA 3DVGY 4XC2A 4DWFA 5JHAA 5BO4B 4P7IA 2RDBC 1P7EA 2NTTA 3OLMD 4YT0B 4FN2A 2N0SB 3V05A 3I7PA 1V7OA 3N1ZC 2C7MB 3K9OB 4WJQA 1JW9D 3RCZA 3SDLC 4EEWA 4W9DA 2Z0DB 1QKZA 3H6NA 2JT4B 1OGWA 3DWGC 3KVFB 2NCNA 4IKGA 4JWUC 1YNTE 2K22A 4ZRKA 3PZ7A 1RWSA 3CSTA 3BK2A 5BMIA 1Z2MA 2RD0A 3TMPB 2BS4B 4A90A 3P42A 5AUKA 1SBBB 1V86A 4ANVA 4BAXA 2J4XA 2JWZA 2EMSA 2QEJC 2OEDA 4BFRA 1SJED 1TZ1A 2JY6A 3WIMA 4NZLB 2INCC 1Y56A 3RUIB 1T0YA 1NYQA 2Y5CA 5BMGA 1ZPSA 4EKUA 1UGMA 1N6ZA 4B95A 1VZ6A 2KYWA 3VTUA 4G0NB 4N59A 2ZCCA 2K8HA 2X38A 3MC0B 3VUXA 3RHUA 2X8XX 1VLBA 4FLHA 1YJIA 1UD7A 1YIWA 4DDID 1MJDA 1P9DU 3IG3A 2WXKA 3I89A 2KVRA 2MH7A 3UF8A 1C1YB 2LMCA 4E74A 2BYTA 2HE7A 5I4DA 2KDIA 2IO0B 4FBJB 1Q5WB 1UH6A 2BW2A 4J6IA 3IVFA 3QJZA 2D07B 4DQOC 1TS5A 5AZHA 1FEHA 4BKTA 1JRPA 4WJOA 2LUMA 1FNVA 3WALA 2NTSA 2GOWA 2CHWA 5KHOA 3I7LA 2N9LA 4JPSA 1QOAA 5H8YE 2LVQA 4FJZA 4YSYB 3AE4B 5H92C 2LZ6A 2L05A 3DBRI 3I7OA 1WGYA 3NVYA 2WXIA 2GBMA 3ZRFA 1C4PA 5BYQA 4K7WA 4MGZE 2AQ1B 3EUB2 1E90A 2N9KA 2ZPNA 3VH3B 3ZJUA 2ONQA 4BOSC 1IPGA 4GN1A 1BT0A 2WX0A 4RF0A 1D4BA 2AX5A 1E0ZA 3DPDA 4TKNA 3QWZB 3TBLD 5BYSA 4ANWA 3A9JA 3IT4B 1HE8A 2KDEB 4OVUA 2HTME 1KLUD 2GBJA 1FRRA 2O6VB 3L54A 1TT5B 2M4NA 3EGRA 1DGJA 2ACZB 3DHHC 1R4MB 4GMVA 4OVVA 2KMAA 2W3SA 2KTRB 3Q3NC 3P4SB 3I7KA 1HZ6A 4MGIE 3P63A 2KFKA 2M17A 1PFDA 1SB3C 1VD2A 4CQNA 3RFNA 4EFOA 4REZA 3SHQA 3ZGZA 4F1SA 4XR2A 3QK0A 4II2B 3RNFC 2L1AA 4E5ZA 2DAJA 1XT9B 4WWOA 5IKCM 1BUIC 3KUZA 3ZUNA 4NJ7A 1WZCA 2IPKD 2BKRB 4IM3A 1D5XC 2V3PA 4C7YA 2BTEA 1ZDXA 3LDZE 4ITKA 4P6VF 2K0PA 3PRZA 1JRUA 3Q3MC 5JH5C 4HPPA 2Q5WD 5C1ZA 1EF1A 3TSSA 5LXHA 3I7HA 2K39A 4FJYA 1V1PB 2HD5B 1SE3A 3N20C 1QOBA 3U7ZA 1F52A 4HXDA 1YMHE 5JZEB 1WYGA 2G4DB 4HCNB 2ZOSA 4EZLA 1SSNA 1D3ZA 3R8BA 2ICIA 3B2GA 3ZVVA 1V2YA 3A4SC 3PRMB 1L4ZB 4N58A 1MHHE 4I6LB 1C78A 3NVWA 1SEBD 1EWYC 3W5UB 3EC8A 1V6EA 2D3BA 4MGKE 4O1NA 2MX2A 2QMTA 2FUG1 1IP9A 5C2TB 1VZ8A 1XLNA 4XE0A 4KIKB 3NVZA 2Y5PA 4TSSA 2FBWB 1S3SG 5G55A 1HEZE 1UWXA 5FR6A 1YQBA 1V80A 2KK8A 3DBLB 1RFAA 1TYGB 3DHGC 2NS5A 4BZAA 3ZU6A 1L0VB 3AEGB 1PGBA 3B0AA 4HROA 3PHXB 3T3NA 2PE9A 3FKYA 2DZMA 1JALA 3U52E 4BBNF 4E54A 4KV2A 4NAMA 3M62B 4WWPA 4BKGA 1LO5D 5G2NA 4DHZE 5BMHA 3IXSA 1N62A 3AEDB 4WH4A 4RCOA 1N60A 4YWGG 1WXVA 4L1BA 3MJ5A 4RMAA 1T0QC 2DWQA 3DBHB 3QAQA 3AE2B 4WIPA 3PS6A 4OHJA 3N30A 2WGSA 3A33B 3N1XC 1EO6A 3LJ3A 4PS8A 1WRDB 2ON8A 3AEAB 3IHPC 4HDQA 1I42A 3UGBB 1I4XA 3P4RB 3CWIA 4I6PA 4LNNA 2LVPA 1CQVA 2I06A 3N1YC 4US8A 1V81A 3WAOA 2R2QA 2MBOA 4PT5A 3ZRCA 2YEPB 5LXIB 1GC7A 3R66C 5FK9C 1NI2A 2D3GA 4LNOA 2K25A 2QHOA 1MVKA 3EECA 4JQWC 5FQDA 2FE8A 2GBNA 2N1VA 3L08A 2JXXA 3AI5A 2NVUI 1CMXB 1WZ3A 1PDXA 3EFCA 4A8XC 2W82A 3TEZA 2HJ1A 3AECB 1ZUD2 4PYZA 1FNWA 1R4MI 1KLGD 3ZDMC 3ZW7A 1LXDA 1F0ZA 2RPVA 3PZDA 3ZNZB 1J7BA 2VRRB 1E7UA 4KX6B 4KZCA 1VJKA 4GGQA 3DVNU 3T9LA 1C4AA 2YEPF 1XEEA 5HFYA 2DZJA 4KSLC 1BMLC 3EI3A 4HKQA 1WMHB 2I05A 4AR1A 3ZJVA 2EELA 3T8MA 2IY1B 1XO3A 2JQRB 3PLUA 4US9A 2PLPA 5DPSA 1M94A 2N1WA 3PLVA 4YSZB 3MHZA 4AJYB 2J0MA 3ZX5A 3ML9A 1RYJA 3UQBA 3ZKJC 3HRDD 4ACFA 5BYRA 1MI0A 3VVWB 1TY0A 3KWVA 1WGKA 2BYEA 3JSVB 3P1MA 1V1PA 4YTNB 4XDCA 4IWPA 1CZPA 1S1QB 1NVID 2GBKA 4MSMB 3PTFC 2B76B 4FXCA 3QQ8B 3ZTYA 4AP4C 3IFWB 2HTHA 2I1KA 5D94A 3R3MA 3W1SC 2INNE 2ZTGA 4II3B 2J42A 3VXWA 4B0MA 3AE5B 3GP7A 3TEYA 2WQYB 3I9V1 4B0EA 1WH3A 3C0RB 3Q69A 1L0XB 2FCSA 1QOGA 2KKCA 5G5GA 1WF9A 4IG7B 2L52A 4M8NA 4ASWC 4NPNA 1WXMA 4KIKA 2WHIA 1C79A 3NHEB 1UBQA 3ZUPA 2G1EA 4DHZB 3DBLI 1WJNA 3NY5A 2O6VD 3ZTDA 2D10A 4BOZB 1C77A 1FNUA 3RNCC 1YD8U 2DX5B 3ONSA 1ET9A 1P98A 5E6OA 2PPHA 3Q8FA 2JZZA 2L3ZA 3CF6E 1E8XA 4C7ZA 4RF1A 2A5UA 4GLSC 1WX8A 1X1MA 2J53A 2PMVA 1JMLA 2ZNVC 3IAM1 3BYYB 2ZW0A 4C4VB 2NBUA 2WDRB 3MJWA 4LNIA 5J18A 4X57B 3DDCB 3DWMA 3NUHB 3HVZA 3PHWB 3RNEC 3P4PB 2BYFA 4W9KA 2KWUB 2YVCA 3HVDA 3RT3B 2PVOD 1SXTA 3PSEB 1V49A 1RRBA 3ZO5B 3I57A 3PV1A 4J3OD 2JPHA 1IBXB 1PGXA 1WYWB 1ZGUB 3PGEA 4WQMA 2ZW1A 4AR8A 1FCLA 4AQ7A 3KQ4A 3UQAA 1CK1A 2MQJA 1KFYB 1TBEA 4MH0E 3U2SC 2KQ4X 3VDZA 2UWQA 3AE3B 1EF5A 1VCBA 2NPTB 2KMCA 2D5GA 1YOVB 4M02A 2NR2A 3RZFA 2EKIA 2MHJA 2CHXA 1D6EC 1EM7A 2QIEB 4UDUC 2V4IB 3NS1A 4ZRIA 5JHBA 2CJOA 1C76A 3LB8C 3V3XA 1L4DB 5CHFA 3EFUA 2FCQA 5AZFA 3VHTC 3AEEB 3KEWA 1XLPA 4HPMB 3URYA 3Q3OC 1PGAA 2HDEA 1P1AA 3ETRA 2K1FA 2E6XA 1FMAD 1ESFA 4MDKE 4DXAB 1FFUA 3NZSA 4HVBA 1GG3A 1HXYD 2KANA 5HKHA 4BKSD 1QQRA 1ZXIA 2WXHA 3NZ3A 2IUUA 3H7PB 4GIVA 1XLQA 1WGHA 1FIQA 2KLGA 2EWJA 4IWOA 1QILA 4A9AA 3SFDB 3TUOA 2L8JA 1WI0A 1WMHA 2B3AA 4A0AA 3L16A 4XWWA 4AREA 2C9WB 1SF0A 2K5PA 1WRIA 4P1BC 4C80A 4KDLB 1L6UA 2I1JA 1WNUA 3BYTB 3EI2A 4XR0A 1IGCA 2Y50A 3MC8A 4JL9A 1TS4A 3Q2AC 2Y3AA 3RZWC 2BF8B 3AN1A 1AW7A 3ZW3A 2ZZGA 2WU5B 1N5WA 3JSVA 2GMIC 2MBEA 1QLBB 4GDKB 3D32A 5IO9A 2M1MA 1P7FA 5EE9A 3NJTA 3QA8A 4GB9A 1YJ1A 2INDC 4W9IA 4AJWA 3RNAC 1CJEA 2MA9B 2EMTA 3U4EG 5AEKB 4XGAB 1DOYA 3A1QB 2KD0A 1V4PA 4USAA 4FA6A 3GZNB 4HLEA 4KGTA 1ACCA 4HPLB 1TIFA 1UWMA 2KHWB 1V9JA 3OJ4B 4W9CA 1MG4A 2AL3A 2XK5B 4YSXB 2PKOA 3GB1A 4F7ZA 2KXJA 4FHKA 3WAMA 1E5WA 2LASA 4NQKE 3E0CA 4HEA1 1VDVA 2KFJA 3QARA 2K6QA 1NDDA 2V9HA 2KC1A 1FXIA 3NZUA 4LTUA 1R4NB 2DAFA 2Z59B 2LEKA 4LDTD 4WWMA 1KLVA 3BWUD 4XR1A 3PT2B 4A09A 4MJSA 2IBIB 1WGGA 2FIFA 4ARIA 4FADA 2IJ0A 3RPFC 2W3RA 4C4VA 5C23A 1KM7A 2V3NA 5IOIA 1QZEA 1WJ4A 1JWUD 2KJ6A 2JYTA 1E8WA 1YX5B 2RR9A 2DLBA 2MWSB 3I3TB 2DHZA 2KN5A 4YTMB 2LGXA 3B2FA 2L83A 1R7SA 1SE9A 1SIJA 1IBXA 1WM2A 4WAFA 3ML8A 2ZZPB 2WXJA 4DHJD 4JLCA 3VAWA 2MJEA 4JIOU 1KOTA 2HJ8A 3AE6B 1KTKA 4RGOS 4ZDVA 2EKEC 3ENEA 2Z0EB 1EUVB 2MBHA 2D3AA 2LHDA 4RGNA 2M0AA 2NPTA 1JCKB 2SEBD 1P0RA 4XYCA 2RSUA 3Q8BA 5LLIA 2PIAA 5D7GA 3APCA 1HZ5A 2QCZA 2ZJDA 4MEMA 3PREA 4EZJA 1T0SC 4GDLB 2YLMA 4XDDA 1GPXA 5FKAC 5D6JB 2H89B 4NAWB 3APFA 4L23A 3BVGA 4LJOB 3VUYA 1B9RA 4K1RB 2FIDA 1UBIA 4K3BA 3R2IA 2BYVE 2R61A 1XF5L 4W9FA 3HK0A 2ASQA 1OFFA 5DPTA 4F8CB 3RI7C 3NG0A 2PW9A 2N7DA 1J7CA 3A4RA 5D3IB 3KLSX 2WXGA 1UUPA 1RAXA 3ALBA 4GU2A 5C3JB 1FPYA 2LGYA 2IY0B 1I4PA 4QAYA 3EA6A 1DOIA 1HA5A 2WDVB 2D11A 3MP9A 5J2RA 2MW5A 2IDYA 4GSWA 3H7PA 1F77A 2W54A 2KDFB 2J7QB 2CS4A 4RGTA 2CR5A 3W9CB 1XCQL 4KZ0A 3E56A 1XQQA 2G45B 1EU4A 4OZAA 3R2TA 4MH8A 2TSSA 1A5RA 4W9HA 1XXGA 4E71A 1JQ4A 1C4CA 2G3QB 4ZOHC 2M8SA 2NBWB 4R3DA 2L0FA 4GOCA 4LK0M 4HWIB 3FC4A 5JXVA 1V5TA 1WXQA 2D3CA 1Q10A 3HHMA 4CHKA 2V1YA 3H7SA 3LYYA 2FUHB 2GBRA 2AEHA 4GDKA 2JZPA 4OZBA 2B5LA 2IZVB 4HKZE 2KWVB 2MLBA 4MACA 1C9FA 1SIFA 2FAZA 3AV8A 5EE1A 2KMMA 2QILA 2MCNB 3A1QA 3IT6B 1RM6C 1TKYA 3B08A 5EE3A 2QJLA 1WE6A 4FULA 2PEAA 4C00A 4CI1A 3VUWA 3VH4B 3SU8X 4PYUA 2XK5A 5DPWA 3V60A 3L13A 4HJGE 3HM6X 2JX5A 4NJ6A 2NMQA 2VH1A 3Q8AA 2H88B 1NENB 3HIZA 4GXBA 3ZWDA 4N6EB 2C5LC 5LNK1 1GC6A 1H4RA 1WE7A 2KX0A 5CHVC 3V6EB 1WR6E 1J7AA 2CJNA 1P3QU 3APDA 1OQQA 2MBQA 4K7UA 3TCAA 3Q8EA 3M95A 3AE9B 3ZJTA 1EWCA 4MELA 3VTWA 1EU3A 4MT5A 2WDTB 2MEKA 2WXOA 3Q3FA 2J0KA 4ANUA 2WXRA 3HM3A 4CYEA 3MTNB 3U30A 1WM3A 4M0WB 2WS3B 1J19A 4NY0A 1WFYA 2LI5A 2LXAA 1ZKHA 1K53A 3QX1A 4ARFA 2AYOB 2KO3A 1MHXA 4CI3A 2Y5BB 3UIPB 4E3CA 3AE1B 3I8EA 1ZOYB 2PE6B 3U8ZA 3AMZA 1YN3A 1TS2A 5E6JA 3H1UA 1UELA 3AB5A 2G9HD 4IC7B 1B1ZA 3JW0X 4JGHB 2MP2B 2KOXA 1I4QA 1OEYA 4RH6A 1FO4A 3PPAA 3RFZB 3MHSD 4LJPB 1N63A 3P4QB 3DVGX 1D5MC 2IUSA 4TZ4A 1WZ0A 2KC2A 2WLBA 2JXTA 2KVZA 4GDLA 2BB5A 4AUQC 1LQBA 2BGFA 3H9DA 1ECRA 2O2VB 4NAWA 2VZKB 1D5ZC 5G5HA 4I6NB 4MJSB 1K50A 3VRBB 3B9JA 4AOFA 2KLCA 4BBNC 1KH0A 4JX1C 2LJ5A 2UYZB 2LRWA 1ISNA 1VRAB 2M19A 3KUCB 3EHVA 4A6QA 1TJEA 2E1BA 1FM0D 2WP9B 4M00A 4A0BA 2IGDA 3NS8A 4EE2A 1V97A 2KZRA 2N9XA 2QSDA 1L0YB 3WQZA 2DZIA 4OW0A 3AE8B 3NVVA 4DK5A 3M3JA 3DBHI 1WGRA 3ZLZA 1E8YA 2BWFA 1ENFA 2GRIA 3NOBA 4PS3A 4KDIC 2IO3B 3GOEA 5GXGB 4AS1A 4WJPA 4DBGA 4JE3B 3RD2A 1OTRB 4M8MA 3MC9A 2K8CA 2JF5A 3I63C 4MM3B 1HTQA 1ZP0B 1YX6B 1VR9A 3W5VB 2PVGC 5D3DA 1T6BX 1AWDA 4LNKA 1KRHA 3V62A 3VRAB 1MPEA 1J0GA 4PK1A 4NQLB 2W55A 3UINB 4W9JA 4ZYSA 2KDBA 3WANA 4CI2A 3P2BA 4A08A 2KQSA 1N5XA 3OAWA 2JYEA 1RLFA 3AH7A 4P1CC 2MSED 1SGHA 4HDOA 2KTFA 2LGDA 4XWTA 3V6CB 3ZWKA 3L0WB 2D2QA 3I5JC 2GI9A 1E9MA 3AU4A 1G6JA 1XVIA 2LVOA 3RN9C 1WWTA 1F2RI 4YL8A 2BS2B 2E3TA 2G4SA 5GMVA 3FILB 4BVUC 4TQ0A 4WWNA 1FFVA 2V0GA 1H8CA 1TZOA 1GJZA 3Q6BA 4WURA 1UNSA 2AQ3B 1GB1A 1GUAB 3QHTA 2ZVNA 4FHJA 5KHQA 3QIJA 3KH0A 2KN4A 2WWZA 4NNJB 3EI4A 1F1HA 2BBCA 3IBEA 2CHZA 1PYWD 4DXFA 4HJKA 3AM9A 2FCNA 3VR8B 1VZ7A 2C7HA 1E8ZA 4MSQB 4L2YA 2SAKA 1MG8A 2WXLA 3SR6A 3C19A 3BIID 1I4HA 2N4FA 3KUDB 1JWMD 1XLOA 1F2RC 1UF0A 2L7RA 4EUTA 5AZGA 3BY4B 1WJUA 1OQYA 4YTPB 3N3KB 2KQ7A 2DZKA 1NI3A 2XNAC 4W9GA 4M0WA 1V8CA 2N7JA 1UGJA 2ZVOA 2GLSA 3L17A 2KJHB 2PJHA 1KF6B 1ZXHA 2BVCA 4ZYNA 1SE4A 1SE2A 4RNAA 2RDGA 2XBBC 1PQSA 2OJWA 4WQOB 5IAAC 3GS2A 4IM2A 2N7EA 3RNBC 2WXMA 3ZTCA 2BB6A 2XN9C 1TGZB 4KVGB 2GB1A 4HK2A 3DQVA 2MP2A 2LUEA 2ZZEA 3CSFA 1FD6A 2WNMA 3ZXRA 1YJJA 4TQ1A 3QC8B 2JSVX 5L83A 4LNFA 2K6DB 1ZE3D 4W9LA 2W9NA 4ZRPA 2AQ2B 1DOXA 1TS3A 2O2VA 1M4VA 2KWDA 3ABVB 3KYCD 4D2KA 2WXNA 1I4GA 4TV3A 3W1YA 1DYQA 1QF6A 3VTVA 3J9CA 1TY2A 3X0WA 2KWCA 3DBSA 4XR3A 3RNGC 2M56B 2R2OA 3ZXVA 3O13A 2V3SA 3ZQ4A 1WY8A 3R7RA 2K3UA 4A20A 4YXDB 2K9XA 5CHWA 1K51A 2ZCBA 3IAS1 1NBFC 2Y6IA 1QOFA 4FJVB 4ZRJA 1A70A 4LLGM 1RFKA 2LGIA 2HYEA 1MFWA 4AR9A 4A3OA 3L4PA 4ZHOA 1C3TA 2JZ3B 5TR5A 1YQ3B 2LJIA 1IGDA 1JROA 4G3XB 5IP4D 1STEA 2MJ3A 5T8IA 1TKGA 3OWEB 2DYOA 4MM3A 3GE3C 3UI3A 2WXPA 3PRPB 3TL5A 1XCTL 1UZXB 2LFIA 4ICUA 4ZHPA 3ZX4A 2DBYA 2L76A 3C8YA 1GB4A 3DOWA 3WA0A 2ZNVB 4RGMA 2MRPA 1I4RA 1Y8RC 1HQRD 3OG5A 4KGRA 3RULA 4DDGD 1F9JA 1V5OA 2L32A 2JRIB 4EZKA 1ZW7A 3VFKA 4P16A 1J8CA 1FXTB 4KSKC 1GOZA 2K8BA 2LWPA 4A11A 1E7VA 4IUMB 3OJ3A 5IA7A 3KW5B 5IN7A 2DNFA 2ZPYA 2M0XA 3SEBA 1WJ6A 3KWLA 3FAHA 4C56C 1WSPA 3FILA 4XX5A 5CX3A 5J17A 2OJRA 2KJRA 3AXCA 3BVMA 2IGGA 2LHEA 2REXA 4M01A 2LD9A 5HHDG 4HCPB 1YQ4B 1WXSA 3ZNHB 4NJCA 5L95C 2VZKD 3A9KB 4S0RA 2JU6X 1ROEA 2WXFA 1N61A 2N9PC 4KGSA 2QC8A 3VR9B 3ZNGC 3BVZA 3AU5A 1PUTA 3M63B 4B9KA 3W2DA 1L6VA 5FR3A 1HTOA 5E6PA 2AWTA 2DYBA 5TSSA 1K8RB 1WXAA 4H2AA 2KNBA 2BS3B 4B6WA 3EI1A 4RM9A 2FCMA 1WGDA 1WIAA 1TKEA 3SFEB 1NEKB 1E10A 1LM8B 3I8CA 2A4ZA 4IOIE 1I35A 4K3CA 4N9F4 2RDHA 3Q14C 4W9EA 1NYRA 2FNJB 1FCCC 1T0RC 3TJPA 4KKJA 2V4LA 2IO1B 2QDFA 3N9YC 4S17A 3CMMB 2I38A 2L00B 3S2AA 1FRDA 1Z5SB 1JWSD 3Q3JA 5DPRA 2L0TA 3GZNI 3JYUA 2WU2B 4HRSA 5HG2A 2N9EB 3TEWA 4IDIA 1E6EB
chains in the Genus database with same CATH topology
3B9JA 1YMHE 1KH0A 1WYGA 4JX1C 4A0AA 3AE7B 4XWWA 3CIRB 4OZCA 2IGHA 1SSNA 3R8BA 4AREA 1SF0A 2ICIA 2K5PA 3B2GA 1WRIA 3H8HA 4C80A 2JWUA 1L4ZB 1L6UA 1VRAB 2M19A 4N58A 1WNUA 3BYTB 3EI2A 4XR0A 1MHHE 1IGCA 1IUEA 1TJEA 4A6QA 2E1BA 2Y50A 1SJHD 1FM0D 1C78A 2WP9B 3NVWA 1SEBD 1TS4A 1EWYC 4A0BA 2IGDA 3W5UB 3MFGA 2Y3AA 4EE2A 1V97A 3WCQA 2PTLA 2QSDA 1L0YB 3AN1A 1AW7A 4O1NA 3WQZA 4OW0A 3AE8B 1E7PB 3NVVA 2WU5B 2ZZGA 2QMTA 2FUG1 5C2TB 1N5WA 1VZ8A 1XLNA 4XE0A 5AUIA 1ET6A 3NVZA 1ENFA 2Y5PA 4TSSA 2GRIA 4ZRQA 1AYFA 2FBWB 1HEZE 1QLBB 4GDKB 5GXGB 4AS1A 1UWXA 1P7FA 5EE9A 1TYGB 4JE3B 3PO0A 3ZYYX 1OQRA 5HI1A 1CJEA 1L0VB 3AEGB 4MM3B 1PGBA 1ZP0B 3U4EG 1VR9A 1DOYA 1V1OA 3W1SA 4HROA 3W5VB 2BT6A 2PVGC 4USAA 1T6BX 5D3DA 1V4PA 3T3NA 1AWDA 5MPOA 2KDMA 4KGTA 1KRHA 1ACCA 1JALA 3U52E 1AN8A 1L5PA 1UWMA 3HUIA 3VRAB 4E54A 4NAMA 1LO5D 1MPEA 4YSXB 5BMHA 2PKOA 2W55A 3IXSA 3GB1A 1N62A 3Q8CA 1WXOA 1QT9A 3AEDB 4ZYSA 4CI2A 4A08A 2I2YA 1JWAD 2J52A 1N5XA 3E0CA 4HEA1 1T3QA 1VDVA 2JYEA 2MJDA 4RCOA 4WH4A 3AH7A 1GAQB 4XWTA 1N60A 4YWGG 4L1BA 3MJ5A 1I7HA 1FXIA 2GI9A 4LTUA 4KKIA 1E9MA 2DWQA 2LEKA 3T3OA 4WWMA 1WWTA 3BWUD 2Z8LA 1F2RI 3AE2B 4WIPA 4XR1A 2BS2B 4OHJA 2E3TA 3I7NA 4A09A 3NRZA 1ZDVA 3FILB 4ARIA 2B5MA 4TQ0A 1FFVA 2IJ0A 2V0GA 3RPFC 1TZOA 2W3RA 1YN4A 4WURA 5EE0A 2ON8A 1BXTA 3AEAB 1I4XA 1UNSA 2KACA 4DXGA 3P4RB 3CWIA 2V3NA 2AQ3B 1GB1A 4ARCA 1JWUD 3LXFA 1CQVA 2I06A 2JYTA 2ZZFA 4US8A 2DLBA 2KN4A 3AEBB 3EI4A 2BBCA 4TMAB 3PZ8A 2IUTA 4PT5A 4YTMB 1PYWD 2YEPB 4DXFA 3B2FA 3AM9A 2L83A 5FK9C 3VR8B 1R7SA 2INPE 1SIJA 1VZ7A 3VQIA 1IBXA 1MVKA 1YN5A 3BK1A 4WAFA 4L2YA 2SAKA 4RFBA 3AEFB 2WXJA 4OVZA 4Q2JA 5FQDA 2WXLA 3SR6A 2FE8A 3BIID 1I4HA 3BZDB 2WDQB 2CU3A 2MJEA 1JWMD 3TEXA 1XLOA 1K52A 1F2RC 3AE6B 1KTKA 4RGOS 1PDXA 4A8XC 2DYMA 2W82A 3TEZA 1T5XD 3AECB 2LHDA 4YTPB 4RGNA 2M0AA 2SEBD 1JCKB 2WXQA 1ZUD2 4A55A 2Y3UA 1JWBD 1FNWA 1KLGD 1NI3A 2XNAC 3Q8BA 2PIAA 5D7GA 4M0WA 1V8CA 2N7JA 1HZ5A 1UGJA 2OHFA 3E9SA 1F0ZA 2RPVA 1KF6B 1ZXHA 1FXAA 2RMMA 1SE4A 1SE2A 4GDLB 2RDGA 4JWSC 4RNAA 4XDDA 1GPXA 5FKAC 3GS2A 1J7BA 2KAJA 2H89B 4KX6B 4NAWB 4L23A 3BVGA 1VJKA 2WXMA 1B9RA 1P7EA 2NTTA 1C4AA 2YEPF 1XEEA 4YT0B 2BB6A 2XN9C 2N0SB 3V05A 5HFYA 3R2IA 3I7PA 1V7OA 1BMLC 3EI3A 2R61A 1XF5L 4HKQA 2GB1A 1OFFA 2I05A 4AR1A 1JW9D 2ZZEA 3ZJVA 1FD6A 2WNMA 2EELA 1YJJA 2PW9A 1J7CA 5D3IB 1XO3A 2JQRB 3KLSX 4TQ1A 4US9A 2JSVX 1QKZA 2PLPA 2WXGA 1UUPA 4YSZB 5C3JB 3MHZA 1I4PA 1ZE3D 3DWGC 3EA6A 4IKGA 1DOIA 1RYJA 4JWUC 1YNTE 2K22A 1HA5A 4ZRPA 2WDVB 3PZ7A 1RWSA 2AQ2B 3BK2A 3HRDD 3MP9A 5BMIA 1DOXA 5BYRA 2IDYA 1MI0A 1TS3A 2BS4B 4A90A 1TY0A 3P42A 1F77A 5AUKA 1M4VA 1SBBB 1WGKA 2KWDA 2W54A 3KWVA 3ABVB 4RGTA 2J4XA 4D2KA 2QEJC 2WXNA 3W9CB 1XCQL 2OEDA 3E56A 3P1MA 1V1PA 1I4GA 4XDCA 1EU4A 4OZAA 4YTNB 1CZPA 3R2TA 4MH8A 2TSSA 1NVID 1SJED 1XXGA 1JQ4A 1DYQA 1C4CA 1QF6A 3J9CA 1TY2A 4FXCA 2B76B 4NZLB 1Y56A 4ZOHC 4XR3A 2M56B 1NYQA 2Y5CA 4R3DA 3O13A 5BMGA 1ZPSA 2INNE 2ZTGA 1VZ6A 4LK0M 2J42A 3ZQ4A 4B0MA 3AE5B 4N59A 3GP7A 3TEYA 2K3UA 2WQYB 3FC4A 3I9V1 4B0EA 4YXDB 2K9XA 2X38A 3Q69A 1L0XB 1K51A 3MC0B 5JXVA 3RHUA 3IAS1 1QOGA 2Y6IA 1VLBA 1QOFA 1YJIA 1WXQA 1A70A 1Q10A 5G5GA 4LLGM 2L52A 1RFKA 2LGIA 2HYEA 2WXKA 3I89A 4AR9A 2MH7A 3LYYA 3L4PA 4ZHOA 2LMCA 1YQ3B 1C79A 2LJIA 1IGDA 2BYTA 1JROA 2G1EA 5I4DA 2JZPA 1STEA 2MJ3A 5T8IA 4OZBA 2B5LA 4HKZE 1TKGA 2BW2A 4MACA 1C9FA 3OWEB 2DYOA 3AV8A 1C77A 1FNUA 5EE1A 2KMMA 3UI3A 2QILA 4DQOC 2WXPA 1ET9A 1TS5A 1RM6C 3IT6B 1TKYA 3Q8FA 1FEHA 1XCTL 1JRPA 5EE3A 2QJLA 2LFIA 4ZHPA 2LUMA 2DBYA 4C7ZA 4RF1A 3C8YA 4GLSC 1GB4A 4CI1A 2J53A 1FNVA 2NTSA 2PMVA 1JMLA 3IAM1 3BYYB 4RGMA 2N9LA 4JPSA 3I7LA 2ZW0A 1QOAA 1I4RA 5H8YE 1HQRD 4KGRA 4HJGE 2WDRB 4YSYB 3AE4B 5H92C 3DWMA 3NUHB 2JX5A 3HVZA 3I7OA 2L32A 2NMQA 3P4PB 3NVYA 3Q8AA 2H88B 2WXIA 4P16A 1NENB 3HVDA 1C4PA 5BYQA 2PVOD 2AQ1B 3EUB2 1SXTA 2N9KA 1GOZA 4N6EB 4A11A 3I57A 4J3OD 1IBXB 1PGXA 5LNK1 3ZJUA 2ONQA 3SEBA 3KWLA 1J7AA 3FAHA 4C56C 4WQMA 2ZW1A 1WSPA 2CJNA 3FILA 4RF0A 4AR8A 1D4BA 2AX5A 1FCLA 1E0ZA 1OQQA 4AQ7A 3BVMA 2IGGA 2LHEA 5HHDG 3KQ4A 1CK1A 1YQ4B 1KFYB 5BYSA 3IT4B 3Q8EA 3U2SC 3AE9B 4NJCA 1EWCA 3ZJTA 2KQ4X 2VZKD 2HTME 1EU3A 4MT5A 2MEKA 1KLUD 3AE3B 1FRRA 2JU6X 1ROEA 2WXFA 2WXOA 3EGRA 1N61A 1DGJA 2ACZB 2WXRA 2D5GA 4KGSA 3VR9B 2EKIA 2WS3B 3BVZA 2W3SA 1PUTA 3P4SB 3I7KA 1HZ6A 1K53A 3W2DA 4ARFA 3P63A 1MHXA 1D6EC 1L6VA 1EM7A 1PFDA 4CI3A 5FR3A 1SB3C 2QIEB 3AE1B 2V4IB 3NS1A 4UDUC 3I8EA 2CJOA 1C76A 1ZOYB 3LB8C 3V3XA 1L4DB 4CQNA 3RFNA 4REZA 3ZGZA 5TSSA 3AMZA 4XR2A 1YN3A 1TS2A 3AEEB 4H2AA 1XLPA 2L1AA 5E6JA 3KEWA 2BS3B 3URYA 3EI1A 3AB5A 4E5ZA 1PGAA 2G9HD 1BUIC 1B1ZA 2HDEA 3ETRA 1TKEA 2IPKD 3SFEB 2E6XA 1FMAD 1D5XC 1ESFA 1NEKB 2V3PA 1E10A 4C7YA 1I4QA 2BTEA 4IOIE 3I8CA 4RH6A 1ZDXA 1FO4A 3RFZB 4ITKA 1FFUA 2RDHA 4P6VF 1N63A 3P4QB 1NYRA 2K0PA 1D5MC 2IUSA 1FCCC 1HXYD 4TZ4A 4KKJA 1QQRA 2WLBA 1ZXIA 2JXTA 2Q5WD 2WXHA 3NZ3A 2BB5A 2IUUA 3N9YC 3TSSA 3I7HA 1ECRA 2I38A 1XLQA 1FIQA 1FRDA 2VZKB 2EWJA 1D5ZC 1JWSD 1V1PB 1QILA 5G5HA 4HRSA 4A9AA 2WU2B 1SE3A 5HG2A 1QOBA 3SFDB 3TUOA 3TEWA 1K50A 4IDIA 3U7ZA 3VRBB 1E6EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9J A;  2WDV B;  3EUB 2;  1RWS A;  1WYG A;  3HRD D;  3P4R B;  3CWI A;  4JX1 C;  4N6E B;  1DOX A;  3AE7 B;  3CIR B;  2BS4 B;  3LXF A;  1SF0 A;  2K5P A;  3B2G A;  5AUK A;  1WRI A;  2W54 A;  1WGK A;  3KWL A;  4C80 A;  3ABV B;  2ZZF A;  1J7A A;  3FAH A;  4WQM A;  4US8 A;  1L6U A;  2CJN A;  3W9C B;  2M19 A;  3AEB B;  4N58 A;  1WNU A;  3P1M A;  4YTN B;  1CZP A;  2AX5 A;  1NVI D;  1IUE A;  1TJE A;  1E0Z A;  1OQQ A;  2E1B A;  1FM0 D;  2WP9 B;  3NVW A;  1JQ4 A;  1EWY C;  1QF6 A;  4YTM B;  1V4P A;  4FXC A;  2B76 B;  3W5U B;  1YQ4 B;  1KFY B;  1V97 A;  3B2F A;  3AM9 A;  2L83 A;  4ZOH C;  3WCQ A;  3AE9 B;  3VR8 B;  1R7S A;  3AN1 A;  2M56 B;  1SIJ A;  1NYQ A;  2Y5C A;  3AE8 B;  2HTM E;  3WQZ A;  1E7P B;  3NVV A;  2WU5 B;  2ZZG A;  3AE3 B;  1FRR A;  5C2T B;  1N5W A;  1ROE A;  3W5V B;  1XLN A;  2ZTG A;  5AUI A;  3AEF B;  3NVZ A;  3AE5 B;  1N61 A;  1DGJ A;  4N59 A;  3SR6 A;  1AYF A;  2ACZ B;  2FBW B;  2WQY B;  3FC4 A;  4YXD B;  1QLB B;  3BII D;  2K9X A;  5GXG B;  2WDQ B;  2CU3 A;  2MJE A;  3VR9 B;  5EE9 A;  3RHU A;  2EKI A;  1TYG B;  2WS3 B;  3PO0 A;  3ZYY X;  1XLO A;  1QOG A;  2W3S A;  1OQR A;  1VLB A;  1QOF A;  1YJI A;  1PUT A;  1WXQ A;  3P4S B;  1CJE A;  1A70 A;  3AE6 B;  5G5G A;  1L0V B;  3AEG B;  2L52 A;  3P63 A;  1ZP0 B;  1L6V A;  1PDX A;  1PFD A;  1RFK A;  1DOY A;  1SB3 C;  2QIE B;  3AE1 B;  4HRO A;  3NS1 A;  2BT6 A;  2PVG C;  4USA A;  2CJO A;  2MH7 A;  3L4P A;  1ZOY B;  3AEC B;  1AWD A;  3LB8 C;  4YTP B;  5EE0 A;  4ZHO A;  5MPO A;  1YQ3 B;  3RFN A;  1KRH A;  1ZUD 2;  1JRO A;  1JWB D;  1JAL A;  3AMZ A;  2G1E A;  1NI3 A;  1L5P A;  1UWM A;  3HUI A;  2MJ3 A;  3VRA B;  3AEE B;  3KEW A;  1XLP A;  2PIA A;  1V8C A;  2BS3 B;  3AB5 A;  4YSX B;  2OHF A;  1TKG A;  2PKO A;  2W55 A;  1F0Z A;  1N62 A;  1KF6 B;  1FXA A;  1WXO A;  1QT9 A;  3AED B;  3AV8 A;  3ETR A;  4JWS C;  1GPX A;  1TKE A;  5EE1 A;  3SFE B;  1J7B A;  1FMA D;  1NEK B;  2KMM A;  1E10 A;  2KAJ A;  4C7Y A;  1JWA D;  1RM6 C;  2H89 B;  1TKY A;  1N5X A;  4KX6 B;  1FO4 A;  1JRP A;  5EE3 A;  1T3Q A;  1VDV A;  2MJD A;  2PVO D;  1VJK A;  2QJL A;  3AH7 A;  4ITK A;  4ZHP A;  1B9R A;  1GAQ B;  2DBY A;  4C7Z A;  1FFU A;  4P6V F;  4YT0 B;  1N63 A;  3P4Q B;  1N60 A;  1NYR A;  2N0S B;  1V7O A;  1I7H A;  1FXI A;  4LTU A;  1E9M A;  1QOA A;  2WLB A;  5H8Y E;  2DWQ A;  1ZXI A;  2LEK A;  1OFF A;  2Q5W D;  4WWM A;  2WDR B;  1WWT A;  1JW9 D;  2ZZE A;  3AE2 B;  3AE4 B;  4YSY B;  5H92 C;  3DWM A;  1YJJ A;  2BS2 B;  1J7C A;  2E3T A;  1XLQ A;  2JX5 A;  1XO3 A;  2JQR B;  1FIQ A;  3HVZ A;  4US9 A;  1FRD A;  3NRZ A;  3P4P B;  3NVY A;  4YSZ B;  2H88 B;  5G5H A;  4HRS A;  4A9A A;  2WU2 B;  1FFV A;  5C3J B;  1NEN B;  1QOB A;  3DWG C;  3RPF C;  3SFD B;  4IDI A;  1DOI A;  2W3R A;  1RYJ A;  3VRB B;  4JWU C;  2K22 A;  3AEA B;  1E6E B; 
#chains in the Genus database with same CATH topology
 1WX7 A;  2MBB B;  3AE7 B;  3CIR B;  2BWE S;  2IGH A;  4OZC A;  4CO7 A;  3N32 A;  3H8H A;  4IM0 A;  2JWU A;  2JUO A;  1IYF A;  1IUE A;  4AWJ A;  1SJH D;  4PS7 A;  4URK A;  3GE8 C;  3MFG A;  3WCQ A;  2O6V A;  2PTL A;  2J0J A;  4LDT B;  2CU1 A;  1R4N I;  4G11 A;  1E7P B;  2LRU A;  5AUI A;  3R7Q A;  1ET6 A;  4ZRQ A;  3ZTW A;  1AYF A;  2KTR A;  2WYQ A;  2NBV B;  3PVL A;  3U7D A;  4TUU A;  3RMK C;  3X23 A;  3PO0 A;  3ZYY X;  1OQR A;  2VH2 A;  2RPQ A;  5HI1 A;  2JVC A;  5EDS A;  4WJN A;  1V1O A;  3W1S A;  2BT6 A;  2LXC A;  1KJT A;  1WR1 A;  5MPO A;  2KDM A;  4MGY E;  1AN8 A;  1L5P A;  2XEW A;  3HUI A;  3WAP A;  3ZDT A;  2CKH B;  3Q8C A;  3B1L X;  1WXO A;  1QT9 A;  3AUL A;  1LGR A;  3QCA A;  3RYT A;  2I2Y A;  4ICV A;  1JWA D;  3SD5 A;  2J52 A;  1T3Q A;  2MJD A;  3DBR B;  4DHJ B;  1GAQ B;  2WX1 A;  1OEY J;  3ZNI D;  4G50 A;  3DCG A;  3BIN A;  4K81 A;  1I7H A;  1GNU A;  4KKI A;  3JVZ X;  3K9P B;  4EOY A;  4IW0 A;  3T3O A;  2Z8L A;  4RM8 A;  3I7N A;  2IYD B;  1XD3 B;  3NRZ A;  1ZDV A;  2B5M A;  3L10 B;  1Q1O A;  4WAA A;  1YN4 A;  2C7N B;  1L2N A;  5EE0 A;  1BXT A;  2RGF A;  3A9J B;  3ECI A;  3DHI C;  2KAC A;  3UIO B;  4DXG A;  1Q0W B;  3V61 A;  2UU7 A;  4ARC A;  3LXF A;  5E6N A;  2ZZF A;  1TTN A;  1AAR A;  2LGS A;  4ANX A;  3AEB B;  4TMA B;  3PZ8 A;  2OOB B;  4A3P A;  2IUT A;  4IWQ A;  3O65 B;  2AL6 A;  3ZIM A;  2BQQ A;  2KFK B;  2INP E;  5D2M B;  2JRH A;  3VQI A;  1YN5 A;  2ZEQ A;  3BK1 A;  4RFB A;  3AEF B;  2KT7 A;  4OVZ A;  1LFD A;  4Q2J A;  2BPS A;  3BZD B;  2IO2 B;  2WDQ B;  2CU3 A;  3TEX A;  1WX9 A;  2DEN B;  1K52 A;  4BKS A;  5CTR C;  1L7Y A;  2DYM A;  3A9K A;  1T5X D;  4LCD E;  4K7S A;  2Y3U A;  4A55 A;  2WXQ A;  4XZ4 A;  1JWB D;  2KX3 A;  3DVN V;  5DCN A;  3KYD D;  2OHF A;  1U4A A;  3E9S A;  2BKF A;  2RMM A;  1FXA A;  4JWS C;  3TIX A;  2C60 A;  2KAJ A;  3DVG Y;  4XC2 A;  4DWF A;  5JHA A;  5BO4 B;  4P7I A;  2RDB C;  1P7E A;  2NTT A;  3OLM D;  4YT0 B;  4FN2 A;  2N0S B;  3V05 A;  3I7P A;  1V7O A;  3N1Z C;  2C7M B;  3K9O B;  4WJQ A;  1JW9 D;  3RCZ A;  3SDL C;  4EEW A;  4W9D A;  2Z0D B;  1QKZ A;  3H6N A;  2JT4 B;  1OGW A;  3DWG C;  3KVF B;  2NCN A;  4IKG A;  4JWU C;  1YNT E;  2K22 A;  4ZRK A;  3PZ7 A;  1RWS A;  3CST A;  3BK2 A;  5BMI A;  1Z2M A;  2RD0 A;  3TMP B;  2BS4 B;  4A90 A;  3P42 A;  5AUK A;  1SBB B;  1V86 A;  4ANV A;  4BAX A;  2J4X A;  2JWZ A;  2EMS A;  2QEJ C;  2OED A;  4BFR A;  1SJE D;  1TZ1 A;  2JY6 A;  3WIM A;  4NZL B;  2INC C;  1Y56 A;  3RUI B;  1T0Y A;  1NYQ A;  2Y5C A;  5BMG A;  1ZPS A;  4EKU A;  1UGM A;  1N6Z A;  4B95 A;  1VZ6 A;  2KYW A;  3VTU A;  4G0N B;  4N59 A;  2ZCC A;  2K8H A;  2X38 A;  3MC0 B;  3VUX A;  3RHU A;  2X8X X;  1VLB A;  4FLH A;  1YJI A;  1UD7 A;  1YIW A;  4DDI D;  1MJD A;  1P9D U;  3IG3 A;  2WXK A;  3I89 A;  2KVR A;  2MH7 A;  3UF8 A;  1C1Y B;  2LMC A;  4E74 A;  2BYT A;  2HE7 A;  5I4D A;  2KDI A;  2IO0 B;  4FBJ B;  1Q5W B;  1UH6 A;  2BW2 A;  4J6I A;  3IVF A;  3QJZ A;  2D07 B;  4DQO C;  1TS5 A;  5AZH A;  1FEH A;  4BKT A;  1JRP A;  4WJO A;  2LUM A;  1FNV A;  3WAL A;  2NTS A;  2GOW A;  2CHW A;  5KHO A;  3I7L A;  2N9L A;  4JPS A;  1QOA A;  5H8Y E;  2LVQ A;  4FJZ A;  4YSY B;  3AE4 B;  5H92 C;  2LZ6 A;  2L05 A;  3DBR I;  3I7O A;  1WGY A;  3NVY A;  2WXI A;  2GBM A;  3ZRF A;  1C4P A;  5BYQ A;  4K7W A;  4MGZ E;  2AQ1 B;  3EUB 2;  1E90 A;  2N9K A;  2ZPN A;  3VH3 B;  3ZJU A;  2ONQ A;  4BOS C;  1IPG A;  4GN1 A;  1BT0 A;  2WX0 A;  4RF0 A;  1D4B A;  2AX5 A;  1E0Z A;  3DPD A;  4TKN A;  3QWZ B;  3TBL D;  5BYS A;  4ANW A;  3A9J A;  3IT4 B;  1HE8 A;  2KDE B;  4OVU A;  2HTM E;  1KLU D;  2GBJ A;  1FRR A;  2O6V B;  3L54 A;  1TT5 B;  2M4N A;  3EGR A;  1DGJ A;  2ACZ B;  3DHH C;  1R4M B;  4GMV A;  4OVV A;  2KMA A;  2W3S A;  2KTR B;  3Q3N C;  3P4S B;  3I7K A;  1HZ6 A;  4MGI E;  3P63 A;  2KFK A;  2M17 A;  1PFD A;  1SB3 C;  1VD2 A;  4CQN A;  3RFN A;  4EFO A;  4REZ A;  3SHQ A;  3ZGZ A;  4F1S A;  4XR2 A;  3QK0 A;  4II2 B;  3RNF C;  2L1A A;  4E5Z A;  2DAJ A;  1XT9 B;  4WWO A;  5IKC M;  1BUI C;  3KUZ A;  3ZUN A;  4NJ7 A;  1WZC A;  2IPK D;  2BKR B;  4IM3 A;  1D5X C;  2V3P A;  4C7Y A;  2BTE A;  1ZDX A;  3LDZ E;  4ITK A;  4P6V F;  2K0P A;  3PRZ A;  1JRU A;  3Q3M C;  5JH5 C;  4HPP A;  2Q5W D;  5C1Z A;  1EF1 A;  3TSS A;  5LXH A;  3I7H A;  2K39 A;  4FJY A;  1V1P B;  2HD5 B;  1SE3 A;  3N20 C;  1QOB A;  3U7Z A;  1F52 A;  4HXD A;  1YMH E;  5JZE B;  1WYG A;  2G4D B;  4HCN B;  2ZOS A;  4EZL A;  1SSN A;  1D3Z A;  3R8B A;  2ICI A;  3B2G A;  3ZVV A;  1V2Y A;  3A4S C;  3PRM B;  1L4Z B;  4N58 A;  1MHH E;  4I6L B;  1C78 A;  3NVW A;  1SEB D;  1EWY C;  3W5U B;  3EC8 A;  1V6E A;  2D3B A;  4MGK E;  4O1N A;  2MX2 A;  2QMT A;  2FUG 1;  1IP9 A;  5C2T B;  1VZ8 A;  1XLN A;  4XE0 A;  4KIK B;  3NVZ A;  2Y5P A;  4TSS A;  2FBW B;  1S3S G;  5G55 A;  1HEZ E;  1UWX A;  5FR6 A;  1YQB A;  1V80 A;  2KK8 A;  3DBL B;  1RFA A;  1TYG B;  3DHG C;  2NS5 A;  4BZA A;  3ZU6 A;  1L0V B;  3AEG B;  1PGB A;  3B0A A;  4HRO A;  3PHX B;  3T3N A;  2PE9 A;  3FKY A;  2DZM A;  1JAL A;  3U52 E;  4BBN F;  4E54 A;  4KV2 A;  4NAM A;  3M62 B;  4WWP A;  4BKG A;  1LO5 D;  5G2N A;  4DHZ E;  5BMH A;  3IXS A;  1N62 A;  3AED B;  4WH4 A;  4RCO A;  1N60 A;  4YWG G;  1WXV A;  4L1B A;  3MJ5 A;  4RMA A;  1T0Q C;  2DWQ A;  3DBH B;  3QAQ A;  3AE2 B;  4WIP A;  3PS6 A;  4OHJ A;  3N30 A;  2WGS A;  3A33 B;  3N1X C;  1EO6 A;  3LJ3 A;  4PS8 A;  1WRD B;  2ON8 A;  3AEA B;  3IHP C;  4HDQ A;  1I42 A;  3UGB B;  1I4X A;  3P4R B;  3CWI A;  4I6P A;  4LNN A;  2LVP A;  1CQV A;  2I06 A;  3N1Y C;  4US8 A;  1V81 A;  3WAO A;  2R2Q A;  2MBO A;  4PT5 A;  3ZRC A;  2YEP B;  5LXI B;  1GC7 A;  3R66 C;  5FK9 C;  1NI2 A;  2D3G A;  4LNO A;  2K25 A;  2QHO A;  1MVK A;  3EEC A;  4JQW C;  5FQD A;  2FE8 A;  2GBN A;  2N1V A;  3L08 A;  2JXX A;  3AI5 A;  2NVU I;  1CMX B;  1WZ3 A;  1PDX A;  3EFC A;  4A8X C;  2W82 A;  3TEZ A;  2HJ1 A;  3AEC B;  1ZUD 2;  4PYZ A;  1FNW A;  1R4M I;  1KLG D;  3ZDM C;  3ZW7 A;  1LXD A;  1F0Z A;  2RPV A;  3PZD A;  3ZNZ B;  1J7B A;  2VRR B;  1E7U A;  4KX6 B;  4KZC A;  1VJK A;  4GGQ A;  3DVN U;  3T9L A;  1C4A A;  2YEP F;  1XEE A;  5HFY A;  2DZJ A;  4KSL C;  1BML C;  3EI3 A;  4HKQ A;  1WMH B;  2I05 A;  4AR1 A;  3ZJV A;  2EEL A;  3T8M A;  2IY1 B;  1XO3 A;  2JQR B;  3PLU A;  4US9 A;  2PLP A;  5DPS A;  1M94 A;  2N1W A;  3PLV A;  4YSZ B;  3MHZ A;  4AJY B;  2J0M A;  3ZX5 A;  3ML9 A;  1RYJ A;  3UQB A;  3ZKJ C;  3HRD D;  4ACF A;  5BYR A;  1MI0 A;  3VVW B;  1TY0 A;  3KWV A;  1WGK A;  2BYE A;  3JSV B;  3P1M A;  1V1P A;  4YTN B;  4XDC A;  4IWP A;  1CZP A;  1S1Q B;  1NVI D;  2GBK A;  4MSM B;  3PTF C;  2B76 B;  4FXC A;  3QQ8 B;  3ZTY A;  4AP4 C;  3IFW B;  2HTH A;  2I1K A;  5D94 A;  3R3M A;  3W1S C;  2INN E;  2ZTG A;  4II3 B;  2J42 A;  3VXW A;  4B0M A;  3AE5 B;  3GP7 A;  3TEY A;  2WQY B;  3I9V 1;  4B0E A;  1WH3 A;  3C0R B;  3Q69 A;  1L0X B;  2FCS A;  1QOG A;  2KKC A;  5G5G A;  1WF9 A;  4IG7 B;  2L52 A;  4M8N A;  4ASW C;  4NPN A;  1WXM A;  4KIK A;  2WHI A;  1C79 A;  3NHE B;  1UBQ A;  3ZUP A;  2G1E A;  4DHZ B;  3DBL I;  1WJN A;  3NY5 A;  2O6V D;  3ZTD A;  2D10 A;  4BOZ B;  1C77 A;  1FNU A;  3RNC C;  1YD8 U;  2DX5 B;  3ONS A;  1ET9 A;  1P98 A;  5E6O A;  2PPH A;  3Q8F A;  2JZZ A;  2L3Z A;  3CF6 E;  1E8X A;  4C7Z A;  4RF1 A;  2A5U A;  4GLS C;  1WX8 A;  1X1M A;  2J53 A;  2PMV A;  1JML A;  2ZNV C;  3IAM 1;  3BYY B;  2ZW0 A;  4C4V B;  2NBU A;  2WDR B;  3MJW A;  4LNI A;  5J18 A;  4X57 B;  3DDC B;  3DWM A;  3NUH B;  3HVZ A;  3PHW B;  3RNE C;  3P4P B;  2BYF A;  4W9K A;  2KWU B;  2YVC A;  3HVD A;  3RT3 B;  2PVO D;  1SXT A;  3PSE B;  1V49 A;  1RRB A;  3ZO5 B;  3I57 A;  3PV1 A;  4J3O D;  2JPH A;  1IBX B;  1PGX A;  1WYW B;  1ZGU B;  3PGE A;  4WQM A;  2ZW1 A;  4AR8 A;  1FCL A;  4AQ7 A;  3KQ4 A;  3UQA A;  1CK1 A;  2MQJ A;  1KFY B;  1TBE A;  4MH0 E;  3U2S C;  2KQ4 X;  3VDZ A;  2UWQ A;  3AE3 B;  1EF5 A;  1VCB A;  2NPT B;  2KMC A;  2D5G A;  1YOV B;  4M02 A;  2NR2 A;  3RZF A;  2EKI A;  2MHJ A;  2CHX A;  1D6E C;  1EM7 A;  2QIE B;  4UDU C;  2V4I B;  3NS1 A;  4ZRI A;  5JHB A;  2CJO A;  1C76 A;  3LB8 C;  3V3X A;  1L4D B;  5CHF A;  3EFU A;  2FCQ A;  5AZF A;  3VHT C;  3AEE B;  3KEW A;  1XLP A;  4HPM B;  3URY A;  3Q3O C;  1PGA A;  2HDE A;  1P1A A;  3ETR A;  2K1F A;  2E6X A;  1FMA D;  1ESF A;  4MDK E;  4DXA B;  1FFU A;  3NZS A;  4HVB A;  1GG3 A;  1HXY D;  2KAN A;  5HKH A;  4BKS D;  1QQR A;  1ZXI A;  2WXH A;  3NZ3 A;  2IUU A;  3H7P B;  4GIV A;  1XLQ A;  1WGH A;  1FIQ A;  2KLG A;  2EWJ A;  4IWO A;  1QIL A;  4A9A A;  3SFD B;  3TUO A;  2L8J A;  1WI0 A;  1WMH A;  2B3A A;  4A0A A;  3L16 A;  4XWW A;  4ARE A;  2C9W B;  1SF0 A;  2K5P A;  1WRI A;  4P1B C;  4C80 A;  4KDL B;  1L6U A;  2I1J A;  1WNU A;  3BYT B;  3EI2 A;  4XR0 A;  1IGC A;  2Y50 A;  3MC8 A;  4JL9 A;  1TS4 A;  3Q2A C;  2Y3A A;  3RZW C;  2BF8 B;  3AN1 A;  1AW7 A;  3ZW3 A;  2ZZG A;  2WU5 B;  1N5W A;  3JSV A;  2GMI C;  2MBE A;  1QLB B;  4GDK B;  3D32 A;  5IO9 A;  2M1M A;  1P7F A;  5EE9 A;  3NJT A;  3QA8 A;  4GB9 A;  1YJ1 A;  2IND C;  4W9I A;  4AJW A;  3RNA C;  1CJE A;  2MA9 B;  2EMT A;  3U4E G;  5AEK B;  4XGA B;  1DOY A;  3A1Q B;  2KD0 A;  1V4P A;  4USA A;  4FA6 A;  3GZN B;  4HLE A;  4KGT A;  1ACC A;  4HPL B;  1TIF A;  1UWM A;  2KHW B;  1V9J A;  3OJ4 B;  4W9C A;  1MG4 A;  2AL3 A;  2XK5 B;  4YSX B;  2PKO A;  3GB1 A;  4F7Z A;  2KXJ A;  4FHK A;  3WAM A;  1E5W A;  2LAS A;  4NQK E;  3E0C A;  4HEA 1;  1VDV A;  2KFJ A;  3QAR A;  2K6Q A;  1NDD A;  2V9H A;  2KC1 A;  1FXI A;  3NZU A;  4LTU A;  1R4N B;  2DAF A;  2Z59 B;  2LEK A;  4LDT D;  4WWM A;  1KLV A;  3BWU D;  4XR1 A;  3PT2 B;  4A09 A;  4MJS A;  2IBI B;  1WGG A;  2FIF A;  4ARI A;  4FAD A;  2IJ0 A;  3RPF C;  2W3R A;  4C4V A;  5C23 A;  1KM7 A;  2V3N A;  5IOI A;  1QZE A;  1WJ4 A;  1JWU D;  2KJ6 A;  2JYT A;  1E8W A;  1YX5 B;  2RR9 A;  2DLB A;  2MWS B;  3I3T B;  2DHZ A;  2KN5 A;  4YTM B;  2LGX A;  3B2F A;  2L83 A;  1R7S A;  1SE9 A;  1SIJ A;  1IBX A;  1WM2 A;  4WAF A;  3ML8 A;  2ZZP B;  2WXJ A;  4DHJ D;  4JLC A;  3VAW A;  2MJE A;  4JIO U;  1KOT A;  2HJ8 A;  3AE6 B;  1KTK A;  4RGO S;  4ZDV A;  2EKE C;  3ENE A;  2Z0E B;  1EUV B;  2MBH A;  2D3A A;  2LHD A;  4RGN A;  2M0A A;  2NPT A;  1JCK B;  2SEB D;  1P0R A;  4XYC A;  2RSU A;  3Q8B A;  5LLI A;  2PIA A;  5D7G A;  3APC A;  1HZ5 A;  2QCZ A;  2ZJD A;  4MEM A;  3PRE A;  4EZJ A;  1T0S C;  4GDL B;  2YLM A;  4XDD A;  1GPX A;  5FKA C;  5D6J B;  2H89 B;  4NAW B;  3APF A;  4L23 A;  3BVG A;  4LJO B;  3VUY A;  1B9R A;  4K1R B;  2FID A;  1UBI A;  4K3B A;  3R2I A;  2BYV E;  2R61 A;  1XF5 L;  4W9F A;  3HK0 A;  2ASQ A;  1OFF A;  5DPT A;  4F8C B;  3RI7 C;  3NG0 A;  2PW9 A;  2N7D A;  1J7C A;  3A4R A;  5D3I B;  3KLS X;  2WXG A;  1UUP A;  1RAX A;  3ALB A;  4GU2 A;  5C3J B;  1FPY A;  2LGY A;  2IY0 B;  1I4P A;  4QAY A;  3EA6 A;  1DOI A;  1HA5 A;  2WDV B;  2D11 A;  3MP9 A;  5J2R A;  2MW5 A;  2IDY A;  4GSW A;  3H7P A;  1F77 A;  2W54 A;  2KDF B;  2J7Q B;  2CS4 A;  4RGT A;  2CR5 A;  3W9C B;  1XCQ L;  4KZ0 A;  3E56 A;  1XQQ A;  2G45 B;  1EU4 A;  4OZA A;  3R2T A;  4MH8 A;  2TSS A;  1A5R A;  4W9H A;  1XXG A;  4E71 A;  1JQ4 A;  1C4C A;  2G3Q B;  4ZOH C;  2M8S A;  2NBW B;  4R3D A;  2L0F A;  4GOC A;  4LK0 M;  4HWI B;  3FC4 A;  5JXV A;  1V5T A;  1WXQ A;  2D3C A;  1Q10 A;  3HHM A;  4CHK A;  2V1Y A;  3H7S A;  3LYY A;  2FUH B;  2GBR A;  2AEH A;  4GDK A;  2JZP A;  4OZB A;  2B5L A;  2IZV B;  4HKZ E;  2KWV B;  2MLB A;  4MAC A;  1C9F A;  1SIF A;  2FAZ A;  3AV8 A;  5EE1 A;  2KMM A;  2QIL A;  2MCN B;  3A1Q A;  3IT6 B;  1RM6 C;  1TKY A;  3B08 A;  5EE3 A;  2QJL A;  1WE6 A;  4FUL A;  2PEA A;  4C00 A;  4CI1 A;  3VUW A;  3VH4 B;  3SU8 X;  4PYU A;  2XK5 A;  5DPW A;  3V60 A;  3L13 A;  4HJG E;  3HM6 X;  2JX5 A;  4NJ6 A;  2NMQ A;  2VH1 A;  3Q8A A;  2H88 B;  1NEN B;  3HIZ A;  4GXB A;  3ZWD A;  4N6E B;  2C5L C;  5LNK 1;  1GC6 A;  1H4R A;  1WE7 A;  2KX0 A;  5CHV C;  3V6E B;  1WR6 E;  1J7A A;  2CJN A;  1P3Q U;  3APD A;  1OQQ A;  2MBQ A;  4K7U A;  3TCA A;  3Q8E A;  3M95 A;  3AE9 B;  3ZJT A;  1EWC A;  4MEL A;  3VTW A;  1EU3 A;  4MT5 A;  2WDT B;  2MEK A;  2WXO A;  3Q3F A;  2J0K A;  4ANU A;  2WXR A;  3HM3 A;  4CYE A;  3MTN B;  3U30 A;  1WM3 A;  4M0W B;  2WS3 B;  1J19 A;  4NY0 A;  1WFY A;  2LI5 A;  2LXA A;  1ZKH A;  1K53 A;  3QX1 A;  4ARF A;  2AYO B;  2KO3 A;  1MHX A;  4CI3 A;  2Y5B B;  3UIP B;  4E3C A;  3AE1 B;  3I8E A;  1ZOY B;  2PE6 B;  3U8Z A;  3AMZ A;  1YN3 A;  1TS2 A;  5E6J A;  3H1U A;  1UEL A;  3AB5 A;  2G9H D;  4IC7 B;  1B1Z A;  3JW0 X;  4JGH B;  2MP2 B;  2KOX A;  1I4Q A;  1OEY A;  4RH6 A;  1FO4 A;  3PPA A;  3RFZ B;  3MHS D;  4LJP B;  1N63 A;  3P4Q B;  3DVG X;  1D5M C;  2IUS A;  4TZ4 A;  1WZ0 A;  2KC2 A;  2WLB A;  2JXT A;  2KVZ A;  4GDL A;  2BB5 A;  4AUQ C;  1LQB A;  2BGF A;  3H9D A;  1ECR A;  2O2V B;  4NAW A;  2VZK B;  1D5Z C;  5G5H A;  4I6N B;  4MJS B;  1K50 A;  3VRB B;  3B9J A;  4AOF A;  2KLC A;  4BBN C;  1KH0 A;  4JX1 C;  2LJ5 A;  2UYZ B;  2LRW A;  1ISN A;  1VRA B;  2M19 A;  3KUC B;  3EHV A;  4A6Q A;  1TJE A;  2E1B A;  1FM0 D;  2WP9 B;  4M00 A;  4A0B A;  2IGD A;  3NS8 A;  4EE2 A;  1V97 A;  2KZR A;  2N9X A;  2QSD A;  1L0Y B;  3WQZ A;  2DZI A;  4OW0 A;  3AE8 B;  3NVV A;  4DK5 A;  3M3J A;  3DBH I;  1WGR A;  3ZLZ A;  1E8Y A;  2BWF A;  1ENF A;  2GRI A;  3NOB A;  4PS3 A;  4KDI C;  2IO3 B;  3GOE A;  5GXG B;  4AS1 A;  4WJP A;  4DBG A;  4JE3 B;  3RD2 A;  1OTR B;  4M8M A;  3MC9 A;  2K8C A;  2JF5 A;  3I63 C;  4MM3 B;  1HTQ A;  1ZP0 B;  1YX6 B;  1VR9 A;  3W5V B;  2PVG C;  5D3D A;  1T6B X;  1AWD A;  4LNK A;  1KRH A;  3V62 A;  3VRA B;  1MPE A;  1J0G A;  4PK1 A;  4NQL B;  2W55 A;  3UIN B;  4W9J A;  4ZYS A;  2KDB A;  3WAN A;  4CI2 A;  3P2B A;  4A08 A;  2KQS A;  1N5X A;  3OAW A;  2JYE A;  1RLF A;  3AH7 A;  4P1C C;  2MSE D;  1SGH A;  4HDO A;  2KTF A;  2LGD A;  4XWT A;  3V6C B;  3ZWK A;  3L0W B;  2D2Q A;  3I5J C;  2GI9 A;  1E9M A;  3AU4 A;  1G6J A;  1XVI A;  2LVO A;  3RN9 C;  1WWT A;  1F2R I;  4YL8 A;  2BS2 B;  2E3T A;  2G4S A;  5GMV A;  3FIL B;  4BVU C;  4TQ0 A;  4WWN A;  1FFV A;  2V0G A;  1H8C A;  1TZO A;  1GJZ A;  3Q6B A;  4WUR A;  1UNS A;  2AQ3 B;  1GB1 A;  1GUA B;  3QHT A;  2ZVN A;  4FHJ A;  5KHQ A;  3QIJ A;  3KH0 A;  2KN4 A;  2WWZ A;  4NNJ B;  3EI4 A;  1F1H A;  2BBC A;  3IBE A;  2CHZ A;  1PYW D;  4DXF A;  4HJK A;  3AM9 A;  2FCN A;  3VR8 B;  1VZ7 A;  2C7H A;  1E8Z A;  4MSQ B;  4L2Y A;  2SAK A;  1MG8 A;  2WXL A;  3SR6 A;  3C19 A;  3BII D;  1I4H A;  2N4F A;  3KUD B;  1JWM D;  1XLO A;  1F2R C;  1UF0 A;  2L7R A;  4EUT A;  5AZG A;  3BY4 B;  1WJU A;  1OQY A;  4YTP B;  3N3K B;  2KQ7 A;  2DZK A;  1NI3 A;  2XNA C;  4W9G A;  4M0W A;  1V8C A;  2N7J A;  1UGJ A;  2ZVO A;  2GLS A;  3L17 A;  2KJH B;  2PJH A;  1KF6 B;  1ZXH A;  2BVC A;  4ZYN A;  1SE4 A;  1SE2 A;  4RNA A;  2RDG A;  2XBB C;  1PQS A;  2OJW A;  4WQO B;  5IAA C;  3GS2 A;  4IM2 A;  2N7E A;  3RNB C;  2WXM A;  3ZTC A;  2BB6 A;  2XN9 C;  1TGZ B;  4KVG B;  2GB1 A;  4HK2 A;  3DQV A;  2MP2 A;  2LUE A;  2ZZE A;  3CSF A;  1FD6 A;  2WNM A;  3ZXR A;  1YJJ A;  4TQ1 A;  3QC8 B;  2JSV X;  5L83 A;  4LNF A;  2K6D B;  1ZE3 D;  4W9L A;  2W9N A;  4ZRP A;  2AQ2 B;  1DOX A;  1TS3 A;  2O2V A;  1M4V A;  2KWD A;  3ABV B;  3KYC D;  4D2K A;  2WXN A;  1I4G A;  4TV3 A;  3W1Y A;  1DYQ A;  1QF6 A;  3VTV A;  3J9C A;  1TY2 A;  3X0W A;  2KWC A;  3DBS A;  4XR3 A;  3RNG C;  2M56 B;  2R2O A;  3ZXV A;  3O13 A;  2V3S A;  3ZQ4 A;  1WY8 A;  3R7R A;  2K3U A;  4A20 A;  4YXD B;  2K9X A;  5CHW A;  1K51 A;  2ZCB A;  3IAS 1;  1NBF C;  2Y6I A;  1QOF A;  4FJV B;  4ZRJ A;  1A70 A;  4LLG M;  1RFK A;  2LGI A;  2HYE A;  1MFW A;  4AR9 A;  4A3O A;  3L4P A;  4ZHO A;  1C3T A;  2JZ3 B;  5TR5 A;  1YQ3 B;  2LJI A;  1IGD A;  1JRO A;  4G3X B;  5IP4 D;  1STE A;  2MJ3 A;  5T8I A;  1TKG A;  3OWE B;  2DYO A;  4MM3 A;  3GE3 C;  3UI3 A;  2WXP A;  3PRP B;  3TL5 A;  1XCT L;  1UZX B;  2LFI A;  4ICU A;  4ZHP A;  3ZX4 A;  2DBY A;  2L76 A;  3C8Y A;  1GB4 A;  3DOW A;  3WA0 A;  2ZNV B;  4RGM A;  2MRP A;  1I4R A;  1Y8R C;  1HQR D;  3OG5 A;  4KGR A;  3RUL A;  4DDG D;  1F9J A;  1V5O A;  2L32 A;  2JRI B;  4EZK A;  1ZW7 A;  3VFK A;  4P16 A;  1J8C A;  1FXT B;  4KSK C;  1GOZ A;  2K8B A;  2LWP A;  4A11 A;  1E7V A;  4IUM B;  3OJ3 A;  5IA7 A;  3KW5 B;  5IN7 A;  2DNF A;  2ZPY A;  2M0X A;  3SEB A;  1WJ6 A;  3KWL A;  3FAH A;  4C56 C;  1WSP A;  3FIL A;  4XX5 A;  5CX3 A;  5J17 A;  2OJR A;  2KJR A;  3AXC A;  3BVM A;  2IGG A;  2LHE A;  2REX A;  4M01 A;  2LD9 A;  5HHD G;  4HCP B;  1YQ4 B;  1WXS A;  3ZNH B;  4NJC A;  5L95 C;  2VZK D;  3A9K B;  4S0R A;  2JU6 X;  1ROE A;  2WXF A;  1N61 A;  2N9P C;  4KGS A;  2QC8 A;  3VR9 B;  3ZNG C;  3BVZ A;  3AU5 A;  1PUT A;  3M63 B;  4B9K A;  3W2D A;  1L6V A;  5FR3 A;  1HTO A;  5E6P A;  2AWT A;  2DYB A;  5TSS A;  1K8R B;  1WXA A;  4H2A A;  2KNB A;  2BS3 B;  4B6W A;  3EI1 A;  4RM9 A;  2FCM A;  1WGD A;  1WIA A;  1TKE A;  3SFE B;  1NEK B;  1E10 A;  1LM8 B;  3I8C A;  2A4Z A;  4IOI E;  1I35 A;  4K3C A;  4N9F 4;  2RDH A;  3Q14 C;  4W9E A;  1NYR A;  2FNJ B;  1FCC C;  1T0R C;  3TJP A;  4KKJ A;  2V4L A;  2IO1 B;  2QDF A;  3N9Y C;  4S17 A;  3CMM B;  2I38 A;  2L00 B;  3S2A A;  1FRD A;  1Z5S B;  1JWS D;  3Q3J A;  5DPR A;  2L0T A;  3GZN I;  3JYU A;  2WU2 B;  4HRS A;  5HG2 A;  2N9E B;  3TEW A;  4IDI A;  1E6E B; 
#chains in the Genus database with same CATH homology
 3B9J A;  1YMH E;  1KH0 A;  1WYG A;  4JX1 C;  4A0A A;  3AE7 B;  4XWW A;  3CIR B;  4OZC A;  2IGH A;  1SSN A;  3R8B A;  4ARE A;  1SF0 A;  2ICI A;  2K5P A;  3B2G A;  1WRI A;  3H8H A;  4C80 A;  2JWU A;  1L4Z B;  1L6U A;  1VRA B;  2M19 A;  4N58 A;  1WNU A;  3BYT B;  3EI2 A;  4XR0 A;  1MHH E;  1IGC A;  1IUE A;  1TJE A;  4A6Q A;  2E1B A;  2Y50 A;  1SJH D;  1FM0 D;  1C78 A;  2WP9 B;  3NVW A;  1SEB D;  1TS4 A;  1EWY C;  4A0B A;  2IGD A;  3W5U B;  3MFG A;  2Y3A A;  4EE2 A;  1V97 A;  3WCQ A;  2PTL A;  2QSD A;  1L0Y B;  3AN1 A;  1AW7 A;  4O1N A;  3WQZ A;  4OW0 A;  3AE8 B;  1E7P B;  3NVV A;  2WU5 B;  2ZZG A;  2QMT A;  2FUG 1;  5C2T B;  1N5W A;  1VZ8 A;  1XLN A;  4XE0 A;  5AUI A;  1ET6 A;  3NVZ A;  1ENF A;  2Y5P A;  4TSS A;  2GRI A;  4ZRQ A;  1AYF A;  2FBW B;  1HEZ E;  1QLB B;  4GDK B;  5GXG B;  4AS1 A;  1UWX A;  1P7F A;  5EE9 A;  1TYG B;  4JE3 B;  3PO0 A;  3ZYY X;  1OQR A;  5HI1 A;  1CJE A;  1L0V B;  3AEG B;  4MM3 B;  1PGB A;  1ZP0 B;  3U4E G;  1VR9 A;  1DOY A;  1V1O A;  3W1S A;  4HRO A;  3W5V B;  2BT6 A;  2PVG C;  4USA A;  1T6B X;  5D3D A;  1V4P A;  3T3N A;  1AWD A;  5MPO A;  2KDM A;  4KGT A;  1KRH A;  1ACC A;  1JAL A;  3U52 E;  1AN8 A;  1L5P A;  1UWM A;  3HUI A;  3VRA B;  4E54 A;  4NAM A;  1LO5 D;  1MPE A;  4YSX B;  5BMH A;  2PKO A;  2W55 A;  3IXS A;  3GB1 A;  1N62 A;  3Q8C A;  1WXO A;  1QT9 A;  3AED B;  4ZYS A;  4CI2 A;  4A08 A;  2I2Y A;  1JWA D;  2J52 A;  1N5X A;  3E0C A;  4HEA 1;  1T3Q A;  1VDV A;  2JYE A;  2MJD A;  4RCO A;  4WH4 A;  3AH7 A;  1GAQ B;  4XWT A;  1N60 A;  4YWG G;  4L1B A;  3MJ5 A;  1I7H A;  1FXI A;  2GI9 A;  4LTU A;  4KKI A;  1E9M A;  2DWQ A;  2LEK A;  3T3O A;  4WWM A;  1WWT A;  3BWU D;  2Z8L A;  1F2R I;  3AE2 B;  4WIP A;  4XR1 A;  2BS2 B;  4OHJ A;  2E3T A;  3I7N A;  4A09 A;  3NRZ A;  1ZDV A;  3FIL B;  4ARI A;  2B5M A;  4TQ0 A;  1FFV A;  2IJ0 A;  2V0G A;  3RPF C;  1TZO A;  2W3R A;  1YN4 A;  4WUR A;  5EE0 A;  2ON8 A;  1BXT A;  3AEA B;  1I4X A;  1UNS A;  2KAC A;  4DXG A;  3P4R B;  3CWI A;  2V3N A;  2AQ3 B;  1GB1 A;  4ARC A;  1JWU D;  3LXF A;  1CQV A;  2I06 A;  2JYT A;  2ZZF A;  4US8 A;  2DLB A;  2KN4 A;  3AEB B;  3EI4 A;  2BBC A;  4TMA B;  3PZ8 A;  2IUT A;  4PT5 A;  4YTM B;  1PYW D;  2YEP B;  4DXF A;  3B2F A;  3AM9 A;  2L83 A;  5FK9 C;  3VR8 B;  1R7S A;  2INP E;  1SIJ A;  1VZ7 A;  3VQI A;  1IBX A;  1MVK A;  1YN5 A;  3BK1 A;  4WAF A;  4L2Y A;  2SAK A;  4RFB A;  3AEF B;  2WXJ A;  4OVZ A;  4Q2J A;  5FQD A;  2WXL A;  3SR6 A;  2FE8 A;  3BII D;  1I4H A;  3BZD B;  2WDQ B;  2CU3 A;  2MJE A;  1JWM D;  3TEX A;  1XLO A;  1K52 A;  1F2R C;  3AE6 B;  1KTK A;  4RGO S;  1PDX A;  4A8X C;  2DYM A;  2W82 A;  3TEZ A;  1T5X D;  3AEC B;  2LHD A;  4YTP B;  4RGN A;  2M0A A;  2SEB D;  1JCK B;  2WXQ A;  1ZUD 2;  4A55 A;  2Y3U A;  1JWB D;  1FNW A;  1KLG D;  1NI3 A;  2XNA C;  3Q8B A;  2PIA A;  5D7G A;  4M0W A;  1V8C A;  2N7J A;  1HZ5 A;  1UGJ A;  2OHF A;  3E9S A;  1F0Z A;  2RPV A;  1KF6 B;  1ZXH A;  1FXA A;  2RMM A;  1SE4 A;  1SE2 A;  4GDL B;  2RDG A;  4JWS C;  4RNA A;  4XDD A;  1GPX A;  5FKA C;  3GS2 A;  1J7B A;  2KAJ A;  2H89 B;  4KX6 B;  4NAW B;  4L23 A;  3BVG A;  1VJK A;  2WXM A;  1B9R A;  1P7E A;  2NTT A;  1C4A A;  2YEP F;  1XEE A;  4YT0 B;  2BB6 A;  2XN9 C;  2N0S B;  3V05 A;  5HFY A;  3R2I A;  3I7P A;  1V7O A;  1BML C;  3EI3 A;  2R61 A;  1XF5 L;  4HKQ A;  2GB1 A;  1OFF A;  2I05 A;  4AR1 A;  1JW9 D;  2ZZE A;  3ZJV A;  1FD6 A;  2WNM A;  2EEL A;  1YJJ A;  2PW9 A;  1J7C A;  5D3I B;  1XO3 A;  2JQR B;  3KLS X;  4TQ1 A;  4US9 A;  2JSV X;  1QKZ A;  2PLP A;  2WXG A;  1UUP A;  4YSZ B;  5C3J B;  3MHZ A;  1I4P A;  1ZE3 D;  3DWG C;  3EA6 A;  4IKG A;  1DOI A;  1RYJ A;  4JWU C;  1YNT E;  2K22 A;  1HA5 A;  4ZRP A;  2WDV B;  3PZ7 A;  1RWS A;  2AQ2 B;  3BK2 A;  3HRD D;  3MP9 A;  5BMI A;  1DOX A;  5BYR A;  2IDY A;  1MI0 A;  1TS3 A;  2BS4 B;  4A90 A;  1TY0 A;  3P42 A;  1F77 A;  5AUK A;  1M4V A;  1SBB B;  1WGK A;  2KWD A;  2W54 A;  3KWV A;  3ABV B;  4RGT A;  2J4X A;  4D2K A;  2QEJ C;  2WXN A;  3W9C B;  1XCQ L;  2OED A;  3E56 A;  3P1M A;  1V1P A;  1I4G A;  4XDC A;  1EU4 A;  4OZA A;  4YTN B;  1CZP A;  3R2T A;  4MH8 A;  2TSS A;  1NVI D;  1SJE D;  1XXG A;  1JQ4 A;  1DYQ A;  1C4C A;  1QF6 A;  3J9C A;  1TY2 A;  4FXC A;  2B76 B;  4NZL B;  1Y56 A;  4ZOH C;  4XR3 A;  2M56 B;  1NYQ A;  2Y5C A;  4R3D A;  3O13 A;  5BMG A;  1ZPS A;  2INN E;  2ZTG A;  1VZ6 A;  4LK0 M;  2J42 A;  3ZQ4 A;  4B0M A;  3AE5 B;  4N59 A;  3GP7 A;  3TEY A;  2K3U A;  2WQY B;  3FC4 A;  3I9V 1;  4B0E A;  4YXD B;  2K9X A;  2X38 A;  3Q69 A;  1L0X B;  1K51 A;  3MC0 B;  5JXV A;  3RHU A;  3IAS 1;  1QOG A;  2Y6I A;  1VLB A;  1QOF A;  1YJI A;  1WXQ A;  1A70 A;  1Q10 A;  5G5G A;  4LLG M;  2L52 A;  1RFK A;  2LGI A;  2HYE A;  2WXK A;  3I89 A;  4AR9 A;  2MH7 A;  3LYY A;  3L4P A;  4ZHO A;  2LMC A;  1YQ3 B;  1C79 A;  2LJI A;  1IGD A;  2BYT A;  1JRO A;  2G1E A;  5I4D A;  2JZP A;  1STE A;  2MJ3 A;  5T8I A;  4OZB A;  2B5L A;  4HKZ E;  1TKG A;  2BW2 A;  4MAC A;  1C9F A;  3OWE B;  2DYO A;  3AV8 A;  1C77 A;  1FNU A;  5EE1 A;  2KMM A;  3UI3 A;  2QIL A;  4DQO C;  2WXP A;  1ET9 A;  1TS5 A;  1RM6 C;  3IT6 B;  1TKY A;  3Q8F A;  1FEH A;  1XCT L;  1JRP A;  5EE3 A;  2QJL A;  2LFI A;  4ZHP A;  2LUM A;  2DBY A;  4C7Z A;  4RF1 A;  3C8Y A;  4GLS C;  1GB4 A;  4CI1 A;  2J53 A;  1FNV A;  2NTS A;  2PMV A;  1JML A;  3IAM 1;  3BYY B;  4RGM A;  2N9L A;  4JPS A;  3I7L A;  2ZW0 A;  1QOA A;  1I4R A;  5H8Y E;  1HQR D;  4KGR A;  4HJG E;  2WDR B;  4YSY B;  3AE4 B;  5H92 C;  3DWM A;  3NUH B;  2JX5 A;  3HVZ A;  3I7O A;  2L32 A;  2NMQ A;  3P4P B;  3NVY A;  3Q8A A;  2H88 B;  2WXI A;  4P16 A;  1NEN B;  3HVD A;  1C4P A;  5BYQ A;  2PVO D;  2AQ1 B;  3EUB 2;  1SXT A;  2N9K A;  1GOZ A;  4N6E B;  4A11 A;  3I57 A;  4J3O D;  1IBX B;  1PGX A;  5LNK 1;  3ZJU A;  2ONQ A;  3SEB A;  3KWL A;  1J7A A;  3FAH A;  4C56 C;  4WQM A;  2ZW1 A;  1WSP A;  2CJN A;  3FIL A;  4RF0 A;  4AR8 A;  1D4B A;  2AX5 A;  1FCL A;  1E0Z A;  1OQQ A;  4AQ7 A;  3BVM A;  2IGG A;  2LHE A;  5HHD G;  3KQ4 A;  1CK1 A;  1YQ4 B;  1KFY B;  5BYS A;  3IT4 B;  3Q8E A;  3U2S C;  3AE9 B;  4NJC A;  1EWC A;  3ZJT A;  2KQ4 X;  2VZK D;  2HTM E;  1EU3 A;  4MT5 A;  2MEK A;  1KLU D;  3AE3 B;  1FRR A;  2JU6 X;  1ROE A;  2WXF A;  2WXO A;  3EGR A;  1N61 A;  1DGJ A;  2ACZ B;  2WXR A;  2D5G A;  4KGS A;  3VR9 B;  2EKI A;  2WS3 B;  3BVZ A;  2W3S A;  1PUT A;  3P4S B;  3I7K A;  1HZ6 A;  1K53 A;  3W2D A;  4ARF A;  3P63 A;  1MHX A;  1D6E C;  1L6V A;  1EM7 A;  1PFD A;  4CI3 A;  5FR3 A;  1SB3 C;  2QIE B;  3AE1 B;  2V4I B;  3NS1 A;  4UDU C;  3I8E A;  2CJO A;  1C76 A;  1ZOY B;  3LB8 C;  3V3X A;  1L4D B;  4CQN A;  3RFN A;  4REZ A;  3ZGZ A;  5TSS A;  3AMZ A;  4XR2 A;  1YN3 A;  1TS2 A;  3AEE B;  4H2A A;  1XLP A;  2L1A A;  5E6J A;  3KEW A;  2BS3 B;  3URY A;  3EI1 A;  3AB5 A;  4E5Z A;  1PGA A;  2G9H D;  1BUI C;  1B1Z A;  2HDE A;  3ETR A;  1TKE A;  2IPK D;  3SFE B;  2E6X A;  1FMA D;  1D5X C;  1ESF A;  1NEK B;  2V3P A;  1E10 A;  4C7Y A;  1I4Q A;  2BTE A;  4IOI E;  3I8C A;  4RH6 A;  1ZDX A;  1FO4 A;  3RFZ B;  4ITK A;  1FFU A;  2RDH A;  4P6V F;  1N63 A;  3P4Q B;  1NYR A;  2K0P A;  1D5M C;  2IUS A;  1FCC C;  1HXY D;  4TZ4 A;  4KKJ A;  1QQR A;  2WLB A;  1ZXI A;  2JXT A;  2Q5W D;  2WXH A;  3NZ3 A;  2BB5 A;  2IUU A;  3N9Y C;  3TSS A;  3I7H A;  1ECR A;  2I38 A;  1XLQ A;  1FIQ A;  1FRD A;  2VZK B;  2EWJ A;  1D5Z C;  1JWS D;  1V1P B;  1QIL A;  5G5H A;  4HRS A;  4A9A A;  2WU2 B;  1SE3 A;  5HG2 A;  1QOB A;  3SFD B;  3TUO A;  3TEW A;  1K50 A;  4IDI A;  3U7Z A;  3VRB B;  1E6E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...