4XR0A

Escherichia coli replication terminator protein (tus) complexed with dna- g/t mismatch.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
308
structure length
308
Chain Sequence
ARYDLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Replisome speed determines the efficiency of the Tus-Ter replication termination barrier.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Replication/dna
molecule keywords DNA replication terminus site-binding protein
total genus 86
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05472 Ter DNA replication terminus site-binding protein (Ter protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.10 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 4xr0A02
3.50.14.10 Alpha Beta 3-Layer(bba) Sandwich Replication Terminator Protein (Tus); Chain A, domain 1 Replication terminator Tus, domain 1 superfamily/Replication terminator Tus 4xr0A01
1ECRA 2I05A 2EWJA 4XR0A 2I06A 4XR2A 4XR3A 4XR1A
chains in the Genus database with same CATH superfamily
1ECRA 4XR0A 3RHUA 3RFNA 4XR3A 1QF6A 2I05A 1V7OA 1TKGA 1TKYA 2ZTGA 2ZZGA 2EWJA 1TKEA 1WNUA 1V4PA 4XR1A 1TJEA 2ZZEA 2ZZFA 3WQZA 2I06A 1WXOA 4XR2A
chains in the Genus database with same CATH topology
1ECRA 4XR0A 3RHUA 3RFNA 4XR3A 1QF6A 2I05A 1V7OA 1TKGA 1TKYA 2ZTGA 2ZZGA 2EWJA 1TKEA 1WNUA 1V4PA 4XR1A 1TJEA 2ZZEA 2ZZFA 3WQZA 2I06A 1WXOA 4XR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ECR A;  2I05 A;  2EWJ A;  4XR0 A;  2I06 A;  4XR2 A;  4XR3 A;  4XR1 A; 
#chains in the Genus database with same CATH topology
 1ECR A;  4XR0 A;  3RHU A;  3RFN A;  4XR3 A;  1QF6 A;  2I05 A;  1V7O A;  1TKG A;  1TKY A;  2ZTG A;  2ZZG A;  2EWJ A;  1TKE A;  1WNU A;  1V4P A;  4XR1 A;  1TJE A;  2ZZE A;  2ZZF A;  3WQZ A;  2I06 A;  1WXO A;  4XR2 A; 
#chains in the Genus database with same CATH homology
 1ECR A;  4XR0 A;  3RHU A;  3RFN A;  4XR3 A;  1QF6 A;  2I05 A;  1V7O A;  1TKG A;  1TKY A;  2ZTG A;  2ZZG A;  2EWJ A;  1TKE A;  1WNU A;  1V4P A;  4XR1 A;  1TJE A;  2ZZE A;  2ZZF A;  3WQZ A;  2I06 A;  1WXO A;  4XR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...