1TKGA

Crystal structure of the editing domain of threonyl-trna synthetase complexed with an analog of seryladenylate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
224
Chain Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Threonyl-tRNA synthetase
total genus 72
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tkgA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tkgA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tkgA02
5AUIA 1NVID 1QOGA 4C7ZA 1TKYA 2PKOA 3P4PB 5C3JB 4ZOHC 1WXOA 1FXAA 1GAQB 2WS3B 3NVZA 3AE2B 1F0ZA 1YQ4B 3HVZA 1FFUA 2W3RA 3VR8B 3AV8A 3AM9A 1J7CA 1JW9D 2FBWB 1NYRA 4US9A 1V7OA 1L0VB 1FO4A 2E1BA 2KMMA 2WU5B 3P63A 3CIRB 4YT0B 1CJEA 1V8CA 2JQRB 1ROEA 1QT9A 5G5GA 2ZZEA 2Q5WD 4N58A 1GPXA 1PFDA 3NRZA 1JROA 4C7YA 4YSXB 3RPFC 1NENB 1N60A 1OFFA 1WXQA 3B2GA 3AE7B 3AEAB 2AX5A 3FC4A 1N63A 1J7AA 2MH7A 1ZUD2 2DWQA 4P6VF 1NYQA 3LB8C 4A9AA 4JX1C 4YTMB 1N62A 2HTME 1B9RA 1QLBB 4YTPB 3AB5A 1YQ3B 3W9CB 1JALA 1QF6A 3KEWA 3WQZA 1OQRA 3RFNA 1L5PA 1L6VA 2QJLA 3AEGB 1DOIA 1DGJA 3P4SB 3B9JA 3HUIA 4ZHPA 5EE0A 1ZXIA 1VJKA 2CU3A 2L52A 1ZP0B 1TKEA 2K5PA 3NS1A 3VR9B 3BIID 2W3SA 3AN1A 2B76B 3AECB 4ZHOA 1TYGB 2OHFA 1XO3A 3AEBB 4LTUA 1DOYA 2BS4B 1L6UA 1E10A 3AH7A 1JWAD 1UWMA 1QOBA 2MJ3A 2ACZB 2W55A 3AEEB 3EUB2 1WRIA 2Y5CA 3NVYA 1RM6C 1SF0A 5AUKA 5C2TB 2W54A 4USAA 5EE9A 1YJIA 2H88B 4ITKA 1SIJA 2PIAA 1E9MA 2JX5A 4WWMA 4IDIA 2ZTGA 1KFYB 4JWUC 2E3TA 1WNUA 1E0ZA 3HRDD 1NI3A 2CJNA 1VDVA 1EWYC 4YXDB 5EE3A 2WP9B 1KF6B 3DWMA 1FIQA 1KRHA 3P1MA 3RHUA 1WGKA 3ZYYX 1RYJA 4WQMA 5GXGB 1QOFA 1WWTA 2BS2B 2WDQB 1RWSA 1FFVA 1QOAA 5EE1A 2WLBA 5H92C 3FAHA 3B2FA 1N5WA 1DOXA 2LEKA 1A70A 3SR6A 3AE9B 4HROA 5MPOA 2M19A 4C80A 3AE5B 1SB3C 2M56B 1AYFA 3AE3B 1PDXA 3ETRA 3W5UB 2G1EA 1WYGA 1JRPA 1FRRA 3AE8B 3VRBB 4JWSC 3ABVB 1NEKB 1VLBA 2EKIA 1RFKA 2H89B 2K9XA 2PVOD 3W5VB 1FRDA 3AE1B 3AEFB 2WQYB 1R7SA 3AEDB 4FXCA 4N59A 2MJEA 3VRAB 2WU2B 1IUEA 1FXIA 2MJDA 5H8YE 3L4PA 2PVGC 3KWLA 1E7PB 3NVVA 2ZZFA 3LXFA 1XLPA 3P4RB 4KX6B 3AE4B 1PUTA 3NVWA 1JWBD 2QIEB 2K22A 3CWIA 2BS3B 2CJOA 1XLOA 1J7BA 2L83A 4HRSA 1I7HA 1XLQA 2N0SB 4YTNB 3P4QB 1XLNA 1E6EB 1V97A 4US8A 1JQ4A 1CZPA 1TJEA 4N6EB 1N61A 1T3QA 2ZZGA 1ZOYB 3SFEB 1FM0D 3AMZA 2WDVB 1AWDA 2BT6A 1YJJA 3DWGC 1FMAD 1TKGA 2WDRB 3WCQA 3PO0A 2KAJA 5G5HA 3AE6B 4YSYB 1N5XA 4YSZB 2DBYA 1V4PA 1OQQA 3SFDB
chains in the Genus database with same CATH superfamily
1WGHA 1NVID 2AYOB 3CSFA 4OHJA 2C9WB 4MDKE 2I1JA 1X1MA 1FO4A 3QWZB 4BOZB 4RCOA 2J52A 1YJ1A 3Q8FA 3EI1A 4CI1A 3R3MA 4F8CB 3MTNB 1G6JA 2DYBA 4NAMA 3ZWDA 1L6VA 4ZYSA 2MSED 3DBSA 3I8EA 3DHHC 3ML9A 1ZXIA 4ZDVA 1RRBA 1NI2A 3B08A 3AECB 2R2OA 1F2RC 1V6EA 4LNFA 3TIXA 5EE9A 3RNGC 3A33B 2E3TA 2DAFA 3HK0A 2I05A 4XX5A 2KWVB 1KRHA 2N9LA 1FD6A 4W9GA 2CR5A 2KTRB 5EE1A 3IHPC 3T3NA 3TEYA 1A70A 3E0CA 3L16A 3ZUNA 2INCC 4TZ4A 3FKYA 4MJSB 3W5UB 2D10A 2EKIA 5D3IB 2IJ0A 4DK5A 3AEFB 1IUEA 2HYEA 1WMHB 3HVDA 4KX6B 1IGCA 1JWBD 5IN7A 2BS3B 3ZTCA 1WIAA 4KKJA 1CZPA 3NS8A 2KFJA 4W9DA 3A4SC 2PTLA 1V2YA 1WJ6A 2MA9B 2MX2A 3SD5A 5D3DA 4DWFA 3VXWA 1KLGD 1R4NI 3H1UA 1BMLC 4BAXA 1YQ4B 1ZW7A 3LDZE 1NYRA 1SE9A 4RH6A 3ECIA 2MP2B 4BFRA 1OGWA 4MELA 2ON8A 4IC7B 1QT9A 5G5GA 2KD0A 2DENB 4RMAA 4PYUA 3R8BA 3VDZA 2LVOA 4FHJA 2JRIB 4XR3A 2ZW1A 3FC4A 5IA7A 4JX1C 1QZEA 5CTRC 2OOBB 1PGXA 1YQ3B 1XF5L 4II2B 2QJLA 1U4AA 2NTTA 1E8WA 2FE8A 2LVQA 5EE0A 1LQBA 4IM2A 2IUSA 3QAQA 1J19A 1AW7A 3QQ8B 3VHTC 1E90A 3NHEB 2VRRB 4XDCA 4LTUA 4FADA 1V1PB 2RGFA 3I7NA 1JWAD 5FR6A 2GI9A 2UYZB 4BBNC 5L95C 4ITKA 2PIAA 4XR0A 1C78A 1BXTA 4JWUC 4I6LB 3TEZA 1VDVA 5JH5C 3MJ5A 1WGKA 1PGBA 1C4AA 3M3JA 2IO0B 3KH0A 4CI2A 2ZCBA 4PS8A 2GOWA 5MPOA 4K7UA 3DVNV 2BBCA 3UIOB 3VRBB 3PLVA 2PVOD 3ZNHB 4WURA 4N59A 3L0WB 3PS6A 3RNFC 1UZXB 4JIOU 2K3UA 2K22A 1E6EB 4HDOA 3SEBA 1FM0D 3RNEC 1TS3A 4MH8A 2RDHA 2WDRB 4J3OD 1T0SC 1TZOA 2IGGA 4E71A 1TZ1A 5BMHA 1MHXA 2RMMA 2KDEB 2O2VB 3AV8A 1GG3A 4EZJA 2RR9A 4IKGA 3QX1A 2HE7A 5G2NA 1RAXA 2V0GA 2J53A 5L83A 3NRZA 2AEHA 3UI3A 1Z5SB 3ZQ4A 1TS2A 4YTMB 2KWDA 3V3XA 5FR3A 1WR6E 1QLBB 4YTPB 5D2MB 1C77A 3WQZA 2EELA 3ZDTA 2EKEC 4EEWA 2L52A 4G0NB 1JWUD 2IDYA 5HI1A 1I4XA 2L8JA 4EZLA 4MM3A 3RNCC 5DPSA 4W9IA 4GIVA 3IT6B 1KFYB 1HE8A 4GDLA 3DBHB 3TCAA 2WNMA 4K7WA 2DLBA 1JMLA 2V3PA 3P1MA 4WQMA 4WAAA 2CS4A 5J17A 4GSWA 1FFVA 3PZDA 4AJWA 4A09A 2TSSA 1ZGUB 4RF0A 4DHJD 4DXGA 2CU1A 4AQ7A 2YEPF 5E6NA 3U2SC 5HHDG 1XLPA 4MH0E 3Q2AC 4IWPA 3OG5A 2ZOSA 1D6EC 4P16A 4HVBA 2LHDA 1L4DB 3H8HA 1KLVA 2M4NA 3RNBC 1WX8A 3IAS1 2FCQA 3U7ZA 4W9FA 4BKSD 2NBUA 1D5XC 1N5XA 1OQQA 4NNJB 4XWTA 4KGSA 1QILA 1WGDA 2N1WA 2W3RA 2CHXA 3ZNID 2WU5B 3BK1A 2L0FA 3NJTA 1ROEA 2WYQA 2VZKD 2WXIA 2EMTA 4ZRJA 1J0GA 4RGMA 5DCNA 4OZCA 4HKZE 1M4VA 2DWQA 1P3QU 3ZRCA 2JXXA 4C56C 2BPSA 1BT0A 2MW5A 4AR8A 1ZDXA 4WIPA 2CU3A 1Q10A 4ZYNA 1Q1OA 2LUEA 1RLFA 5BYSA 2IY1B 3ZXVA 4HJKA 4ANVA 3A9JB 2IO2B 1KM7A 4JPSA 5DPWA 3KUDB 3GS2A 2R61A 4L23A 1FCLA 1F52A 4TUUA 2LRUA 1WGGA 1N5WA 3AE5B 3WAOA 3QCAA 1KJTA 3PRZA 5BO4B 2KQ4X 1UGJA 3L4PA 1WFYA 4LNKA 1HA5A 3AE4B 1I4PA 1MHHE 1WH3A 3CWIA 4FHKA 1I7HA 3V60A 3PT2B 3RNAC 3V62A 4US8A 1T3QA 4HCPB 2BKRB 3QHTA 1Y56A 2KC1A 3RZFA 3I57A 3PO0A 4FJVB 2VZKB 2D11A 1ESFA 5JZEB 2KC2A 4RGTA 1C9FA 4HLEA 1Q0WB 1FFUA 3PV1A 3U30A 3ZJUA 1J7CA 2LGIA 3DBLI 3ZRFA 4R3DA 2GBKA 1CQVA 4K3BA 1VZ8A 4CI3A 1I4QA 1WM2A 1C1YB 2MBOA 1HZ6A 2WXOA 4HDQA 3I7OA 2BKFA 1WE6A 1YQBA 2JUOA 2D3AA 1MJDA 2KDBA 3AB5A 1JCKB 4XYCA 1TS5A 3JSVA 4HPLB 4I6PA 4ZRQA 2E6XA 3HUIA 2IO3B 1ZP0B 4ZHOA 2KVRA 4DDID 1D5MC 3ZX4A 3DDCB 1E10A 2DYMA 3Q69A 2WXNA 3AI5A 3PPAA 2L32A 4E3CA 2L1AA 1TTNA 1NI3A 1EWYC 1YMHE 4PK1A 3RHUA 1IGDA 1RYJA 2WXHA 4L2YA 4BOSC 4A0AA 1RWSA 5H92C 3UGBB 3VTVA 4IW0A 2IGDA 1ISNA 3SR6A 3AE9B 3KVFB 4C80A 3RD2A 1N6ZA 2WX0A 2KLCA 2DAJA 3ZLZA 2I06A 5IO9A 4A55A 5C1ZA 1V1OA 3N9YC 2RDBC 2HDEA 4C00A 1WXMA 3ZIMA 3Q14C 4HWIB 2RSUA 1V97A 4DXAB 1TJEA 3V05A 1CMXB 4W9EA 4IM0A 3H9DA 2MWSB 4KDIC 4EE2A 3IVFA 2WXKA 2K8HA 1FXAA 1GAQB 4MGKE 4XR1A 1WSPA 2M17A 2ICIA 3VR8B 1LO5D 2O6VA 4B0EA 3OLMD 3IT4B 3C0RB 2WXMA 3P63A 2GRIA 1PFDA 4P7IA 1XEEA 3B2GA 3K9OB 3PZ8A 1LGRA 2DZMA 2C7MB 2G45B 1F77A 2KOXA 4ARFA 2KDFB 4RGNA 4JQWC 5FKAC 3SDLC 1L4ZB 2MP2A 1UWMA 3AEEB 1UNSA 1SF0A 1MI0A 2KHWB 2JRHA 3NZUA 2JPHA 2CHWA 1C76A 2BYVE 3HRDD 5HFYA 4KIKB 1FNWA 1WY8A 4FBJB 4GMVA 1EF5A 3V6CB 4GN1A 3ZXRA 2WXJA 3A9KB 4EKUA 2HJ8A 2QMTA 2FNJB 1WZCA 3OJ4B 3BVZA 1WXSA 2G1EA 1JRPA 2EWJA 1YD8U 2D5GA 3P4RB 2N9XA 4IWOA 4WQOB 4IOIE 3KWVA 2KAJA 1H4RA 5IAAC 1FXTB 1VRAB 2YLMA 3KYDD 2BWFA 1LFDA 3EA6A 3TJPA 2HJ1A 1I35A 3I7KA 4J6IA 1WZ0A 2LMCA 4RGOS 2LJIA 4MGYE 4AP4C 2V4IB 2FUG1 5HG2A 4MSMB 3DCGA 3HM3A 3UQBA 1WE7A 1D5ZC 2FAZA 1T0RC 3EHVA 2WXGA 2KACA 5D7GA 1GB1A 3RFZB 2MBHA 3AEGB 3DVGY 4RNAA 4TMAB 4G50A 1DGJA 4W9HA 3Q8BA 4ZHPA 3JYUA 1XO3A 3R2TA 4CO7A 2KXJA 2LGDA 1WRIA 5C2TB 1WZ3A 2H88B 3BYYB 4AOFA 1SIJA 1E9MA 5CX3A 1HQRD 1SSNA 3T9LA 2QCZA 3I7LA 4S17A 1TY0A 2V1YA 4LJPB 5C23A 3RZWC 2BS2B 4ANXA 4C4VA 2GB1A 3H7PB 4NZLB 1GB4A 2BB5A 2M0XA 3ALBA 2AQ2B 1NEKB 1UELA 2LFIA 3URYA 3Q6BA 3AE1B 1C3TA 3W1SC 4AWJA 3AEDB 2BYFA 3TUOA 3I63C 3KWLA 3EC8A 1SJHD 2KWCA 2QEJC 3N32A 2RD0A 4XE0A 2Y6IA 2FCMA 3AE6B 4RFBA 3BYTB 2GMIC 2KFKB 3APCA 4YL8A 3AULA 2KTFA 2KMMA 4YT0B 2IZVB 3I7PA 1PGAA 3N1YC 5JHAA 4C7YA 3M95A 3GZNI 4A3PA 1ZUD2 4JGHB 4JE3B 2PJHA 1IP9A 5E6OA 4XC2A 1JALA 4EOYA 3TMPB 3R7QA 1EF1A 1TY2A 4NAWB 2KJRA 2K5PA 4KSKC 4A0BA 4H2AA 3HM6X 3AN1A 1IBXA 4W9KA 1DOYA 2KDIA 1TGZB 3EUB2 2W54A 4ACFA 3VTWA 3ONSA 4AR1A 3U52E 3GE8C 4GDKB 2KKCA 2O6VB 2BYEA 2WXFA 4JL9A 2BTEA 4AS1A 5GXGB 4GDLB 1ET9A 1H8CA 1EM7A 2ZNVB 1WRDB 1HEZE 1XXGA 4REZA 3RMKC 3AE3B 2M56B 3B0AA 3P42A 1WYGA 3PHWB 4FULA 2G9HD 1VR9A 5BMGA 2KFKA 4HEA1 2Y50A 3IXSA 4LDTB 4ZRKA 1WJNA 4KSLC 2V3SA 3P4QB 2K8CA 2IGHA 2JF5A 4K7SA 2WDVB 3R2IA 1FMAD 4K1RB 3X23A 1SIFA 2K1FA 2PE6B 4TSSA 3DPDA 1QOGA 3I8CA 3CSTA 4HK2A 4KZ0A 3TBLD 2WXRA 4MGZE 1WXOA 2LHEA 3NVZA 4G11A 3EECA 2J0JA 4BKTA 1WR1A 2IUTA 3AM9A 3DOWA 2KJ6A 2SAKA 1WM3A 2N9PC 2PLPA 2J4XA 2JQRB 3BY4B 2BWES 1RFAA 3U4EG 1TS4A 1GC7A 1EU4A 4YSXB 4MT5A 1OFFA 1V1PA 1FPYA 1N63A 3E9SA 2Z0DB 1J7AA 2MH7A 3L17A 3WIMA 1MFWA 4K3CA 5E6PA 1KLUD 4EFOA 3GB1A 3RT3B 2UU7A 3A1QA 1VJKA 3KW5B 4W9CA 3APDA 4A08A 1L7YA 3NY5A 2ASQA 5T8IA 2LJ5A 2KN4A 3VH4B 2C7HA 2K39A 2HD5B 3ZU6A 1YOVB 3ZTYA 5IOIA 2YVCA 2WP9B 2BQQA 2LGXA 4TKNA 4IWQA 3ZYYX 3DBRB 2CKHB 4FN2A 1C4CA 2K25A 2IUUA 4M02A 1AYFA 1I4GA 3GOEA 5TSSA 2C5LC 2NPTA 2KQSA 3W5VB 2K9XA 3OWEB 4XZ4A 2WQYB 3VRAB 4NJCA 1OQYA 2B5MA 1ZE3D 3DVGX 3ZNZB 5J2RA 4ANUA 2ZZFA 1T5XD 3LXFA 3WAMA 1I4RA 1WF9A 4A8XC 2ONQA 1STEA 2X8XX 4LNOA 4PS3A 4HXDA 3TEXA 3IG3A 2IO1B 3PREA 2LASA 2BVCA 2D3CA 4GU2A 3IFWB 1SEBD 4M8MA 2MBBB 3SFDB 4DHZE 5AUIA 2MHJA 3PRPB 4ZOHC 1ENFA 1GOZA 1LXDA 3HVZA 1JW9D 1V7OA 4F1SA 4P1CC 3X0WA 4IM3A 1T0YA 1KTKA 3DBRI 2IBIB 2Y3AA 3BVGA 2L00B 3N20C 4FA6A 1P7EA 4OZAA 4ZRIA 2AX5A 2C7NB 1XT9B 2HTME 2INPE 2KDMA 4KIKA 3W2DA 3QK0A 1ACCA 2DHZA 1B1ZA 3ZX5A 2MEKA 4MGIE 1TYGB 3AEBB 4BZAA 1L6UA 1T0QC 3MC9A 1QOBA 2MJ3A 4BBNF 2DZJA 4ICVA 1YX6B 1P1AA 1E0ZA 3ZO5B 2KWUB 3Q8CA 1XQQA 2INDC 3RULA 4DHJB 4YXDB 3SU8X 4W9JA 2JZPA 2KVZA 1WWTA 1FCCC 5AZFA 2UWQA 2JZZA 2LRWA 5FQDA 2JY6A 3V6EB 2PEAA 1SB3C 4WH4A 4C4VB 3H7PA 4JWSC 3ABVB 4JLCA 5JXVA 2VH1A 1F9JA 3L13A 2LZ6A 2J7QB 2MJEA 3Q3OC 2BW2A 2Z8LA 5I4DA 1K51A 3OJ3A 1XCTL 2ZPNA 2NR2A 1YIWA 4HRSA 5BYQA 2KLGA 1HZ5A 2OJRA 1SE3A 4N6EB 3MFGA 4O1NA 3DVNU 3SFEB 1D3ZA 1P9DU 1YJJA 3ZVVA 1EUVB 4II3B 3EFUA 2XEWA 4YSYB 4AREA 4TQ1A 4P6VF 1YN3A 1WMHA 4AJYB 3P4PB 3WALA 2WS3B 2KNBA 2JT4B 4XR2A 2BYTA 1I42A 3Q8AA 4XGAB 2QC8A 4DDGD 2N7DA 1CK1A 2Q5WD 4M0WB 1GUAB 2JYEA 2I38A 2K0PA 4TQ0A 2BGFA 2M8SA 2N1VA 3NG0A 2JWUA 1QF6A 4WJPA 4GGQA 1L5PA 4WWOA 3S2AA 1QQRA 1K50A 1E5WA 1TKEA 4BVUC 3W1YA 2OHFA 1KH0A 2FCNA 3UQAA 1UGMA 5IP4D 5AUKA 1LM8B 1RM6C 2Z59B 1YJIA 2WXQA 4IDIA 2PE9A 2LGYA 4M8NA 4ZRPA 2CJNA 3U8ZA 3VFKA 4BKSA 5D94A 1T6BX 2IPKD 1EO6A 1MPEA 1HTOA 3FILB 1V9JA 5CHVC 1K52A 1P0RA 2K8BA 2LXAA 3ZTDA 2JU6X 1VZ6A 2M19A 2QSDA 4A90A 3ETRA 1V80A 2G3QB 2MBEA 5KHOA 3MHZA 1WI0A 3Q3MC 4P1BC 3NUHB 2WX1A 2ZPYA 3N1ZC 4FLHA 5AZGA 2ZVNA 2LWPA 1PUTA 1J7BA 2L83A 1XLQA 3PLUA 4YTNB 3U7DA 2FCSA 3Q8EA 3KQ4A 3AMZA 3OAWA 1TT5B 3MC8A 3N1XC 3DWGC 1TKGA 4MSQB 5G5HA 2DBYA 1N62A 3KUCB 3AU5A 2N7EA 4C7ZA 5G55A 5C3JB 2NCNA 1ZDVA 2WGSA 2IY0B 2Y3UA 3ZKJC 2ZCCA 2GBMA 3KUZA 2J0MA 1BUIC 2GBJA 1L0VB 3ZGZA 2RPVA 2ZVOA 4LNIA 2DX5B 3KYCD 3QARA 2REXA 3I7HA 4A9AA 2J42A 4DHZB 3UF8A 5BMIA 2AL3A 4LCDE 3RFNA 3A9KA 3I9V1 3DBLB 4KKIA 1SGHA 3CMMB 4NPNA 1R4MI 2WXLA 3DBHI 3BIID 2LUMA 3MHSD 3O65B 4KGRA 4AUQC 4PYZA 4M0WA 1E7VA 1SJED 3PRMB 4A20A 4OVUA 2A5UA 1XVIA 4E54A 4YWGG 2ZTGA 2V4LA 4WWNA 3Q3FA 3M63B 5JHBA 2KT7A 3BVMA 4NQLB 4CYEA 1A5RA 2VH2A 2GLSA 4KZCA 4HROA 3RCZA 1ECRA 1VLBA 1AARA 1R7SA 5AEKB 3P2BA 5TR5A 2ZZPB 2QIEB 1R4NB 2WXPA 2N0SB 5FK9C 4LNNA 3RUIB 2ZZGA 1D4BA 3AXCA 1MG8A 3BK2A 2SEBD 2XK5B 2B5LA 3WAPA 1E8YA 3A9JA 2NBVB 3VTUA 4NJ7A 1AN8A 2NBWB 3L08A 1ZKHA 1TKYA 2KMAA 4KDLB 1C4PA 3PGEA 2BF8B 1L0XB 3H7SA 3KLSX 1PYWD 3CIRB 1CJEA 4OVZA 3TSSA 3VH3B 4GLSC 2M0AA 4RM9A 1UUPA 1WXQA 3UINB 2FIDA 3GZNB 5E6JA 3LJ3A 2L3ZA 3QC8B 4TV3A 1TBEA 2NTSA 3B1LX 4KGTA 4DXFA 1V5OA 2W82A 2JZ3B 1DOIA 3QIJA 2RDGA 3VR9B 2WDTB 4E74A 5D6JB 2MBQA 1Z2MA 3NZ3A 3HIZA 4MM3B 3GE3C 1TIFA 1E8XA 4WJQA 4GDKA 1DYQA 3NVYA 2Y5CA 4GXBA 3ZWKA 2M1MA 1WX7A 1YNTE 4WWMA 3VVWB 1HXYD 3TL5A 1I4HA 2V9HA 4W9LA 3EGRA 5EE3A 1K8RB 3VUYA 2MCNB 3RN9C 4B6WA 2KYWA 2WLBA 5DPTA 3M62B 2LD9A 1V5TA 1WGRA 4ASWC 4LDTD 4B9KA 2XK5A 4XDDA 2LGSA 2G4SA 2KJHB 1OEYA 4ARIA 1R4MB 3JVZX 2QILA 3IAM1 2IYDB 2INNE 2BB6A 2DZKA 2Z0EB 2L7RA 5CHFA 1NDDA 4LJOB 4D2KA 3CF6E 1XLOA 2DYOA 3QA8A 4HPMB 4UDUC 2D07B 1ZPSA 1VZ7A 1F1HA 3PTFC 1IBXB 3L54A 1EWCA 5LLIA 4EZKA 1C79A 4DQOC 2PKOA 3EFCA 1FNVA 2WWZA 3GP7A 3RI7C 2L76A 3VAWA 2FBWB 2MQJA 2LXCA 3ZW7A 1GPXA 4ANWA 4G3XB 2R2QA 1JROA 3RPFC 1N60A 3O13A 3JW0X 3EI3A 2K6QA 3AEAB 1M94A 1L2NA 4HCNB 1B9RA 2Y5PA 3WANA 1UH6A 3UIPB 3E56A 3TEWA 2OEDA 5DPRA 3MP9A 1GJZA 1P7FA 1E8ZA 2AL6A 3ZJTA 2QDFA 2ZNVC 3ZUPA 1NBFC 5BYRA 1J8CA 4EUTA 3AH7A 1JWSD 2AQ3B 1WX9A 2O6VD 3EI4A 3R66C 1ZXHA 4QAYA 4HKQA 4NY0A 3JSVB 4OZBA 2KO3A 4KV2A 1KOTA 1SXTA 4F7ZA 4URKA 3D32A 1QOFA 1QOAA 2LI5A 2AWTA 4CHKA 4NAWA 3WA0A 1JRUA 2G4DB 2PW9A 4CQNA 4IG7B 2GBRA 2DNFA 3T3OA 2H89B 4A3OA 2FUHB 4FJYA 1FRDA 2O2VA 4PS7A 1JWMD 2NS5A 4FXCA 2JVCA 2WU2B 1FXIA 5AZHA 1XD3B 1E7PB 1QKZA 2NPTB 3W1SA 4OW0A 1SE4A 1FNUA 4ARCA 2CJOA 1SE2A 2L0TA 1WYWB 3RYTA 2JWZA 2WHIA 4HJGE 3C19A 1ZOYB 3R7RA 1WXAA 2BT6A 2W9NA 3WCQA 5GMVA 1XCQL 3I89A 4YSZB 2Y5BB 2EMSA 3BINA 1UD7A 3PSEB 3NZSA 2I2YA 2N9KA 3AE2B 3C8YA 3AU4A 2E1BA 5J18A 4LLGM 3ZJVA 3ENEA 4Q2JA 2I1KA 4N58A 2PMVA 3HHMA 1NENB 2KTRA 2JYTA 3AE7B 2B3AA 4E5ZA 2ZJDA 5LXIB 3SHQA 1FEHA 4RM8A 2QHOA 1YN5A 2JXTA 2KZRA 1OQRA 1WJUA 2ZW0A 3MJWA 4GOCA 3ZNGC 2J0KA 1OEYJ 4AR9A 3VQIA 2XBBC 3P4SB 5CHWA 1IPGA 2RPQA 3NS1A 1P98A 2W3SA 1WJ4A 1WXVA 3PZ7A 4WAFA 1EU3A 2AQ1B 4I6NB 2KX0A 3EI2A 3Q3NC 2D3BA 2KQ7A 2OJWA 3DHIC 1WNUA 5KHQA 3BZDB 4X57B 3LYYA 3PHXB 5EDSA 1KF6B 5IKCM 1FIQA 3DQVA 3MC0B 3L10B 4M00A 1S3SG 1PQSA 3ML8A 3VUXA 2D2QA 1DOXA 2LEKA 4NQKE 2N4FA 1S1QB 1PDXA 1Y8RC 3AE8B 4MACA 1FRRA 4WJOA 2N7JA 3IBEA 4L1BA 1VD2A 2MJDA 5H8YE 4GB9A 1UWXA 1HTQA 3J9CA 3ZDMC 2KK8A 4WJNA 4BKGA 2X38A 3A4RA 4KVGB 2FIFA 3K9PB 4N9F4 1OTRB 4DBGA 1V86A 2A4ZA 2GBNA 2KMCA 4MEMA 3ZTWA 2DZIA 1ET6A 5LNK1 3FILA 2NVUI 4OVVA 1V4PA 1L0YB 3V61A 1MVKA 4MJSA 2PPHA 1IYFA 1F0ZA 4US9A 2D3GA 1V8CA 3H6NA 2XNAC 2ZZEA 4PT5A 2YEPB 3VUWA 2JSVX 2MLBA 1UBQA 1NYQA 3I3TB 3LB8C 5HKHA 4IUMB 3DHGC 3BWUD 4XWWA 3W9CB 3KEWA 2CHZA 1WGYA 3B9JA 1GNUA 4B0MA 2N9EB 4A6QA 2B76B 4B95A 2BS4B 1V49A 2ACZB 2W55A 3N30A 4ICUA 1MG4A 2L05A 4USAA 2JX5A 3NOBA 4K81A 3DWMA 1GC6A 3A1QB 1E7UA 4S0RA 4A11A 3ZW3A 1YX5B 2C60A 2NMQA 2WDQB 2KANA 3FAHA 3B2FA 4LK0M 4NJ6A 3QJZA 2LVPA 2XN9C 1RFKA 2K6DB 3PVLA 1Q5WB 1SBBB 1UF0A 2HTHA 4RF1A 3T8MA 1V81A 5LXHA 2MRPA 2PVGC 3NVVA 3APFA 4WWPA 3I5JC 3Q3JA 3NVWA 2V3NA 4M01A 1VCBA 1YN4A 1XLNA 1JQ4A 1N61A 2ZEQA 1K53A 2KN5A 3N3KB 2KX3A 1AWDA 1UBIA 1F2RI 4HPPA 4FJZA
chains in the Genus database with same CATH topology
2VZKB 1ESFA 1NVID 1QOGA 4RGTA 1TKYA 3I8CA 4OHJA 1C9FA 1WXOA 2WXRA 1C4PA 2LHEA 3NVZA 1FFUA 1L0XB 2IUTA 3AM9A 1J7CA 3KLSX 2LGIA 3ZJUA 1PYWD 2SAKA 4R3DA 1FO4A 1CQVA 1VZ8A 3CIRB 2PLPA 4CI3A 1CJEA 1I4QA 2J4XA 2JQRB 4OVZA 3TSSA 3U4EG 1HZ6A 1TS4A 2J52A 2WXOA 4RCOA 3I7OA 4GLSC 1EU4A 3Q8FA 4YSXB 3EI1A 2M0AA 4MT5A 1OFFA 1UUPA 1WXQA 1V1PA 5E6JA 1N63A 3E9SA 1J7AA 2MH7A 4CI1A 1KLUD 3AB5A 2NTSA 3GB1A 1JCKB 4NAMA 1TS5A 4KGTA 4DXFA 4ZRQA 1L6VA 2W82A 4ZYSA 3I8EA 1DOIA 2E6XA 2RDGA 3HUIA 1ZXIA 1VJKA 3VR9B 1ZP0B 3AECB 4ZHOA 1D5MC 3NZ3A 4A08A 4MM3B 1F2RC 1E10A 2DYMA 1DYQA 3NVYA 3Q69A 2Y5CA 2WXNA 5EE9A 5T8IA 2KN4A 2L32A 1YNTE 4WWMA 2E3TA 1HXYD 2L1AA 1NI3A 2I05A 1I4HA 1EWYC 3EGRA 5EE3A 2WP9B 1YMHE 1KRHA 3RHUA 1IGDA 3ZYYX 1RYJA 2N9LA 2WXHA 1FD6A 4L2YA 4A0AA 1RWSA 5H92C 5EE1A 2WLBA 2IGDA 3T3NA 1C4CA 3TEYA 1A70A 3SR6A 3AE9B 3E0CA 4C80A 4TZ4A 2IUUA 1AYFA 3W5UB 1I4GA 5TSSA 4XDDA 2EKIA 4ARIA 3W5VB 5D3IB 2IJ0A 2K9XA 3OWEB 2QILA 3AEFB 3IAM1 2WQYB 2INNE 3VRAB 1IUEA 4NJCA 2I06A 2BB6A 4A55A 2B5MA 1ZE3D 2HYEA 1V1OA 1T5XD 3N9YC 3HVDA 2HDEA 3LXFA 1I4RA 2ZZFA 4KX6B 4A8XC 2ONQA 1IGCA 1JWBD 1STEA 2BS3B 4D2KA 1XLOA 2DYOA 3TEXA 4UDUC 4KKJA 1V97A 1ZPSA 1CZPA 1TJEA 3V05A 1VZ7A 1IBXB 2PTLA 1EWCA 1SEBD 5D3DA 1C79A 3SFDB 1KLGD 5AUIA 4DQOC 4EE2A 1BMLC 2WXKA 2PKOA 4ZOHC 1FNVA 1FXAA 1GAQB 3GP7A 4XR1A 1ENFA 1GOZA 1WSPA 1YQ4B 3HVZA 2ICIA 3VR8B 1LO5D 4B0EA 1JW9D 2FBWB 1NYRA 4RH6A 1V7OA 3IT4B 2WXMA 3P63A 2GRIA 2ON8A 1KTKA 1QT9A 5G5GA 1GPXA 1PFDA 1JROA 3R8BA 2Y3AA 3BVGA 3RPFC 1N60A 3O13A 1P7EA 1XEEA 4OZAA 3B2GA 3EI3A 4XR3A 2ZW1A 2AX5A 3AEAB 3FC4A 3PZ8A 4JX1C 2HTME 2INPE 2KDMA 1B9RA 1F77A 3W2DA 2Y5PA 1PGXA 1ACCA 1YQ3B 3TEWA 3E56A 1XF5L 1B1ZA 4ARFA 2OEDA 2QJLA 2MEKA 2NTTA 3MP9A 1P7FA 4RGNA 3ZJTA 2FE8A 5EE0A 2IUSA 5FKAC 1AW7A 1TYGB 5BYRA 3AEBB 4LTUA 4XDCA 1L4ZB 1L6UA 1V1PB 3I7NA 3AH7A 1JWAD 1UWMA 1QOBA 2MJ3A 1UNSA 3AEEB 1JWSD 2GI9A 1SF0A 1MI0A 2AQ3B 4ITKA 2PIAA 4XR0A 1C78A 1C76A 3EI4A 1BXTA 4JWUC 1ZXHA 1E0ZA 4HKQA 3HRDD 3Q8CA 5HFYA 1VDVA 3TEZA 4OZBA 4YXDB 3MJ5A 1SXTA 1FNWA 1WGKA 1PGBA 1C4AA 2JZPA 1QOFA 1WWTA 4CI2A 1FCCC 1QOAA 2WXJA 2QMTA 5FQDA 3BVZA 5MPOA 2PW9A 4CQNA 1SB3C 4WH4A 2BBCA 2G1EA 1JRPA 3VRBB 3T3OA 4JWSC 2EWJA 3ABVB 2H89B 5JXVA 2PVOD 1FRDA 4WURA 1JWMD 4FXCA 4N59A 2MJEA 2WU2B 1FXIA 2BW2A 2Z8LA 1E7PB 1QKZA 3W1SA 2K3UA 2D5GA 4OW0A 5I4DA 1K51A 3P4RB 1SE4A 1XCTL 1FNUA 2K22A 4ARCA 2CJOA 4HRSA 5BYQA 1SE2A 1HZ5A 1E6EB 1SE3A 4N6EB 3SEBA 4HJGE 3MFGA 4O1NA 1ZOYB 3SFEB 1FM0D 1TS3A 2BT6A 4IOIE 1YJJA 3KWVA 4MH8A 2RDHA 2WDRB 3WCQA 1XCQL 2KAJA 3I89A 4YSYB 4J3OD 4YSZB 4AREA 4TQ1A 4P6VF 1TZOA 2IGGA 1VRAB 5BMHA 1YN3A 2I2YA 3P4PB 1MHXA 2RMMA 2N9KA 2WS3B 3EA6A 3AE2B 4XR2A 2BYTA 3AV8A 3C8YA 3Q8AA 3I7KA 4IKGA 2E1BA 4LLGM 3ZJVA 2LMCA 2V0GA 2J53A 4RGOS 4Q2JA 2LJIA 1CK1A 2Q5WD 4N58A 3NRZA 2PMVA 2V4IB 1NENB 2FUG1 5HG2A 2JYTA 3AE7B 4E5ZA 3UI3A 1D5ZC 2JYEA 2I38A 2K0PA 1TS2A 3ZQ4A 1FEHA 4TQ0A 4YTMB 2KWDA 3V3XA 5FR3A 1QLBB 1YN5A 2WXGA 4YTPB 2JXTA 2KACA 5D7GA 2JWUA 1QF6A 1GB1A 1C77A 3RFZB 1OQRA 3WQZA 1L5PA 2ZW0A 3AEGB 4RNAA 4TMAB 4AR9A 3VQIA 2EELA 1DGJA 3P4SB 3Q8BA 1QQRA 4ZHPA 1K50A 2L52A 3NS1A 1TKEA 1JWUD 2W3SA 2IDYA 5HI1A 3PZ7A 2OHFA 4WAFA 1KH0A 1XO3A 1I4XA 3R2TA 1EU3A 2AQ1B 5AUKA 1WRIA 5C2TB 1RM6C 3EI2A 1YJIA 2H88B 2WXQA 3BYYB 1SIJA 1E9MA 4IDIA 3IT6B 1KFYB 1WNUA 1HQRD 1SSNA 3BZDB 2CJNA 4ZRPA 3LYYA 2WNMA 3I7LA 1T6BX 1JMLA 2DLBA 1TY0A 2IPKD 2V3PA 1KF6B 3P1MA 1FIQA 3MC0B 4WQMA 1MPEA 3FILB 2BS2B 2GB1A 1FFVA 4NZLB 1GB4A 4A09A 2BB5A 1DOXA 1K52A 2LEKA 2JU6X 1VZ6A 2M19A 2TSSA 2QSDA 4A90A 2AQ2B 1PDXA 3ETRA 3AE8B 4MACA 1FRRA 4RF0A 4DXGA 1NEKB 2LFIA 3URYA 2N7JA 3AE1B 4L1BA 3MHZA 3AEDB 4AQ7A 2YEPF 2MJDA 3TUOA 5H8YE 1UWXA 3NUHB 3KWLA 3J9CA 3U2SC 5HHDG 1XLPA 2X38A 1PUTA 1D6EC 1J7BA 2L83A 4P16A 1XLQA 2LHDA 1SJHD 4YTNB 1L4DB 2QEJC 3H8HA 1ET6A 3Q8EA 5LNK1 3KQ4A 3AMZA 3FILA 3U7ZA 3IAS1 3DWGC 1TKGA 4XE0A 2Y6IA 5G5HA 1D5XC 3AE6B 1N5XA 1V4PA 2DBYA 1OQQA 1N62A 4RFBA 1L0YB 3BYTB 1MVKA 4XWTA 4KGSA 4C7ZA 5C3JB 1QILA 1ZDVA 2Y3UA 1F0ZA 2W3RA 1BUIC 4US9A 1L0VB 2KMMA 2WU5B 3BK1A 4YT0B 3I7PA 3ZGZA 1V8CA 2RPVA 1ROEA 2XNAC 1PGAA 2ZZEA 2VZKD 2WXIA 4PT5A 2YEPB 4RGMA 4C7YA 4OZCA 2JSVX 4HKZE 3I7HA 1M4VA 1ZUD2 2DWQA 4A9AA 1NYQA 3LB8C 4JE3B 2J42A 5BMIA 3BWUD 4XWWA 3W9CB 1JALA 4C56C 3KEWA 3RFNA 3I9V1 4AR8A 4KKIA 1ZDXA 3B9JA 1TY2A 4WIPA 2WXLA 4NAWB 2CU3A 4B0MA 2K5PA 3BIID 4A6QA 2LUMA 4H2AA 1Q10A 3AN1A 2B76B 4KGRA 1IBXA 4A0BA 1DOYA 2BS4B 4M0WA 1SJED 3EUB2 5BYSA 2ACZB 2W55A 2W54A 4USAA 4E54A 4AR1A 4JPSA 2JX5A 3U52E 4YWGG 2ZTGA 4GDKB 3GS2A 2R61A 4L23A 2WXFA 3DWMA 1FCLA 2BTEA 4AS1A 5GXGB 4GDLB 1ET9A 4A11A 2NMQA 2WDQB 1EM7A 3BVMA 3B2FA 3FAHA 1N5WA 1HEZE 1XXGA 4REZA 4LK0M 4HROA 3AE5B 3AE3B 2M56B 3P42A 1WYGA 1ECRA 2XN9C 1VLBA 1RFKA 1SBBB 1R7SA 2G9HD 4RF1A 1VR9A 2KQ4X 1UGJA 3L4PA 5BMGA 2PVGC 3NVVA 4HEA1 2Y50A 3IXSA 1HA5A 3AE4B 1I4PA 1MHHE 2QIEB 3CWIA 3NVWA 2WXPA 2V3NA 1I7HA 2N0SB 1YN4A 5FK9C 3P4QB 1XLNA 4US8A 1JQ4A 2IGHA 1N61A 1T3QA 2ZZGA 1K53A 1D4BA 2WDVB 1AWDA 1Y56A 3BK2A 2SEBD 3R2IA 1FMAD 2B5LA 3I57A 3PO0A 4TSSA 1F2RI 1AN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AUI A;  1NVI D;  1QOG A;  4C7Z A;  1TKY A;  2PKO A;  3P4P B;  5C3J B;  4ZOH C;  1WXO A;  1FXA A;  1GAQ B;  2WS3 B;  3NVZ A;  3AE2 B;  1F0Z A;  1YQ4 B;  3HVZ A;  1FFU A;  2W3R A;  3VR8 B;  3AV8 A;  3AM9 A;  1J7C A;  1JW9 D;  2FBW B;  1NYR A;  4US9 A;  1V7O A;  1L0V B;  1FO4 A;  2E1B A;  2KMM A;  2WU5 B;  3P63 A;  3CIR B;  4YT0 B;  1CJE A;  1V8C A;  2JQR B;  1ROE A;  1QT9 A;  5G5G A;  2ZZE A;  2Q5W D;  4N58 A;  1GPX A;  1PFD A;  3NRZ A;  1JRO A;  4C7Y A;  4YSX B;  3RPF C;  1NEN B;  1N60 A;  1OFF A;  1WXQ A;  3B2G A;  3AE7 B;  3AEA B;  2AX5 A;  3FC4 A;  1N63 A;  1J7A A;  2MH7 A;  1ZUD 2;  2DWQ A;  4P6V F;  1NYQ A;  3LB8 C;  4A9A A;  4JX1 C;  4YTM B;  1N62 A;  2HTM E;  1B9R A;  1QLB B;  4YTP B;  3AB5 A;  1YQ3 B;  3W9C B;  1JAL A;  1QF6 A;  3KEW A;  3WQZ A;  1OQR A;  3RFN A;  1L5P A;  1L6V A;  2QJL A;  3AEG B;  1DOI A;  1DGJ A;  3P4S B;  3B9J A;  3HUI A;  4ZHP A;  5EE0 A;  1ZXI A;  1VJK A;  2CU3 A;  2L52 A;  1ZP0 B;  1TKE A;  2K5P A;  3NS1 A;  3VR9 B;  3BII D;  2W3S A;  3AN1 A;  2B76 B;  3AEC B;  4ZHO A;  1TYG B;  2OHF A;  1XO3 A;  3AEB B;  4LTU A;  1DOY A;  2BS4 B;  1L6U A;  1E10 A;  3AH7 A;  1JWA D;  1UWM A;  1QOB A;  2MJ3 A;  2ACZ B;  2W55 A;  3AEE B;  3EUB 2;  1WRI A;  2Y5C A;  3NVY A;  1RM6 C;  1SF0 A;  5AUK A;  5C2T B;  2W54 A;  4USA A;  5EE9 A;  1YJI A;  2H88 B;  4ITK A;  1SIJ A;  2PIA A;  1E9M A;  2JX5 A;  4WWM A;  4IDI A;  2ZTG A;  1KFY B;  4JWU C;  2E3T A;  1WNU A;  1E0Z A;  3HRD D;  1NI3 A;  2CJN A;  1VDV A;  1EWY C;  4YXD B;  5EE3 A;  2WP9 B;  1KF6 B;  3DWM A;  1FIQ A;  1KRH A;  3P1M A;  3RHU A;  1WGK A;  3ZYY X;  1RYJ A;  4WQM A;  5GXG B;  1QOF A;  1WWT A;  2BS2 B;  2WDQ B;  1RWS A;  1FFV A;  1QOA A;  5EE1 A;  2WLB A;  5H92 C;  3FAH A;  3B2F A;  1N5W A;  1DOX A;  2LEK A;  1A70 A;  3SR6 A;  3AE9 B;  4HRO A;  5MPO A;  2M19 A;  4C80 A;  3AE5 B;  1SB3 C;  2M56 B;  1AYF A;  3AE3 B;  1PDX A;  3ETR A;  3W5U B;  2G1E A;  1WYG A;  1JRP A;  1FRR A;  3AE8 B;  3VRB B;  4JWS C;  3ABV B;  1NEK B;  1VLB A;  2EKI A;  1RFK A;  2H89 B;  2K9X A;  2PVO D;  3W5V B;  1FRD A;  3AE1 B;  3AEF B;  2WQY B;  1R7S A;  3AED B;  4FXC A;  4N59 A;  2MJE A;  3VRA B;  2WU2 B;  1IUE A;  1FXI A;  2MJD A;  5H8Y E;  3L4P A;  2PVG C;  3KWL A;  1E7P B;  3NVV A;  2ZZF A;  3LXF A;  1XLP A;  3P4R B;  4KX6 B;  3AE4 B;  1PUT A;  3NVW A;  1JWB D;  2QIE B;  2K22 A;  3CWI A;  2BS3 B;  2CJO A;  1XLO A;  1J7B A;  2L83 A;  4HRS A;  1I7H A;  1XLQ A;  2N0S B;  4YTN B;  3P4Q B;  1XLN A;  1E6E B;  1V97 A;  4US8 A;  1JQ4 A;  1CZP A;  1TJE A;  4N6E B;  1N61 A;  1T3Q A;  2ZZG A;  1ZOY B;  3SFE B;  1FM0 D;  3AMZ A;  2WDV B;  1AWD A;  2BT6 A;  1YJJ A;  3DWG C;  1FMA D;  1TKG A;  2WDR B;  3WCQ A;  3PO0 A;  2KAJ A;  5G5H A;  3AE6 B;  4YSY B;  1N5X A;  4YSZ B;  2DBY A;  1V4P A;  1OQQ A;  3SFD B; 
#chains in the Genus database with same CATH topology
 1WGH A;  1NVI D;  2AYO B;  3CSF A;  4OHJ A;  2C9W B;  4MDK E;  2I1J A;  1X1M A;  1FO4 A;  3QWZ B;  4BOZ B;  4RCO A;  2J52 A;  1YJ1 A;  3Q8F A;  3EI1 A;  4CI1 A;  3R3M A;  4F8C B;  3MTN B;  1G6J A;  2DYB A;  4NAM A;  3ZWD A;  1L6V A;  4ZYS A;  2MSE D;  3DBS A;  3I8E A;  3DHH C;  3ML9 A;  1ZXI A;  4ZDV A;  1RRB A;  1NI2 A;  3B08 A;  3AEC B;  2R2O A;  1F2R C;  1V6E A;  4LNF A;  3TIX A;  5EE9 A;  3RNG C;  3A33 B;  2E3T A;  2DAF A;  3HK0 A;  2I05 A;  4XX5 A;  2KWV B;  1KRH A;  2N9L A;  1FD6 A;  4W9G A;  2CR5 A;  2KTR B;  5EE1 A;  3IHP C;  3T3N A;  3TEY A;  1A70 A;  3E0C A;  3L16 A;  3ZUN A;  2INC C;  4TZ4 A;  3FKY A;  4MJS B;  3W5U B;  2D10 A;  2EKI A;  5D3I B;  2IJ0 A;  4DK5 A;  3AEF B;  1IUE A;  2HYE A;  1WMH B;  3HVD A;  4KX6 B;  1IGC A;  1JWB D;  5IN7 A;  2BS3 B;  3ZTC A;  1WIA A;  4KKJ A;  1CZP A;  3NS8 A;  2KFJ A;  4W9D A;  3A4S C;  2PTL A;  1V2Y A;  1WJ6 A;  2MA9 B;  2MX2 A;  3SD5 A;  5D3D A;  4DWF A;  3VXW A;  1KLG D;  1R4N I;  3H1U A;  1BML C;  4BAX A;  1YQ4 B;  1ZW7 A;  3LDZ E;  1NYR A;  1SE9 A;  4RH6 A;  3ECI A;  2MP2 B;  4BFR A;  1OGW A;  4MEL A;  2ON8 A;  4IC7 B;  1QT9 A;  5G5G A;  2KD0 A;  2DEN B;  4RMA A;  4PYU A;  3R8B A;  3VDZ A;  2LVO A;  4FHJ A;  2JRI B;  4XR3 A;  2ZW1 A;  3FC4 A;  5IA7 A;  4JX1 C;  1QZE A;  5CTR C;  2OOB B;  1PGX A;  1YQ3 B;  1XF5 L;  4II2 B;  2QJL A;  1U4A A;  2NTT A;  1E8W A;  2FE8 A;  2LVQ A;  5EE0 A;  1LQB A;  4IM2 A;  2IUS A;  3QAQ A;  1J19 A;  1AW7 A;  3QQ8 B;  3VHT C;  1E90 A;  3NHE B;  2VRR B;  4XDC A;  4LTU A;  4FAD A;  1V1P B;  2RGF A;  3I7N A;  1JWA D;  5FR6 A;  2GI9 A;  2UYZ B;  4BBN C;  5L95 C;  4ITK A;  2PIA A;  4XR0 A;  1C78 A;  1BXT A;  4JWU C;  4I6L B;  3TEZ A;  1VDV A;  5JH5 C;  3MJ5 A;  1WGK A;  1PGB A;  1C4A A;  3M3J A;  2IO0 B;  3KH0 A;  4CI2 A;  2ZCB A;  4PS8 A;  2GOW A;  5MPO A;  4K7U A;  3DVN V;  2BBC A;  3UIO B;  3VRB B;  3PLV A;  2PVO D;  3ZNH B;  4WUR A;  4N59 A;  3L0W B;  3PS6 A;  3RNF C;  1UZX B;  4JIO U;  2K3U A;  2K22 A;  1E6E B;  4HDO A;  3SEB A;  1FM0 D;  3RNE C;  1TS3 A;  4MH8 A;  2RDH A;  2WDR B;  4J3O D;  1T0S C;  1TZO A;  2IGG A;  4E71 A;  1TZ1 A;  5BMH A;  1MHX A;  2RMM A;  2KDE B;  2O2V B;  3AV8 A;  1GG3 A;  4EZJ A;  2RR9 A;  4IKG A;  3QX1 A;  2HE7 A;  5G2N A;  1RAX A;  2V0G A;  2J53 A;  5L83 A;  3NRZ A;  2AEH A;  3UI3 A;  1Z5S B;  3ZQ4 A;  1TS2 A;  4YTM B;  2KWD A;  3V3X A;  5FR3 A;  1WR6 E;  1QLB B;  4YTP B;  5D2M B;  1C77 A;  3WQZ A;  2EEL A;  3ZDT A;  2EKE C;  4EEW A;  2L52 A;  4G0N B;  1JWU D;  2IDY A;  5HI1 A;  1I4X A;  2L8J A;  4EZL A;  4MM3 A;  3RNC C;  5DPS A;  4W9I A;  4GIV A;  3IT6 B;  1KFY B;  1HE8 A;  4GDL A;  3DBH B;  3TCA A;  2WNM A;  4K7W A;  2DLB A;  1JML A;  2V3P A;  3P1M A;  4WQM A;  4WAA A;  2CS4 A;  5J17 A;  4GSW A;  1FFV A;  3PZD A;  4AJW A;  4A09 A;  2TSS A;  1ZGU B;  4RF0 A;  4DHJ D;  4DXG A;  2CU1 A;  4AQ7 A;  2YEP F;  5E6N A;  3U2S C;  5HHD G;  1XLP A;  4MH0 E;  3Q2A C;  4IWP A;  3OG5 A;  2ZOS A;  1D6E C;  4P16 A;  4HVB A;  2LHD A;  1L4D B;  3H8H A;  1KLV A;  2M4N A;  3RNB C;  1WX8 A;  3IAS 1;  2FCQ A;  3U7Z A;  4W9F A;  4BKS D;  2NBU A;  1D5X C;  1N5X A;  1OQQ A;  4NNJ B;  4XWT A;  4KGS A;  1QIL A;  1WGD A;  2N1W A;  2W3R A;  2CHX A;  3ZNI D;  2WU5 B;  3BK1 A;  2L0F A;  3NJT A;  1ROE A;  2WYQ A;  2VZK D;  2WXI A;  2EMT A;  4ZRJ A;  1J0G A;  4RGM A;  5DCN A;  4OZC A;  4HKZ E;  1M4V A;  2DWQ A;  1P3Q U;  3ZRC A;  2JXX A;  4C56 C;  2BPS A;  1BT0 A;  2MW5 A;  4AR8 A;  1ZDX A;  4WIP A;  2CU3 A;  1Q10 A;  4ZYN A;  1Q1O A;  2LUE A;  1RLF A;  5BYS A;  2IY1 B;  3ZXV A;  4HJK A;  4ANV A;  3A9J B;  2IO2 B;  1KM7 A;  4JPS A;  5DPW A;  3KUD B;  3GS2 A;  2R61 A;  4L23 A;  1FCL A;  1F52 A;  4TUU A;  2LRU A;  1WGG A;  1N5W A;  3AE5 B;  3WAO A;  3QCA A;  1KJT A;  3PRZ A;  5BO4 B;  2KQ4 X;  1UGJ A;  3L4P A;  1WFY A;  4LNK A;  1HA5 A;  3AE4 B;  1I4P A;  1MHH E;  1WH3 A;  3CWI A;  4FHK A;  1I7H A;  3V60 A;  3PT2 B;  3RNA C;  3V62 A;  4US8 A;  1T3Q A;  4HCP B;  2BKR B;  3QHT A;  1Y56 A;  2KC1 A;  3RZF A;  3I57 A;  3PO0 A;  4FJV B;  2VZK B;  2D11 A;  1ESF A;  5JZE B;  2KC2 A;  4RGT A;  1C9F A;  4HLE A;  1Q0W B;  1FFU A;  3PV1 A;  3U30 A;  3ZJU A;  1J7C A;  2LGI A;  3DBL I;  3ZRF A;  4R3D A;  2GBK A;  1CQV A;  4K3B A;  1VZ8 A;  4CI3 A;  1I4Q A;  1WM2 A;  1C1Y B;  2MBO A;  1HZ6 A;  2WXO A;  4HDQ A;  3I7O A;  2BKF A;  1WE6 A;  1YQB A;  2JUO A;  2D3A A;  1MJD A;  2KDB A;  3AB5 A;  1JCK B;  4XYC A;  1TS5 A;  3JSV A;  4HPL B;  4I6P A;  4ZRQ A;  2E6X A;  3HUI A;  2IO3 B;  1ZP0 B;  4ZHO A;  2KVR A;  4DDI D;  1D5M C;  3ZX4 A;  3DDC B;  1E10 A;  2DYM A;  3Q69 A;  2WXN A;  3AI5 A;  3PPA A;  2L32 A;  4E3C A;  2L1A A;  1TTN A;  1NI3 A;  1EWY C;  1YMH E;  4PK1 A;  3RHU A;  1IGD A;  1RYJ A;  2WXH A;  4L2Y A;  4BOS C;  4A0A A;  1RWS A;  5H92 C;  3UGB B;  3VTV A;  4IW0 A;  2IGD A;  1ISN A;  3SR6 A;  3AE9 B;  3KVF B;  4C80 A;  3RD2 A;  1N6Z A;  2WX0 A;  2KLC A;  2DAJ A;  3ZLZ A;  2I06 A;  5IO9 A;  4A55 A;  5C1Z A;  1V1O A;  3N9Y C;  2RDB C;  2HDE A;  4C00 A;  1WXM A;  3ZIM A;  3Q14 C;  4HWI B;  2RSU A;  1V97 A;  4DXA B;  1TJE A;  3V05 A;  1CMX B;  4W9E A;  4IM0 A;  3H9D A;  2MWS B;  4KDI C;  4EE2 A;  3IVF A;  2WXK A;  2K8H A;  1FXA A;  1GAQ B;  4MGK E;  4XR1 A;  1WSP A;  2M17 A;  2ICI A;  3VR8 B;  1LO5 D;  2O6V A;  4B0E A;  3OLM D;  3IT4 B;  3C0R B;  2WXM A;  3P63 A;  2GRI A;  1PFD A;  4P7I A;  1XEE A;  3B2G A;  3K9O B;  3PZ8 A;  1LGR A;  2DZM A;  2C7M B;  2G45 B;  1F77 A;  2KOX A;  4ARF A;  2KDF B;  4RGN A;  4JQW C;  5FKA C;  3SDL C;  1L4Z B;  2MP2 A;  1UWM A;  3AEE B;  1UNS A;  1SF0 A;  1MI0 A;  2KHW B;  2JRH A;  3NZU A;  2JPH A;  2CHW A;  1C76 A;  2BYV E;  3HRD D;  5HFY A;  4KIK B;  1FNW A;  1WY8 A;  4FBJ B;  4GMV A;  1EF5 A;  3V6C B;  4GN1 A;  3ZXR A;  2WXJ A;  3A9K B;  4EKU A;  2HJ8 A;  2QMT A;  2FNJ B;  1WZC A;  3OJ4 B;  3BVZ A;  1WXS A;  2G1E A;  1JRP A;  2EWJ A;  1YD8 U;  2D5G A;  3P4R B;  2N9X A;  4IWO A;  4WQO B;  4IOI E;  3KWV A;  2KAJ A;  1H4R A;  5IAA C;  1FXT B;  1VRA B;  2YLM A;  3KYD D;  2BWF A;  1LFD A;  3EA6 A;  3TJP A;  2HJ1 A;  1I35 A;  3I7K A;  4J6I A;  1WZ0 A;  2LMC A;  4RGO S;  2LJI A;  4MGY E;  4AP4 C;  2V4I B;  2FUG 1;  5HG2 A;  4MSM B;  3DCG A;  3HM3 A;  3UQB A;  1WE7 A;  1D5Z C;  2FAZ A;  1T0R C;  3EHV A;  2WXG A;  2KAC A;  5D7G A;  1GB1 A;  3RFZ B;  2MBH A;  3AEG B;  3DVG Y;  4RNA A;  4TMA B;  4G50 A;  1DGJ A;  4W9H A;  3Q8B A;  4ZHP A;  3JYU A;  1XO3 A;  3R2T A;  4CO7 A;  2KXJ A;  2LGD A;  1WRI A;  5C2T B;  1WZ3 A;  2H88 B;  3BYY B;  4AOF A;  1SIJ A;  1E9M A;  5CX3 A;  1HQR D;  1SSN A;  3T9L A;  2QCZ A;  3I7L A;  4S17 A;  1TY0 A;  2V1Y A;  4LJP B;  5C23 A;  3RZW C;  2BS2 B;  4ANX A;  4C4V A;  2GB1 A;  3H7P B;  4NZL B;  1GB4 A;  2BB5 A;  2M0X A;  3ALB A;  2AQ2 B;  1NEK B;  1UEL A;  2LFI A;  3URY A;  3Q6B A;  3AE1 B;  1C3T A;  3W1S C;  4AWJ A;  3AED B;  2BYF A;  3TUO A;  3I63 C;  3KWL A;  3EC8 A;  1SJH D;  2KWC A;  2QEJ C;  3N32 A;  2RD0 A;  4XE0 A;  2Y6I A;  2FCM A;  3AE6 B;  4RFB A;  3BYT B;  2GMI C;  2KFK B;  3APC A;  4YL8 A;  3AUL A;  2KTF A;  2KMM A;  4YT0 B;  2IZV B;  3I7P A;  1PGA A;  3N1Y C;  5JHA A;  4C7Y A;  3M95 A;  3GZN I;  4A3P A;  1ZUD 2;  4JGH B;  4JE3 B;  2PJH A;  1IP9 A;  5E6O A;  4XC2 A;  1JAL A;  4EOY A;  3TMP B;  3R7Q A;  1EF1 A;  1TY2 A;  4NAW B;  2KJR A;  2K5P A;  4KSK C;  4A0B A;  4H2A A;  3HM6 X;  3AN1 A;  1IBX A;  4W9K A;  1DOY A;  2KDI A;  1TGZ B;  3EUB 2;  2W54 A;  4ACF A;  3VTW A;  3ONS A;  4AR1 A;  3U52 E;  3GE8 C;  4GDK B;  2KKC A;  2O6V B;  2BYE A;  2WXF A;  4JL9 A;  2BTE A;  4AS1 A;  5GXG B;  4GDL B;  1ET9 A;  1H8C A;  1EM7 A;  2ZNV B;  1WRD B;  1HEZ E;  1XXG A;  4REZ A;  3RMK C;  3AE3 B;  2M56 B;  3B0A A;  3P42 A;  1WYG A;  3PHW B;  4FUL A;  2G9H D;  1VR9 A;  5BMG A;  2KFK A;  4HEA 1;  2Y50 A;  3IXS A;  4LDT B;  4ZRK A;  1WJN A;  4KSL C;  2V3S A;  3P4Q B;  2K8C A;  2IGH A;  2JF5 A;  4K7S A;  2WDV B;  3R2I A;  1FMA D;  4K1R B;  3X23 A;  1SIF A;  2K1F A;  2PE6 B;  4TSS A;  3DPD A;  1QOG A;  3I8C A;  3CST A;  4HK2 A;  4KZ0 A;  3TBL D;  2WXR A;  4MGZ E;  1WXO A;  2LHE A;  3NVZ A;  4G11 A;  3EEC A;  2J0J A;  4BKT A;  1WR1 A;  2IUT A;  3AM9 A;  3DOW A;  2KJ6 A;  2SAK A;  1WM3 A;  2N9P C;  2PLP A;  2J4X A;  2JQR B;  3BY4 B;  2BWE S;  1RFA A;  3U4E G;  1TS4 A;  1GC7 A;  1EU4 A;  4YSX B;  4MT5 A;  1OFF A;  1V1P A;  1FPY A;  1N63 A;  3E9S A;  2Z0D B;  1J7A A;  2MH7 A;  3L17 A;  3WIM A;  1MFW A;  4K3C A;  5E6P A;  1KLU D;  4EFO A;  3GB1 A;  3RT3 B;  2UU7 A;  3A1Q A;  1VJK A;  3KW5 B;  4W9C A;  3APD A;  4A08 A;  1L7Y A;  3NY5 A;  2ASQ A;  5T8I A;  2LJ5 A;  2KN4 A;  3VH4 B;  2C7H A;  2K39 A;  2HD5 B;  3ZU6 A;  1YOV B;  3ZTY A;  5IOI A;  2YVC A;  2WP9 B;  2BQQ A;  2LGX A;  4TKN A;  4IWQ A;  3ZYY X;  3DBR B;  2CKH B;  4FN2 A;  1C4C A;  2K25 A;  2IUU A;  4M02 A;  1AYF A;  1I4G A;  3GOE A;  5TSS A;  2C5L C;  2NPT A;  2KQS A;  3W5V B;  2K9X A;  3OWE B;  4XZ4 A;  2WQY B;  3VRA B;  4NJC A;  1OQY A;  2B5M A;  1ZE3 D;  3DVG X;  3ZNZ B;  5J2R A;  4ANU A;  2ZZF A;  1T5X D;  3LXF A;  3WAM A;  1I4R A;  1WF9 A;  4A8X C;  2ONQ A;  1STE A;  2X8X X;  4LNO A;  4PS3 A;  4HXD A;  3TEX A;  3IG3 A;  2IO1 B;  3PRE A;  2LAS A;  2BVC A;  2D3C A;  4GU2 A;  3IFW B;  1SEB D;  4M8M A;  2MBB B;  3SFD B;  4DHZ E;  5AUI A;  2MHJ A;  3PRP B;  4ZOH C;  1ENF A;  1GOZ A;  1LXD A;  3HVZ A;  1JW9 D;  1V7O A;  4F1S A;  4P1C C;  3X0W A;  4IM3 A;  1T0Y A;  1KTK A;  3DBR I;  2IBI B;  2Y3A A;  3BVG A;  2L00 B;  3N20 C;  4FA6 A;  1P7E A;  4OZA A;  4ZRI A;  2AX5 A;  2C7N B;  1XT9 B;  2HTM E;  2INP E;  2KDM A;  4KIK A;  3W2D A;  3QK0 A;  1ACC A;  2DHZ A;  1B1Z A;  3ZX5 A;  2MEK A;  4MGI E;  1TYG B;  3AEB B;  4BZA A;  1L6U A;  1T0Q C;  3MC9 A;  1QOB A;  2MJ3 A;  4BBN F;  2DZJ A;  4ICV A;  1YX6 B;  1P1A A;  1E0Z A;  3ZO5 B;  2KWU B;  3Q8C A;  1XQQ A;  2IND C;  3RUL A;  4DHJ B;  4YXD B;  3SU8 X;  4W9J A;  2JZP A;  2KVZ A;  1WWT A;  1FCC C;  5AZF A;  2UWQ A;  2JZZ A;  2LRW A;  5FQD A;  2JY6 A;  3V6E B;  2PEA A;  1SB3 C;  4WH4 A;  4C4V B;  3H7P A;  4JWS C;  3ABV B;  4JLC A;  5JXV A;  2VH1 A;  1F9J A;  3L13 A;  2LZ6 A;  2J7Q B;  2MJE A;  3Q3O C;  2BW2 A;  2Z8L A;  5I4D A;  1K51 A;  3OJ3 A;  1XCT L;  2ZPN A;  2NR2 A;  1YIW A;  4HRS A;  5BYQ A;  2KLG A;  1HZ5 A;  2OJR A;  1SE3 A;  4N6E B;  3MFG A;  4O1N A;  3DVN U;  3SFE B;  1D3Z A;  1P9D U;  1YJJ A;  3ZVV A;  1EUV B;  4II3 B;  3EFU A;  2XEW A;  4YSY B;  4ARE A;  4TQ1 A;  4P6V F;  1YN3 A;  1WMH A;  4AJY B;  3P4P B;  3WAL A;  2WS3 B;  2KNB A;  2JT4 B;  4XR2 A;  2BYT A;  1I42 A;  3Q8A A;  4XGA B;  2QC8 A;  4DDG D;  2N7D A;  1CK1 A;  2Q5W D;  4M0W B;  1GUA B;  2JYE A;  2I38 A;  2K0P A;  4TQ0 A;  2BGF A;  2M8S A;  2N1V A;  3NG0 A;  2JWU A;  1QF6 A;  4WJP A;  4GGQ A;  1L5P A;  4WWO A;  3S2A A;  1QQR A;  1K50 A;  1E5W A;  1TKE A;  4BVU C;  3W1Y A;  2OHF A;  1KH0 A;  2FCN A;  3UQA A;  1UGM A;  5IP4 D;  5AUK A;  1LM8 B;  1RM6 C;  2Z59 B;  1YJI A;  2WXQ A;  4IDI A;  2PE9 A;  2LGY A;  4M8N A;  4ZRP A;  2CJN A;  3U8Z A;  3VFK A;  4BKS A;  5D94 A;  1T6B X;  2IPK D;  1EO6 A;  1MPE A;  1HTO A;  3FIL B;  1V9J A;  5CHV C;  1K52 A;  1P0R A;  2K8B A;  2LXA A;  3ZTD A;  2JU6 X;  1VZ6 A;  2M19 A;  2QSD A;  4A90 A;  3ETR A;  1V80 A;  2G3Q B;  2MBE A;  5KHO A;  3MHZ A;  1WI0 A;  3Q3M C;  4P1B C;  3NUH B;  2WX1 A;  2ZPY A;  3N1Z C;  4FLH A;  5AZG A;  2ZVN A;  2LWP A;  1PUT A;  1J7B A;  2L83 A;  1XLQ A;  3PLU A;  4YTN B;  3U7D A;  2FCS A;  3Q8E A;  3KQ4 A;  3AMZ A;  3OAW A;  1TT5 B;  3MC8 A;  3N1X C;  3DWG C;  1TKG A;  4MSQ B;  5G5H A;  2DBY A;  1N62 A;  3KUC B;  3AU5 A;  2N7E A;  4C7Z A;  5G55 A;  5C3J B;  2NCN A;  1ZDV A;  2WGS A;  2IY0 B;  2Y3U A;  3ZKJ C;  2ZCC A;  2GBM A;  3KUZ A;  2J0M A;  1BUI C;  2GBJ A;  1L0V B;  3ZGZ A;  2RPV A;  2ZVO A;  4LNI A;  2DX5 B;  3KYC D;  3QAR A;  2REX A;  3I7H A;  4A9A A;  2J42 A;  4DHZ B;  3UF8 A;  5BMI A;  2AL3 A;  4LCD E;  3RFN A;  3A9K A;  3I9V 1;  3DBL B;  4KKI A;  1SGH A;  3CMM B;  4NPN A;  1R4M I;  2WXL A;  3DBH I;  3BII D;  2LUM A;  3MHS D;  3O65 B;  4KGR A;  4AUQ C;  4PYZ A;  4M0W A;  1E7V A;  1SJE D;  3PRM B;  4A20 A;  4OVU A;  2A5U A;  1XVI A;  4E54 A;  4YWG G;  2ZTG A;  2V4L A;  4WWN A;  3Q3F A;  3M63 B;  5JHB A;  2KT7 A;  3BVM A;  4NQL B;  4CYE A;  1A5R A;  2VH2 A;  2GLS A;  4KZC A;  4HRO A;  3RCZ A;  1ECR A;  1VLB A;  1AAR A;  1R7S A;  5AEK B;  3P2B A;  5TR5 A;  2ZZP B;  2QIE B;  1R4N B;  2WXP A;  2N0S B;  5FK9 C;  4LNN A;  3RUI B;  2ZZG A;  1D4B A;  3AXC A;  1MG8 A;  3BK2 A;  2SEB D;  2XK5 B;  2B5L A;  3WAP A;  1E8Y A;  3A9J A;  2NBV B;  3VTU A;  4NJ7 A;  1AN8 A;  2NBW B;  3L08 A;  1ZKH A;  1TKY A;  2KMA A;  4KDL B;  1C4P A;  3PGE A;  2BF8 B;  1L0X B;  3H7S A;  3KLS X;  1PYW D;  3CIR B;  1CJE A;  4OVZ A;  3TSS A;  3VH3 B;  4GLS C;  2M0A A;  4RM9 A;  1UUP A;  1WXQ A;  3UIN B;  2FID A;  3GZN B;  5E6J A;  3LJ3 A;  2L3Z A;  3QC8 B;  4TV3 A;  1TBE A;  2NTS A;  3B1L X;  4KGT A;  4DXF A;  1V5O A;  2W82 A;  2JZ3 B;  1DOI A;  3QIJ A;  2RDG A;  3VR9 B;  2WDT B;  4E74 A;  5D6J B;  2MBQ A;  1Z2M A;  3NZ3 A;  3HIZ A;  4MM3 B;  3GE3 C;  1TIF A;  1E8X A;  4WJQ A;  4GDK A;  1DYQ A;  3NVY A;  2Y5C A;  4GXB A;  3ZWK A;  2M1M A;  1WX7 A;  1YNT E;  4WWM A;  3VVW B;  1HXY D;  3TL5 A;  1I4H A;  2V9H A;  4W9L A;  3EGR A;  5EE3 A;  1K8R B;  3VUY A;  2MCN B;  3RN9 C;  4B6W A;  2KYW A;  2WLB A;  5DPT A;  3M62 B;  2LD9 A;  1V5T A;  1WGR A;  4ASW C;  4LDT D;  4B9K A;  2XK5 A;  4XDD A;  2LGS A;  2G4S A;  2KJH B;  1OEY A;  4ARI A;  1R4M B;  3JVZ X;  2QIL A;  3IAM 1;  2IYD B;  2INN E;  2BB6 A;  2DZK A;  2Z0E B;  2L7R A;  5CHF A;  1NDD A;  4LJO B;  4D2K A;  3CF6 E;  1XLO A;  2DYO A;  3QA8 A;  4HPM B;  4UDU C;  2D07 B;  1ZPS A;  1VZ7 A;  1F1H A;  3PTF C;  1IBX B;  3L54 A;  1EWC A;  5LLI A;  4EZK A;  1C79 A;  4DQO C;  2PKO A;  3EFC A;  1FNV A;  2WWZ A;  3GP7 A;  3RI7 C;  2L76 A;  3VAW A;  2FBW B;  2MQJ A;  2LXC A;  3ZW7 A;  1GPX A;  4ANW A;  4G3X B;  2R2Q A;  1JRO A;  3RPF C;  1N60 A;  3O13 A;  3JW0 X;  3EI3 A;  2K6Q A;  3AEA B;  1M94 A;  1L2N A;  4HCN B;  1B9R A;  2Y5P A;  3WAN A;  1UH6 A;  3UIP B;  3E56 A;  3TEW A;  2OED A;  5DPR A;  3MP9 A;  1GJZ A;  1P7F A;  1E8Z A;  2AL6 A;  3ZJT A;  2QDF A;  2ZNV C;  3ZUP A;  1NBF C;  5BYR A;  1J8C A;  4EUT A;  3AH7 A;  1JWS D;  2AQ3 B;  1WX9 A;  2O6V D;  3EI4 A;  3R66 C;  1ZXH A;  4QAY A;  4HKQ A;  4NY0 A;  3JSV B;  4OZB A;  2KO3 A;  4KV2 A;  1KOT A;  1SXT A;  4F7Z A;  4URK A;  3D32 A;  1QOF A;  1QOA A;  2LI5 A;  2AWT A;  4CHK A;  4NAW A;  3WA0 A;  1JRU A;  2G4D B;  2PW9 A;  4CQN A;  4IG7 B;  2GBR A;  2DNF A;  3T3O A;  2H89 B;  4A3O A;  2FUH B;  4FJY A;  1FRD A;  2O2V A;  4PS7 A;  1JWM D;  2NS5 A;  4FXC A;  2JVC A;  2WU2 B;  1FXI A;  5AZH A;  1XD3 B;  1E7P B;  1QKZ A;  2NPT B;  3W1S A;  4OW0 A;  1SE4 A;  1FNU A;  4ARC A;  2CJO A;  1SE2 A;  2L0T A;  1WYW B;  3RYT A;  2JWZ A;  2WHI A;  4HJG E;  3C19 A;  1ZOY B;  3R7R A;  1WXA A;  2BT6 A;  2W9N A;  3WCQ A;  5GMV A;  1XCQ L;  3I89 A;  4YSZ B;  2Y5B B;  2EMS A;  3BIN A;  1UD7 A;  3PSE B;  3NZS A;  2I2Y A;  2N9K A;  3AE2 B;  3C8Y A;  3AU4 A;  2E1B A;  5J18 A;  4LLG M;  3ZJV A;  3ENE A;  4Q2J A;  2I1K A;  4N58 A;  2PMV A;  3HHM A;  1NEN B;  2KTR A;  2JYT A;  3AE7 B;  2B3A A;  4E5Z A;  2ZJD A;  5LXI B;  3SHQ A;  1FEH A;  4RM8 A;  2QHO A;  1YN5 A;  2JXT A;  2KZR A;  1OQR A;  1WJU A;  2ZW0 A;  3MJW A;  4GOC A;  3ZNG C;  2J0K A;  1OEY J;  4AR9 A;  3VQI A;  2XBB C;  3P4S B;  5CHW A;  1IPG A;  2RPQ A;  3NS1 A;  1P98 A;  2W3S A;  1WJ4 A;  1WXV A;  3PZ7 A;  4WAF A;  1EU3 A;  2AQ1 B;  4I6N B;  2KX0 A;  3EI2 A;  3Q3N C;  2D3B A;  2KQ7 A;  2OJW A;  3DHI C;  1WNU A;  5KHQ A;  3BZD B;  4X57 B;  3LYY A;  3PHX B;  5EDS A;  1KF6 B;  5IKC M;  1FIQ A;  3DQV A;  3MC0 B;  3L10 B;  4M00 A;  1S3S G;  1PQS A;  3ML8 A;  3VUX A;  2D2Q A;  1DOX A;  2LEK A;  4NQK E;  2N4F A;  1S1Q B;  1PDX A;  1Y8R C;  3AE8 B;  4MAC A;  1FRR A;  4WJO A;  2N7J A;  3IBE A;  4L1B A;  1VD2 A;  2MJD A;  5H8Y E;  4GB9 A;  1UWX A;  1HTQ A;  3J9C A;  3ZDM C;  2KK8 A;  4WJN A;  4BKG A;  2X38 A;  3A4R A;  4KVG B;  2FIF A;  3K9P B;  4N9F 4;  1OTR B;  4DBG A;  1V86 A;  2A4Z A;  2GBN A;  2KMC A;  4MEM A;  3ZTW A;  2DZI A;  1ET6 A;  5LNK 1;  3FIL A;  2NVU I;  4OVV A;  1V4P A;  1L0Y B;  3V61 A;  1MVK A;  4MJS A;  2PPH A;  1IYF A;  1F0Z A;  4US9 A;  2D3G A;  1V8C A;  3H6N A;  2XNA C;  2ZZE A;  4PT5 A;  2YEP B;  3VUW A;  2JSV X;  2MLB A;  1UBQ A;  1NYQ A;  3I3T B;  3LB8 C;  5HKH A;  4IUM B;  3DHG C;  3BWU D;  4XWW A;  3W9C B;  3KEW A;  2CHZ A;  1WGY A;  3B9J A;  1GNU A;  4B0M A;  2N9E B;  4A6Q A;  2B76 B;  4B95 A;  2BS4 B;  1V49 A;  2ACZ B;  2W55 A;  3N30 A;  4ICU A;  1MG4 A;  2L05 A;  4USA A;  2JX5 A;  3NOB A;  4K81 A;  3DWM A;  1GC6 A;  3A1Q B;  1E7U A;  4S0R A;  4A11 A;  3ZW3 A;  1YX5 B;  2C60 A;  2NMQ A;  2WDQ B;  2KAN A;  3FAH A;  3B2F A;  4LK0 M;  4NJ6 A;  3QJZ A;  2LVP A;  2XN9 C;  1RFK A;  2K6D B;  3PVL A;  1Q5W B;  1SBB B;  1UF0 A;  2HTH A;  4RF1 A;  3T8M A;  1V81 A;  5LXH A;  2MRP A;  2PVG C;  3NVV A;  3APF A;  4WWP A;  3I5J C;  3Q3J A;  3NVW A;  2V3N A;  4M01 A;  1VCB A;  1YN4 A;  1XLN A;  1JQ4 A;  1N61 A;  2ZEQ A;  1K53 A;  2KN5 A;  3N3K B;  2KX3 A;  1AWD A;  1UBI A;  1F2R I;  4HPP A;  4FJZ A; 
#chains in the Genus database with same CATH homology
 2VZK B;  1ESF A;  1NVI D;  1QOG A;  4RGT A;  1TKY A;  3I8C A;  4OHJ A;  1C9F A;  1WXO A;  2WXR A;  1C4P A;  2LHE A;  3NVZ A;  1FFU A;  1L0X B;  2IUT A;  3AM9 A;  1J7C A;  3KLS X;  2LGI A;  3ZJU A;  1PYW D;  2SAK A;  4R3D A;  1FO4 A;  1CQV A;  1VZ8 A;  3CIR B;  2PLP A;  4CI3 A;  1CJE A;  1I4Q A;  2J4X A;  2JQR B;  4OVZ A;  3TSS A;  3U4E G;  1HZ6 A;  1TS4 A;  2J52 A;  2WXO A;  4RCO A;  3I7O A;  4GLS C;  1EU4 A;  3Q8F A;  4YSX B;  3EI1 A;  2M0A A;  4MT5 A;  1OFF A;  1UUP A;  1WXQ A;  1V1P A;  5E6J A;  1N63 A;  3E9S A;  1J7A A;  2MH7 A;  4CI1 A;  1KLU D;  3AB5 A;  2NTS A;  3GB1 A;  1JCK B;  4NAM A;  1TS5 A;  4KGT A;  4DXF A;  4ZRQ A;  1L6V A;  2W82 A;  4ZYS A;  3I8E A;  1DOI A;  2E6X A;  2RDG A;  3HUI A;  1ZXI A;  1VJK A;  3VR9 B;  1ZP0 B;  3AEC B;  4ZHO A;  1D5M C;  3NZ3 A;  4A08 A;  4MM3 B;  1F2R C;  1E10 A;  2DYM A;  1DYQ A;  3NVY A;  3Q69 A;  2Y5C A;  2WXN A;  5EE9 A;  5T8I A;  2KN4 A;  2L32 A;  1YNT E;  4WWM A;  2E3T A;  1HXY D;  2L1A A;  1NI3 A;  2I05 A;  1I4H A;  1EWY C;  3EGR A;  5EE3 A;  2WP9 B;  1YMH E;  1KRH A;  3RHU A;  1IGD A;  3ZYY X;  1RYJ A;  2N9L A;  2WXH A;  1FD6 A;  4L2Y A;  4A0A A;  1RWS A;  5H92 C;  5EE1 A;  2WLB A;  2IGD A;  3T3N A;  1C4C A;  3TEY A;  1A70 A;  3SR6 A;  3AE9 B;  3E0C A;  4C80 A;  4TZ4 A;  2IUU A;  1AYF A;  3W5U B;  1I4G A;  5TSS A;  4XDD A;  2EKI A;  4ARI A;  3W5V B;  5D3I B;  2IJ0 A;  2K9X A;  3OWE B;  2QIL A;  3AEF B;  3IAM 1;  2WQY B;  2INN E;  3VRA B;  1IUE A;  4NJC A;  2I06 A;  2BB6 A;  4A55 A;  2B5M A;  1ZE3 D;  2HYE A;  1V1O A;  1T5X D;  3N9Y C;  3HVD A;  2HDE A;  3LXF A;  1I4R A;  2ZZF A;  4KX6 B;  4A8X C;  2ONQ A;  1IGC A;  1JWB D;  1STE A;  2BS3 B;  4D2K A;  1XLO A;  2DYO A;  3TEX A;  4UDU C;  4KKJ A;  1V97 A;  1ZPS A;  1CZP A;  1TJE A;  3V05 A;  1VZ7 A;  1IBX B;  2PTL A;  1EWC A;  1SEB D;  5D3D A;  1C79 A;  3SFD B;  1KLG D;  5AUI A;  4DQO C;  4EE2 A;  1BML C;  2WXK A;  2PKO A;  4ZOH C;  1FNV A;  1FXA A;  1GAQ B;  3GP7 A;  4XR1 A;  1ENF A;  1GOZ A;  1WSP A;  1YQ4 B;  3HVZ A;  2ICI A;  3VR8 B;  1LO5 D;  4B0E A;  1JW9 D;  2FBW B;  1NYR A;  4RH6 A;  1V7O A;  3IT4 B;  2WXM A;  3P63 A;  2GRI A;  2ON8 A;  1KTK A;  1QT9 A;  5G5G A;  1GPX A;  1PFD A;  1JRO A;  3R8B A;  2Y3A A;  3BVG A;  3RPF C;  1N60 A;  3O13 A;  1P7E A;  1XEE A;  4OZA A;  3B2G A;  3EI3 A;  4XR3 A;  2ZW1 A;  2AX5 A;  3AEA B;  3FC4 A;  3PZ8 A;  4JX1 C;  2HTM E;  2INP E;  2KDM A;  1B9R A;  1F77 A;  3W2D A;  2Y5P A;  1PGX A;  1ACC A;  1YQ3 B;  3TEW A;  3E56 A;  1XF5 L;  1B1Z A;  4ARF A;  2OED A;  2QJL A;  2MEK A;  2NTT A;  3MP9 A;  1P7F A;  4RGN A;  3ZJT A;  2FE8 A;  5EE0 A;  2IUS A;  5FKA C;  1AW7 A;  1TYG B;  5BYR A;  3AEB B;  4LTU A;  4XDC A;  1L4Z B;  1L6U A;  1V1P B;  3I7N A;  3AH7 A;  1JWA D;  1UWM A;  1QOB A;  2MJ3 A;  1UNS A;  3AEE B;  1JWS D;  2GI9 A;  1SF0 A;  1MI0 A;  2AQ3 B;  4ITK A;  2PIA A;  4XR0 A;  1C78 A;  1C76 A;  3EI4 A;  1BXT A;  4JWU C;  1ZXH A;  1E0Z A;  4HKQ A;  3HRD D;  3Q8C A;  5HFY A;  1VDV A;  3TEZ A;  4OZB A;  4YXD B;  3MJ5 A;  1SXT A;  1FNW A;  1WGK A;  1PGB A;  1C4A A;  2JZP A;  1QOF A;  1WWT A;  4CI2 A;  1FCC C;  1QOA A;  2WXJ A;  2QMT A;  5FQD A;  3BVZ A;  5MPO A;  2PW9 A;  4CQN A;  1SB3 C;  4WH4 A;  2BBC A;  2G1E A;  1JRP A;  3VRB B;  3T3O A;  4JWS C;  2EWJ A;  3ABV B;  2H89 B;  5JXV A;  2PVO D;  1FRD A;  4WUR A;  1JWM D;  4FXC A;  4N59 A;  2MJE A;  2WU2 B;  1FXI A;  2BW2 A;  2Z8L A;  1E7P B;  1QKZ A;  3W1S A;  2K3U A;  2D5G A;  4OW0 A;  5I4D A;  1K51 A;  3P4R B;  1SE4 A;  1XCT L;  1FNU A;  2K22 A;  4ARC A;  2CJO A;  4HRS A;  5BYQ A;  1SE2 A;  1HZ5 A;  1E6E B;  1SE3 A;  4N6E B;  3SEB A;  4HJG E;  3MFG A;  4O1N A;  1ZOY B;  3SFE B;  1FM0 D;  1TS3 A;  2BT6 A;  4IOI E;  1YJJ A;  3KWV A;  4MH8 A;  2RDH A;  2WDR B;  3WCQ A;  1XCQ L;  2KAJ A;  3I89 A;  4YSY B;  4J3O D;  4YSZ B;  4ARE A;  4TQ1 A;  4P6V F;  1TZO A;  2IGG A;  1VRA B;  5BMH A;  1YN3 A;  2I2Y A;  3P4P B;  1MHX A;  2RMM A;  2N9K A;  2WS3 B;  3EA6 A;  3AE2 B;  4XR2 A;  2BYT A;  3AV8 A;  3C8Y A;  3Q8A A;  3I7K A;  4IKG A;  2E1B A;  4LLG M;  3ZJV A;  2LMC A;  2V0G A;  2J53 A;  4RGO S;  4Q2J A;  2LJI A;  1CK1 A;  2Q5W D;  4N58 A;  3NRZ A;  2PMV A;  2V4I B;  1NEN B;  2FUG 1;  5HG2 A;  2JYT A;  3AE7 B;  4E5Z A;  3UI3 A;  1D5Z C;  2JYE A;  2I38 A;  2K0P A;  1TS2 A;  3ZQ4 A;  1FEH A;  4TQ0 A;  4YTM B;  2KWD A;  3V3X A;  5FR3 A;  1QLB B;  1YN5 A;  2WXG A;  4YTP B;  2JXT A;  2KAC A;  5D7G A;  2JWU A;  1QF6 A;  1GB1 A;  1C77 A;  3RFZ B;  1OQR A;  3WQZ A;  1L5P A;  2ZW0 A;  3AEG B;  4RNA A;  4TMA B;  4AR9 A;  3VQI A;  2EEL A;  1DGJ A;  3P4S B;  3Q8B A;  1QQR A;  4ZHP A;  1K50 A;  2L52 A;  3NS1 A;  1TKE A;  1JWU D;  2W3S A;  2IDY A;  5HI1 A;  3PZ7 A;  2OHF A;  4WAF A;  1KH0 A;  1XO3 A;  1I4X A;  3R2T A;  1EU3 A;  2AQ1 B;  5AUK A;  1WRI A;  5C2T B;  1RM6 C;  3EI2 A;  1YJI A;  2H88 B;  2WXQ A;  3BYY B;  1SIJ A;  1E9M A;  4IDI A;  3IT6 B;  1KFY B;  1WNU A;  1HQR D;  1SSN A;  3BZD B;  2CJN A;  4ZRP A;  3LYY A;  2WNM A;  3I7L A;  1T6B X;  1JML A;  2DLB A;  1TY0 A;  2IPK D;  2V3P A;  1KF6 B;  3P1M A;  1FIQ A;  3MC0 B;  4WQM A;  1MPE A;  3FIL B;  2BS2 B;  2GB1 A;  1FFV A;  4NZL B;  1GB4 A;  4A09 A;  2BB5 A;  1DOX A;  1K52 A;  2LEK A;  2JU6 X;  1VZ6 A;  2M19 A;  2TSS A;  2QSD A;  4A90 A;  2AQ2 B;  1PDX A;  3ETR A;  3AE8 B;  4MAC A;  1FRR A;  4RF0 A;  4DXG A;  1NEK B;  2LFI A;  3URY A;  2N7J A;  3AE1 B;  4L1B A;  3MHZ A;  3AED B;  4AQ7 A;  2YEP F;  2MJD A;  3TUO A;  5H8Y E;  1UWX A;  3NUH B;  3KWL A;  3J9C A;  3U2S C;  5HHD G;  1XLP A;  2X38 A;  1PUT A;  1D6E C;  1J7B A;  2L83 A;  4P16 A;  1XLQ A;  2LHD A;  1SJH D;  4YTN B;  1L4D B;  2QEJ C;  3H8H A;  1ET6 A;  3Q8E A;  5LNK 1;  3KQ4 A;  3AMZ A;  3FIL A;  3U7Z A;  3IAS 1;  3DWG C;  1TKG A;  4XE0 A;  2Y6I A;  5G5H A;  1D5X C;  3AE6 B;  1N5X A;  1V4P A;  2DBY A;  1OQQ A;  1N62 A;  4RFB A;  1L0Y B;  3BYT B;  1MVK A;  4XWT A;  4KGS A;  4C7Z A;  5C3J B;  1QIL A;  1ZDV A;  2Y3U A;  1F0Z A;  2W3R A;  1BUI C;  4US9 A;  1L0V B;  2KMM A;  2WU5 B;  3BK1 A;  4YT0 B;  3I7P A;  3ZGZ A;  1V8C A;  2RPV A;  1ROE A;  2XNA C;  1PGA A;  2ZZE A;  2VZK D;  2WXI A;  4PT5 A;  2YEP B;  4RGM A;  4C7Y A;  4OZC A;  2JSV X;  4HKZ E;  3I7H A;  1M4V A;  1ZUD 2;  2DWQ A;  4A9A A;  1NYQ A;  3LB8 C;  4JE3 B;  2J42 A;  5BMI A;  3BWU D;  4XWW A;  3W9C B;  1JAL A;  4C56 C;  3KEW A;  3RFN A;  3I9V 1;  4AR8 A;  4KKI A;  1ZDX A;  3B9J A;  1TY2 A;  4WIP A;  2WXL A;  4NAW B;  2CU3 A;  4B0M A;  2K5P A;  3BII D;  4A6Q A;  2LUM A;  4H2A A;  1Q10 A;  3AN1 A;  2B76 B;  4KGR A;  1IBX A;  4A0B A;  1DOY A;  2BS4 B;  4M0W A;  1SJE D;  3EUB 2;  5BYS A;  2ACZ B;  2W55 A;  2W54 A;  4USA A;  4E54 A;  4AR1 A;  4JPS A;  2JX5 A;  3U52 E;  4YWG G;  2ZTG A;  4GDK B;  3GS2 A;  2R61 A;  4L23 A;  2WXF A;  3DWM A;  1FCL A;  2BTE A;  4AS1 A;  5GXG B;  4GDL B;  1ET9 A;  4A11 A;  2NMQ A;  2WDQ B;  1EM7 A;  3BVM A;  3B2F A;  3FAH A;  1N5W A;  1HEZ E;  1XXG A;  4REZ A;  4LK0 M;  4HRO A;  3AE5 B;  3AE3 B;  2M56 B;  3P42 A;  1WYG A;  1ECR A;  2XN9 C;  1VLB A;  1RFK A;  1SBB B;  1R7S A;  2G9H D;  4RF1 A;  1VR9 A;  2KQ4 X;  1UGJ A;  3L4P A;  5BMG A;  2PVG C;  3NVV A;  4HEA 1;  2Y50 A;  3IXS A;  1HA5 A;  3AE4 B;  1I4P A;  1MHH E;  2QIE B;  3CWI A;  3NVW A;  2WXP A;  2V3N A;  1I7H A;  2N0S B;  1YN4 A;  5FK9 C;  3P4Q B;  1XLN A;  4US8 A;  1JQ4 A;  2IGH A;  1N61 A;  1T3Q A;  2ZZG A;  1K53 A;  1D4B A;  2WDV B;  1AWD A;  1Y56 A;  3BK2 A;  2SEB D;  3R2I A;  1FMA D;  2B5L A;  3I57 A;  3PO0 A;  4TSS A;  1F2R I;  1AN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...