1TJEA

Crystal structure of the editing domain of threonyl-trna synthetase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
b'MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonyl-tRNA synthetase
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tjeA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tjeA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tjeA02
3VR8B 1FFUA 1TKEA 1IUEA 1KFYB 1NVID 2W3RA 2WQYB 1RFKA 3CIRB 1DOXA 3VR9B 5MPOA 2DWQA 1PDXA 2K5PA 2BT6A 1V4PA 4ZHPA 2CJOA 2FBWB 5GXGB 4C7ZA 3AB5A 1NENB 3NVZA 3AE1B 2G1EA 3NVYA 3WCQA 3AEEB 5C3JB 3B9JA 3FC4A 3AEFB 1JALA 2MJDA 4ITKA 4YTNB 1JW9D 4HROA 2AX5A 2WP9B 1N5WA 2N0SB 4LTUA 1TJEA 3AH7A 5EE3A 1EWYC 2PVGC 3AEAB 1CZPA 2K22A 5H92C 3W9CB 1RM6C 1QOFA 2PKOA 1F0ZA 1WGKA 3KEWA 1CJEA 3AE7B 3RPFC 3ZYYX 1V97A 3P4RB 1FIQA 1PFDA 2BS2B 2EKIA 2ACZB 3AE4B 4KX6B 3P1MA 4C80A 3WQZA 3P4QB 5H8YE 3VRBB 4ZHOA 2PVOD 2BS4B 2E3TA 1VDVA 2WDQB 1FM0D 1XLPA 3ABVB 3P4PB 2JX5A 4WWMA 2OHFA 1FO4A 2MJ3A 1E7PB 1JROA 1OFFA 1XLQA 3LXFA 3CWIA 5EE1A 3AEBB 4C7YA 1N63A 2ZTGA 2WDVB 1L6VA 1OQQA 1ZOYB 4FXCA 1GPXA 4WQMA 1WXOA 1XO3A 2Y5CA 1UWMA 1QLBB 3SFEB 1YJJA 3DWGC 1NYRA 2L83A 3AE3B 4YT0B 3L4PA 5C2TB 2ZZEA 1E9MA 4US8A 3AE6B 3SR6A 5EE9A 2M56B 1J7CA 3LB8C 4JX1C 3P4SB 3B2GA 5G5HA 2WU5B 1FXIA 5G5GA 2H88B 1FRDA 3AE9B 1YQ4B 2BS3B 3HRDD 3RHUA 4JWSC 3KWLA 3SFDB 2CU3A 4HRSA 1J7BA 1QT9A 1WNUA 2QJLA 1YJIA 4YSZB 1VLBA 2KMMA 3ETRA 4YXDB 1WXQA 3AMZA 1SB3C 3AE5B 4N58A 4JWUC 1DOYA 2MH7A 1ZP0B 3NVVA 2MJEA 2H89B 4N59A 2KAJA 1N61A 1YQ3B 3W5UB 2W54A 2B76B 3AECB 4IDIA 2QIEB 1GAQB 1ROEA 1OQRA 2L52A 2M19A 3HUIA 2ZZGA 3AM9A 1JWBD 1QOGA 3AV8A 1L5PA 2CJNA 4YSYB 3FAHA 1AYFA 4YTPB 1QOBA 1ZUD2 4ZOHC 1SIJA 2LEKA 1TKGA 3AEDB 2ZZFA 1FMAD 1N62A 1WYGA 1I7HA 2WU2B 1L0VB 1WRIA 1E0ZA 2PIAA 1RYJA 1KF6B 4P6VF 1R7SA 1VJKA 4USAA 4US9A 5EE0A 1N60A 1V8CA 1NI3A 5AUIA 3PO0A 4N6EB 1B9RA 2HTME 1FXAA 3NVWA 1NYQA 1E10A 4YTMB 1KRHA 3DWMA 1N5XA 1TYGB 3VRAB 1QF6A 1E6EB 1JWAD 5AUKA 3AE2B 1FRRA 2DBYA 2JQRB 1A70A 1J7AA 1NEKB 1AWDA 2K9XA 2W55A 1RWSA 3NRZA 3P63A 3W5VB 1ZXIA 1DOIA 4A9AA 1XLOA 2W3SA 1WWTA 2Q5WD 1QOAA 3AEGB 3HVZA 1L6UA 3EUB2 1JQ4A 3RFNA 1FFVA 1PUTA 3NS1A 1T3QA 1DGJA 2WLBA 1V7OA 1JRPA 1XLNA 3AN1A 2WS3B 4YSXB 2E1BA 2WDRB 1TKYA 3BIID 3B2FA 3AE8B 1SF0A
chains in the Genus database with same CATH superfamily
4MELA 3RULA 2KJ6A 4P16A 4JL9A 4ICUA 4KV2A 4EEWA 3AE1B 4W9HA 3AEFB 1YIWA 2RDGA 2XK5A 3VUXA 1IBXB 1Y8RC 3QJZA 2LD9A 3RPFC 4RGNA 3ZYYX 3P4RB 4ANUA 1YN4A 5D7GA 2EKIA 4MM3B 4C80A 3MC9A 2MRPA 5H8YE 2MEKA 3PLUA 2WDQB 1I4HA 2JX5A 2QCZA 5EE1A 1OFFA 4MGYE 3TEWA 3TCAA 4AWJA 5HHDG 1IBXA 2I2YA 2L8JA 2BYFA 4W9IA 3PHWB 4N9F4 3MJWA 4FULA 4MGZE 2VH1A 4RM8A 4MM3A 3P4SB 1VZ6A 2GOWA 1WX7A 2BF8B 4B0EA 1YJIA 4N58A 3VUYA 1P3QU 1LQBA 2PMVA 2MX2A 2V3NA 4XE0A 2HJ8A 2D3BA 2J7QB 2LVQA 1UD7A 4GGQA 1WZ0A 3Q69A 2JRIB 4C56C 4TQ0A 5C23A 2L7RA 1OEYJ 4F7ZA 2VZKB 1FMAD 2WXPA 3SU8X 1PGBA 1WZCA 1R4MI 2INDC 3VVWB 1OEYA 4ANXA 2LZ6A 3DDCB 2J53A 1C3TA 3Q8AA 1VR9A 4L1BA 1ZGUB 2JQRB 1UH6A 1XLOA 4DBGA 4KGSA 1FFVA 1AW7A 2HJ1A 1T3QA 2K8HA 2ZPYA 3BIID 3BVZA 2DWQA 1GOZA 4MSQB 4WWOA 3IT4B 1H8CA 1JALA 4ITKA 2C9WB 1CK1A 3UINB 1FNUA 1WI0A 4A8XC 1WGDA 1F0ZA 5D6JB 3AE7B 3L0WB 4HWIB 1V97A 3U4EG 2ZW1A 3P1MA 3KUZA 1KH0A 3VQIA 3NY5A 3SHQA 1QQRA 2CU1A 3LDZE 2BPSA 4JQWC 1SJED 3AEBB 2K25A 4KDIC 1QILA 2MW5A 2Y5BB 1QLBB 5BYQA 2ZZEA 4RF1A 4WWPA 1HZ5A 2IJ0A 3NUHB 1BUIC 3VHTC 3RHUA 4CI2A 2LXAA 3SFDB 3QK0A 1J7BA 1YJ1A 3Q14C 4J3OD 1VLBA 2C5LC 3N1XC 1C77A 2BYEA 1N61A 1YD8U 3V3XA 3TIXA 2MLBA 3BK1A 2YEPB 3ZU6A 2KMCA 3ZJVA 5BMIA 3TL5A 3LYYA 4RFBA 5J17A 4P6VF 1R7SA 2IUSA 1D5ZC 4WURA 4LDTD 2JY6A 3GE3C 2HTME 3VUWA 3P2BA 1MG8A 4IWPA 3I7NA 2ZTGA 2DBYA 4PYUA 3KEWA 2KQ7A 3NRZA 1VZ8A 2KDEB 3ZUNA 1TIFA 3M63B 3ZXRA 2ZVNA 3PPAA 3AN1A 2WS3B 2E1BA 1SF0A 1I4XA 1L0YB 2V3PA 1EF1A 3GZNB 3C0RB 3CIRB 3ENEA 1I4PA 2AL3A 1IYFA 1K51A 2QILA 3BYTB 1Q1OA 3NVYA 4WWNA 5C3JB 5DPSA 2XNAC 2N0SB 3ZTCA 1TTNA 4LNKA 4AQ7A 4BKSD 3IVFA 2O6VB 2WXMA 4HDQA 3M95A 2LMCA 4HJGE 3VAWA 3VFKA 1FO4A 1HZ6A 3DBRB 3SFEB 1KLGD 4KGTA 3PGEA 4M8NA 1LO5D 1EUVB 2O6VA 2NBVB 3B2GA 2ZZPB 2HD5B 3KWLA 2MP2B 4XYCA 3X0WA 2WXFA 2I05A 4ICVA 2ZNVB 3DQVA 3OJ3A 1H4RA 2N9EB 5G55A 2WX0A 3PRMB 4KZCA 3A9KB 2JUOA 2KVRA 1KOTA 1AYFA 1XT9B 4HCNB 2MP2A 2RDHA 2WHIA 2NPTB 2DYMA 1L0VB 4USAA 3T3OA 2JYTA 2ICIA 1ET9A 4TMAB 5EE0A 4X57B 5HG2A 2KXJA 1FXAA 3A9KA 3NVWA 4B0MA 4FA6A 4YTMB 2K8BA 5DPTA 1E7VA 3B08A 2VH2A 3P63A 2I06A 1EWCA 5JH5C 2NPTA 2Q5WD 3EA6A 4BVUC 3RFNA 2RD0A 2HDEA 2D07B 2IUUA 4YSXB 5BMHA 1I42A 1TKYA 4EFOA 1YN5A 3ZWKA 4A0BA 2N9PC 4G50A 3Q3MC 1RFAA 2QEJC 4P1BC 3JVZX 3QWZB 4KVGB 5JHBA 1G6JA 3AEEB 3B9JA 2I38A 4FHKA 1CJEA 2KWDA 5DPWA 2C60A 3GZNI 2JXXA 4E54A 3L16A 4OVUA 1VDVA 3OJ4B 4W9KA 4AR8A 3E0CA 2D3CA 2C7HA 4RGOS 5CX3A 2BVCA 1ZOYB 3N1YC 4FXCA 1GB4A 5C2TB 1YX6B 2PE6B 3MP9A 4ARFA 1F2RI 2LI5A 2RR9A 4US8A 2R2OA 2D5GA 1HTOA 4OVVA 5J18A 4B9KA 4YSZB 1TBEA 5HFYA 3IHPC 3ZUPA 3A4RA 2DX5B 1TZOA 3DBRI 2EMSA 4O1NA 3R3MA 3HUIA 1IP9A 3AM9A 3U8ZA 2NTSA 4TV3A 3BINA 2WXLA 2GMIC 5D3DA 2LEKA 3RCZA 3AEDB 1PGXA 1WYGA 3CSTA 1RYJA 1YOVB 1VD2A 2N9LA 2WXIA 3I9V1 3DHIC 4W9JA 1ESFA 4M02A 2K9XA 3Q8FA 4Q2JA 3JSVB 4IOIE 1QOAA 3AEGB 1GG3A 1BMLC 2J0JA 1WX9A 4I6NB 4RGMA 1S1QB 3RNFC 1DYQA 3MTNB 3VH4B 2D11A 2BKRB 3ZDMC 1E8YA 5JXVA 4ZHPA 3Q2AC 5LNK1 1MVKA 5GXGB 3AB5A 1NENB 3JSVA 1J0GA 3ML8A 2BB6A 3A4SC 2NS5A 3ECIA 2K22A 2KHWB 2JWZA 2JYEA 5D3IB 3NS8A 3MC0B 2X38A 2V3SA 2K6DB 2LWPA 3Q8BA 4E71A 1I35A 3DHGC 3BVGA 3LXFA 4DHZE 1LXDA 4OZBA 1BXTA 4REZA 1QKZA 2EELA 1XCQL 1WXOA 2DENB 3A33B 3QARA 4FJZA 3AI5A 1IGCA 5IKCM 4NY0A 1QZEA 4HRSA 4MGIE 2GRIA 1TZ1A 2BWFA 2WXGA 4P1CC 2WXRA 3AECB 2KWUB 3DOWA 1WXMA 1JWBD 3QX1A 1L5PA 3AU4A 1ET6A 2OJRA 2MBEA 4XWWA 1SE2A 2JT4B 3BK2A 1N6ZA 1I7HA 3IAS1 4CO7A 4BFRA 1WF9A 4A11A 4BOZB 2REXA 3I5JC 1WJUA 5AUIA 2FCQA 2KWVB 1TYGB 4A6QA 3T3NA 3H9DA 1P0RA 3M62B 3RNCC 1V49A 1MJDA 2KD0A 2BBCA 2ZCCA 1JQ4A 3I3TB 2WLBA 3EFCA 3LJ3A 1EU3A 2JZZA 3DVGX 5FK9C 2V1YA 3VR8B 1IUEA 1NVID 3ZDTA 4ZYSA 5CHVC 4W9GA 1AN8A 4DHJD 2FBWB 1ACCA 3NVZA 3PT2B 4A0AA 4WH4A 3MJ5A 4FLHA 3IG3A 1E8XA 2PW9A 3AH7A 2V0GA 4MH8A 4FBJB 2D3AA 2JZ3B 3Q8EA 2ACZB 3AE4B 4NAMA 4GXBA 1E7UA 2BTEA 5AZHA 2PVOD 3WANA 2E3TA 4L23A 4R3DA 1GJZA 1FM0D 2M1MA 3EHVA 2K3UA 1GNUA 3CWIA 3DCGA 2IO1B 2WX1A 5AZFA 1XXGA 2M56B 3T8MA 2Z59B 4NPNA 3TSSA 4AUQC 2K8CA 4P7IA 3Q3NC 2CU3A 4LNIA 3GP7A 3ZX4A 1XQQA 2FUHB 1WXAA 3Q6BA 1JWSD 4CI3A 4ARCA 4XDDA 1A5RA 2LUMA 3CMMB 4IDIA 4HPPA 1ROEA 4GDLB 1OQRA 3HHMA 2J0MA 2INPE 2CJNA 4YSYB 3FAHA 4XX5A 2KKCA 2JU6X 5DPRA 4ZRKA 2ZW0A 3X23A 1PYWD 4WJOA 4GDLA 3Q3JA 4GU2A 3BYYB 1YNTE 2GBNA 1WNUA 4K3BA 4A08A 2W55A 1ZXIA 4HXDA 5FKAC 1WWTA 2IBIB 2QMTA 1V80A 1MPEA 2DZKA 5LLIA 5FR3A 2Y50A 1TKEA 2BB5A 4RF0A 3R7RA 2JF5A 1V4PA 4XR2A 2EMTA 3ZNGC 2JZPA 3N20C 4YTNB 3VTUA 2WP9B 1TJEA 2UWQA 3AEAB 3EGRA 4FN2A 3KQ4A 1UGMA 1TY0A 1I4QA 3IXSA 1MG4A 1WM2A 3TBLD 2IGDA 1SIFA 4OZCA 4K7UA 2MQJA 4WJPA 2J0KA 3ABVB 1LM8B 2N9KA 4WIPA 2VRRB 3ZWDA 1OQQA 2LGXA 2KX3A 1SSNA 4JE3B 2L83A 3KYCD 2FUG1 2M0AA 4M01A 2LUEA 2BS3B 3RI7C 2Z8LA 1WGHA 4D2KA 4M0WB 1HQRD 5D2MB 2MH7A 1ZP0B 3BY4B 2LVOA 5IOIA 1CQVA 2Y3UA 2ON8A 3RUIB 3ZJTA 1OQYA 1C4CA 1QOBA 1YQBA 1ZUD2 2AL6A 1L7YA 3ZW7A 1UZXB 2C7NB 4M0WA 1E8ZA 4E74A 3RZFA 2AQ1B 2HTHA 2PIAA 1I4GA 4HJKA 5IN7A 2GLSA 1FXTB 2MHJA 4N6EB 3IBEA 3H6NA 1C4AA 1EM7A 4CI1A 3AE2B 3SEBA 2ASQA 3U30A 2K39A 3QQ8B 4E3CA 4ARIA 3RD2A 3PREA 3ZJUA 5T8IA 4L2YA 2IYDB 1WJ4A 1V81A 4MT5A 4ANWA 1DOXA 2ZVOA 2QHOA 4HCPB 2AX5A 1N5WA 3ZGZA 4HDOA 1QOFA 4ZYNA 4WAAA 2KC2A 4G0NB 1MHHE 2BS2B 1ISNA 3N3KB 2MBQA 1V6EA 1ECRA 4WWMA 1J8CA 4TZ4A 2WXHA 1E7PB 2NVUI 4WAFA 2EKEC 4GIVA 4NZLB 5AEKB 3B1LX 1XO3A 3IAM1 4KZ0A 3AE3B 4AREA 4F1SA 3A1QB 2IY0B 3P42A 3Q3FA 2KT7A 3RMKC 4DDID 2BQQA 1YQ4B 2JSVX 3NHEB 3VTVA 3DPDA 3NJTA 3RZWC 2AYOB 1ZE3D 1QT9A 5GMVA 2I1JA 3AMZA 2HYEA 4PS7A 2QIEB 3RNEC 2KDMA 3A1QA 2A4ZA 3EFUA 2FNJB 2INCC 5KHQA 4GSWA 2W9NA 1K52A 2PEAA 1F2RC 2WU2B 1HXYD 1K53A 3ML9A 3PVLA 4TUUA 1N60A 2BWES 1SE4A 3MFGA 4DHJB 2BKFA 2KQ4X 2WYQA 2FCSA 2KNBA 1WXSA 2BGFA 4B6WA 2R2QA 3VRAB 4TSSA 1FRRA 1ZXHA 1A70A 1J7AA 3I8EA 2DAJA 2KQSA 4HK2A 1HA5A 1SEBD 3EUB2 2L0FA 1X1MA 1JWUD 3APFA 2Y3AA 3KWVA 3B2FA 1D5XC 2W3RA 2WQYB 2ZNVC 3O65B 4OZAA 4LJPB 2CJOA 2RMMA 5E6JA 1XD3B 2GBJA 2KK8A 2RPQA 3L54A 2YEPF 2KX0A 2PJHA 4XC2A 1C4PA 1EWYC 4GN1A 5CTRC 1D6EC 3K9PB 2L0TA 4IG7B 1FIQA 2QDFA 4KX6B 2IY1B 4G11A 2K0PA 4W9CA 1SGHA 3PZ7A 3J9CA 1FPYA 4RH6A 3VDZA 2CHZA 4KKIA 1GC6A 1TT5B 2IO0B 2V4LA 3IT6B 2KOXA 2LRUA 2WDVB 5BMGA 3ZVVA 4JLCA 1NYRA 3HVDA 1E9MA 1WJ6A 2J42A 3DBLB 2OOBB 2KVZA 5DCNA 3WAMA 2Z0DB 2KFKB 3PRZA 3DVNV 1STEA 1I4RA 3NG0A 3APDA 2KMMA 2CKHB 1SB3C 5BYSA 2H89B 1NI2A 4N59A 4ZDVA 4NQKE 1VZ7A 2G9HD 2KDBA 2ZPNA 3R8BA 1P98A 4W9EA 2E6XA 1SE9A 1QOGA 3CF6E 3AV8A 2J52A 2OJWA 1WRDB 2KFKA 1Q5WB 2L3ZA 1T0RC 1TKGA 4HEA1 1IPGA 4AP4C 2L00B 3OWEB 1JMLA 1WE6A 1NI3A 1E5WA 5TR5A 1U4AA 4F8CB 1UGJA 1N5XA 1V2YA 3FILB 4EZJA 1C9FA 1WGYA 2YLMA 2KO3A 1T0QC 4ASWC 4K7WA 3U7DA 4EE2A 4II2B 2M4NA 3WA0A 4CQNA 1JWMD 3VR9B 4DXAB 3FILA 3W1YA 1Z2MA 4DXFA 4C7ZA 3WCQA 2G1EA 4XGAB 2LGYA 2NTTA 4LTUA 2J4XA 1V86A 2AWTA 3EECA 2IUTA 2PKOA 1WGKA 2FCMA 4MGKE 4DK5A 1WX8A 4WJNA 1RAXA 3ONSA 3I7KA 2LASA 4KKJA 1JROA 4KDLB 5D94A 4RGTA 1L6VA 1GPXA 3W1SA 2KTRA 2DAFA 4CYEA 3L4PA 2RDBC 2IDYA 2WU5B 3HRDD 4RCOA 4JWSC 4GOCA 4UDUC 2KACA 1FD6A 4K1RB 3KW5B 3A9JB 3ZRFA 4AJYB 1C1YB 3I7LA 2N4FA 3BVMA 1MHXA 2W54A 4IWOA 3R66C 4JPSA 4IM2A 4BOSC 4AS1A 2AEHA 4A90A 3AU5A 3DBLI 4IUMB 4S17A 5HKHA 5I4DA 1TS4A 2WXQA 1N62A 1V1PB 3A9JA 4DQOC 4ZRQA 1TGZB 2DLBA 2RPVA 1UBIA 3NZSA 3O13A 3RT3B 1B9RA 3HM3A 3PZ8A 1GC7A 4FHJA 1RRBA 3U2SC 1KLUD 2B5LA 3PZDA 1UF0A 4PS8A 2D2QA 3V05A 1L2NA 4M8MA 2OEDA 4AR1A 4FADA 4QAYA 1L6UA 1V1PA 3UIOB 3NS1A 5IP4D 5MPOA 3OLMD 2K5PA 4RMAA 3Q3OC 3ZXVA 1V5TA 1WY8A 1FCCC 2N7DA 3NZUA 3MC8A 1HTQA 1WR6E 2ONQA 1YN3A 4BKGA 2N7JA 1LFDA 1L4ZB 1L4DB 2LGSA 1K50A 3P4PB 3S2AA 1XLQA 2YVCA 4FJVB 1ENFA 1YJJA 4S0RA 2MBHA 1V1OA 1MI0A 1EO6A 4JX1C 5G5GA 3H8HA 2JVCA 2M8SA 4URKA 1L0XB 1WFYA 4IKGA 3KH0A 2PTLA 2PLPA 3U52E 1DOYA 1FCLA 3DVGY 3UF8A 4JWUC 3NVVA 3ZTYA 1T0SC 1GAQB 1TS3A 4DDGD 3KVFB 2TSSA 5JHAA 2KLCA 3H1UA 4ZRIA 3C19A 4I6PA 4MDKE 3U7ZA 3PTFC 1ZKHA 3QC8B 1WE7A 1KJTA 1SJHD 4PT5A 2FAZA 3EI2A 2L76A 3QHTA 1D5MC 1F9JA 2LHEA 2LGIA 1P9DU 4XR1A 2DZMA 2LVPA 1M4VA 4FJYA 2CS4A 1AARA 2FIFA 4BZAA 4WQOB 1T0YA 3ZX5A 4LNFA 2NMQA 4K7SA 2KN4A 2WWZA 2IZVB 3RFZB 2L05A 1IGDA 5CHFA 3ZRCA 4OVZA 3RN9C 2DYBA 3ZNZB 1V9JA 1FNVA 2MSED 3T9LA 4LJOB 2LJ5A 1RM6C 3H7SA 4LCDE 1B1ZA 2IGGA 5IAAC 1PFDA 4II3B 2G45B 3P4QB 5BYRA 2G3QB 1HE8A 3N32A 4MH0E 3HM6X 3L10B 4M00A 3KLSX 2M17A 2KC1A 2N9XA 3PS6A 2KLGA 3VTWA 5IO9A 4CHKA 4ZRPA 2JRHA 2LHDA 2BW2A 1BT0A 2B5MA 4HKQA 1D3ZA 2X8XX 3H7PB 2NCNA 1WYWB 2INNE 4YTPB 3HIZA 4E5ZA 1NDDA 5J2RA 2KTFA 1KLVA 5E6NA 2D10A 3AULA 1NBFC 1V8CA 3KUDB 3H7PA 1NYQA 1E10A 4PK1A 1KRHA 3DBHB 2WXJA 1Q0WB 3BWUD 1JWAD 5AUKA 1SE3A 3FKYA 3W5VB 4A9AA 2UYZB 3HVZA 1TY2A 2Y6IA 1CMXB 2RSUA 4XDCA 2MCNB 2Z0EB 2LGDA 3OAWA 1FFUA 1MFWA 3I63C 3QIJA 1OTRB 3ZQ4A 3ZKJC 3MHSD 1GUAB 1RLFA 3FC4A 3ZTDA 1D4BA 2UU7A 3R2TA 5LXHA 4AJWA 2G4DB 3V6EB 4JGHB 2GI9A 2XEWA 4BBNC 1XLPA 3KUCB 1R4NB 4GB9A 2GB1A 2CR5A 2OHFA 2N7EA 2LXCA 1WZ3A 4C7YA 3UQAA 2B3AA 2MBBB 1YMHE 1ZDXA 2KMAA 2DYOA 4OHJA 3R2IA 2G4SA 4ZRJA 1E90A 5EE9A 5EDSA 2FCNA 3ZLZA 1F1HA 2H88B 1F52A 3RYTA 1WXVA 4RM9A 4ACFA 2O2VB 2ZOSA 3D32A 5AZGA 3URYA 3V60A 4GMVA 4YXDB 2V9HA 2BYVE 3WALA 3V6CB 2D3GA 3WIMA 2IO2B 2M19A 2PE9A 4TKNA 3EI3A 4NJ6A 3VXWA 1P1AA 3Q8CA 2O2VA 2MWSB 5E6PA 3UI3A 4US9A 3PRPB 5LXIB 1WSPA 4PS3A 3QCAA 2K1FA 4NNJB 4OW0A 3DBSA 3DWMA 1T5XD 1LGRA 5KHOA 1E0ZA 2GBMA 3ZNHB 3DVNU 1DOIA 3K9OB 1XCTL 2BYTA 2WDTB 1PUTA 3V61A 3GE8C 1DGJA 2GBKA 4NQLB 4XR0A 3N9YC 3QA8A 4B95A 1KFYB 3TEXA 4ANVA 3DBHI 5IA7A 2BT6A 2KDIA 3I57A 3N30A 4HROA 2AQ2B 2PVGC 1GB1A 3W9CB 4AR9A 3GB1A 1VCBA 3R7QA 1UNSA 4BBNF 4HVBA 4YWGG 1Y56A 2R61A 2IPKD 2DHZA 4ZHOA 2C7MB 1WGGA 1UUPA 2WXNA 4NJCA 3RNBC 4KSKC 2N1VA 3EC8A 2MA9B 3PLVA 3M3JA 4WQMA 4MSMB 4IC7B 3SD5A 4KSLC 1KM7A 2PPHA 3AE6B 3I7HA 5G5HA 3NZ3A 4NJ7A 1OGWA 4A55A 1R4NI 1WXQA 3AE5B 2W82A 2MJEA 1WR1A 2WNMA 3TEZA 2XN9C 3W5UB 2DNFA 4LNNA 1JCKB 1S3SG 1WIAA 2L52A 4IW0A 2ZZGA 2DZIA 2SAKA 2Y5PA 2CHXA 3PSEB 2ZZFA 2DZJA 5FQDA 1VJKA 2KANA 3TJPA 4PYZA 5E6OA 2KDFB 4W9LA 1K8RB 4HLEA 1QF6A 3UQBA 3N1ZC 1NEKB 2K6QA 1RWSA 2RGFA 2LFIA 4EZKA 3GOEA 4BAXA 1JRUA 1WJNA 3QAQA 5C1ZA 1SXTA 3I7PA 1JRPA 1XEEA 1UBQA 2VZKD 2ZCBA 1E8WA 4HPLB 3ZO5B 3L08A 3KYDD 1RFKA 1PDXA 3NOBA 4LLGM 1UWXA 2CHWA 3JW0X 1XVIA 1JW9D 5EE3A 2M0XA 1CZPA 3BZDB 2KFJA 5HI1A 1ZDVA 1KTKA 5JZEB 3OG5A 1WH3A 2KZRA 4EZLA 1C79A 1TS2A 2NBUA 2BS4B 4XWTA 3APCA 4DHZB 3ZW3A 3PV1A 1N63A 2A5UA 3C8YA 5TSSA 2N1WA 3CSFA 2Y5CA 1UWMA 3ALBA 2I1KA 3DWGC 4YT0B 4AOFA 1FEHA 2LRWA 3SR6A 1J7CA 3LB8C 2KTRB 1FXIA 1F77A 5G2NA 3AE9B 3ZIMA 3I89A 3I8CA 1Q10A 2QJLA 5FR6A 4BKTA 5BO4B 3ETRA 2SEBD 2FE8A 3L17A 1WMHB 1YQ3B 3EI4A 2AQ3B 4TQ1A 3UGBB 1FNWA 2QSDA 1HEZE 4HPMB 2JPHA 2WXOA 3W2DA 4ZOHC 3W1SC 2NBWB 1XF5L 3RNGC 1WRIA 4WJQA 1T6BX 1WMHA 4HKZE 3PO0A 4A3OA 4IM3A 2MBOA 2EWJA 3TUOA 2KJRA 1E6EB 4JIOU 1ZW7A 1AWDA 2ZEQA 4KGRA 4KIKB 1SBBB 3WAPA 1V5OA 3WAOA 3I7OA 3L13A 1XLNA 1EU4A 2KJHB 2WDRB 4DXGA 3AE8B 4MJSB 4K3CA 4A09A 4RNAA 2MJDA 4GDKB 4W9FA 1M94A 4KIKA 5H92C 1C78A 2WGSA 4MACA 4NAWB 2KN5A 2JXTA 1WM3A 4IM0A 3PHXB 3WQZA 4LDTB 4A3PA 3EI1A 3VH3B 4EOYA 3MHZA 1EF5A 3VRBB 4MJSA 4XR3A 4IWQA 2MJ3A 3RNAC 1VRAB 3ZNID 1C76A 5L95C 1PQSA 1TS5A 4GDKA 4K81A 4NAWA 1J19A 2LJIA 1FRDA 2IO3B 4G3XB 2QC8A 4C4VB 1ZPSA 3E56A 1YX5B 3E9SA 2O6VD 4LNOA 3B0AA 4H2AA 3SDLC 1R4MB 2JWUA 2KAJA 2KYWA 2HE7A 2B76B 2WXKA 3V62A 2FIDA 2L32A 1WGRA 4J6IA 3DHHC 3IFWB 4W9DA 3UIPB 2V4IB 4LK0M 1UELA 2XBBC 3JYUA 4C00A 4C4VA 1SIJA 1KF6B 3TMPB 3ZTWA 3TEYA 4EUTA 1P7FA 4GLSC 1Z5SB 2GBRA 2L1AA 4MEMA 2ZJDA 4BKSA 4DWFA 4EKUA 4A20A 3HK0A 2W3SA 3GS2A 2IGHA 4I6LB 2XK5B 1PGAA 3AXCA 1V7OA 2NR2A 2KWCA 5CHWA 1P7EA 4XZ4A 5L83A 4YL8A
chains in the Genus database with same CATH topology
1D5XC 1FFUA 2W3RA 2WQYB 4P16A 5JXVA 4ZHPA 4OZAA 3ZQ4A 2CJOA 5LNK1 1MVKA 5GXGB 3AB5A 1NENB 2RMMA 5E6JA 3AE1B 2BB6A 2YEPF 3AEFB 3FC4A 2RDGA 1D4BA 1C4PA 1EWYC 2K22A 1IBXB 1D6EC 3R2TA 2JYEA 5D3IB 3RPFC 4RGNA 3ZYYX 3P4RB 1YN4A 1FIQA 2X38A 2EKIA 3MC0B 4KX6B 4MM3B 5D7GA 4C80A 2K0PA 5H8YE 3PZ7A 2MEKA 2GI9A 3J9CA 3Q8BA 2WDQB 4RH6A 1I4HA 1XLPA 2JX5A 2GB1A 2OHFA 3BVGA 4KKIA 3LXFA 1OFFA 5EE1A 3TEWA 3IT6B 4OZBA 4C7YA 1BXTA 4REZA 1QKZA 2WDVB 2EELA 5BMGA 1XCQL 5HHDG 1WXOA 1YMHE 1ZDXA 2I2YA 1IBXA 1NYRA 2DYOA 4OHJA 3R2IA 3HVDA 1E9MA 2J42A 1IGCA 5EE9A 3P4SB 2H88B 1VZ6A 1STEA 4B0EA 1I4RA 4HRSA 3URYA 1YJIA 2KMMA 4YXDB 1SB3C 2GRIA 4N58A 5BYSA 2H89B 2WXGA 4N59A 2PMVA 1VZ7A 2G9HD 2V3NA 2WXRA 3AECB 3R8BA 4XE0A 2M19A 2E6XA 1JWBD 1QOGA 3AV8A 2J52A 3EI3A 1L5PA 1ET6A 3Q69A 4C56C 4TQ0A 4XWWA 1SE2A 3Q8CA 2VZKB 1TKGA 1FMAD 3BK2A 4HEA1 1I7HA 2WXPA 3IAS1 3OWEB 3UI3A 1PGBA 4A11A 4US9A 1WSPA 1JMLA 1NI3A 5AUIA 2J53A 4OW0A 3Q8AA 3DWMA 1N5XA 1TYGB 1UGJA 1VR9A 4A6QA 3T3NA 1T5XD 3FILB 4L1BA 1C9FA 2JQRB 1E0ZA 1DOIA 1XLOA 2BBCA 1XCTL 4KGSA 2BYTA 4EE2A 1JQ4A 1FFVA 1PUTA 1AW7A 1T3QA 1DGJA 2WLBA 1EU3A 3BIID 5FK9C 4XR0A 3N9YC 4CQNA 3VR8B 1IUEA 1JWMD 1KFYB 1NVID 3BVZA 3TEXA 4ZYSA 3VR9B 1AN8A 2DWQA 2BT6A 3FILA 1GOZA 2FBWB 4DXFA 3I57A 1ACCA 3IT4B 4C7ZA 3NVZA 3WCQA 2G1EA 1JALA 4A0AA 2NTTA 3MJ5A 4ITKA 4HROA 4LTUA 4WH4A 2J4XA 1CK1A 2PW9A 2AQ2B 3AH7A 1FNUA 2V0GA 2PVGC 4MH8A 1GB1A 2IUTA 3W9CB 2PKOA 4A8XC 1F0ZA 1WGKA 4AR9A 3GB1A 3AE7B 1V97A 3U4EG 1UNSA 2ZW1A 3Q8EA 2ACZB 3AE4B 4NAMA 3P1MA 4YWGG 1Y56A 2R61A 2IPKD 2BTEA 1KH0A 4ZHOA 3VQIA 2PVOD 2E3TA 4L23A 3I7KA 4R3DA 1QQRA 1FM0D 1UUPA 2K3UA 2WXNA 4KKJA 1JROA 4NJCA 1SJED 3CWIA 3AEBB 4RGTA 1L6VA 1GPXA 1QILA 4WQMA 3W1SA 1QLBB 5BYQA 2ZZEA 3L4PA 4RF1A 3AE6B 1XXGA 2IDYA 1HZ5A 2IJ0A 3I7HA 2M56B 1BUIC 3NUHB 5G5HA 2WU5B 3TSSA 3NZ3A 3HRDD 4RCOA 3RHUA 4JWSC 4CI2A 3SFDB 2CU3A 4UDUC 4A55A 1J7BA 2KACA 1FD6A 3GP7A 4J3OD 1VLBA 1JWSD 1WXQA 1C77A 3AE5B 2W82A 4CI3A 2MJEA 4ARCA 2WNMA 4XDDA 3I7LA 1N61A 3BVMA 1MHXA 2LUMA 3V3XA 3TEZA 2XN9C 3W5UB 2W54A 4IDIA 4JPSA 1ROEA 1JCKB 4GDLB 4AS1A 1OQRA 2L52A 3BK1A 2ZZGA 2YEPB 2INPE 4A90A 2CJNA 4YSYB 3FAHA 3ZJVA 5BMIA 2SAKA 2Y5PA 5I4DA 1TS4A 2WXQA 3LYYA 1N62A 2ZZFA 1V1PB 4RFBA 5FQDA 4DQOC 4ZRQA 2DLBA 4P6VF 1R7SA 1VJKA 2JU6X 2RPVA 1D5ZC 2IUSA 4WURA 2ZW0A 3O13A 1PYWD 1B9RA 2HTME 3PZ8A 3U2SC 1KLUD 2B5LA 3BYYB 1YNTE 1QF6A 3I7NA 3V05A 2ZTGA 2DBYA 3KEWA 1NEKB 1WNUA 4A08A 2OEDA 1RWSA 2W55A 3NRZA 4AR1A 1ZXIA 2LFIA 1VZ8A 5FKAC 1WWTA 2QMTA 1L6UA 1V1PA 1MPEA 1SXTA 3NS1A 3I7PA 1JRPA 1XEEA 3AN1A 2WS3B 2VZKD 2E1BA 5FR3A 1SF0A 1I4XA 1L0YB 2V3PA 2Y50A 1TKEA 2BB5A 4RF0A 1RFKA 3CIRB 5MPOA 1I4PA 1PDXA 2K5PA 1V4PA 4XR2A 4LLGM 1UWXA 1K51A 2QILA 3BYTB 3NVYA 2JZPA 5C3JB 1FCCC 4YTNB 1JW9D 5EE3A 2WP9B 2XNAC 2N0SB 1TJEA 3AEAB 1CZPA 3BZDB 3EGRA 3KQ4A 4AQ7A 1TY0A 2ONQA 1ZDVA 5HI1A 1YN3A 1I4QA 1KTKA 3IXSA 2WXMA 2N7JA 2IGDA 4OZCA 1C79A 2LMCA 1L4ZB 1L4DB 1TS2A 4HJGE 2BS4B 4XWTA 1K50A 3ABVB 3P4PB 2N9KA 1FO4A 1XLQA 1N63A 4WIPA 3C8YA 1OQQA 1HZ6A 1ENFA 5TSSA 2Y5CA 1SSNA 1UWMA 4JE3B 3SFEB 1YJJA 1KLGD 3DWGC 2L83A 4KGTA 4YT0B 1FEHA 1V1OA 1MI0A 2FUG1 1LO5D 3SR6A 1J7CA 2M0AA 3LB8C 4JX1C 3B2GA 5G5GA 1FXIA 1F77A 3H8HA 3AE9B 2BS3B 2Z8LA 3I89A 3KWLA 1L0XB 3I8CA 4IKGA 2WXFA 4D2KA 2I05A 1Q10A 1HQRD 2QJLA 2PTLA 2PLPA 3U52E 1DOYA 3ETRA 1FCLA 2SEBD 4JWUC 2MH7A 1ZP0B 2FE8A 3NVVA 1YQ3B 3EI4A 1CQVA 1GAQB 2AQ3B 4TQ1A 1TS3A 2Y3UA 2TSSA 2ON8A 1FNWA 2QSDA 3ZJTA 1HEZE 1AYFA 2WXOA 1C4CA 3U7ZA 1QOBA 3W2DA 1ZUD2 2RDHA 4ZOHC 4M0WA 1XF5L 2DYMA 1SJHD 4PT5A 1L0VB 1WRIA 2AQ1B 2PIAA 1I4GA 4USAA 3T3OA 3EI2A 1T6BX 2JYTA 1D5MC 2ICIA 1ET9A 4TMAB 5EE0A 2LHEA 4HKZE 3PO0A 4N6EB 2LGIA 5HG2A 4XR1A 4B0MA 1FXAA 3NVWA 4YTMB 2EWJA 3TUOA 1M4VA 1C4AA 1E6EB 1EM7A 4CI1A 3AE2B 3SEBA 3P63A 1AWDA 2I06A 1EWCA 4KGRA 2Q5WD 3EA6A 4ARIA 1SBBB 3RFNA 2HDEA 3ZJUA 5T8IA 3I7OA 4L2YA 1XLNA 2NMQA 1EU4A 2KN4A 2IUUA 4YSXB 5BMHA 2WDRB 1TKYA 4DXGA 3RFZB 1YN5A 3AE8B 4A0BA 1IGDA 4MT5A 4OVZA 1DOXA 2QEJC 4A09A 3AEEB 3B9JA 4RNAA 2MJDA 1FNVA 2AX5A 4GDKB 1N5WA 3ZGZA 5H92C 1C78A 1RM6C 1QOFA 2I38A 4MACA 4NAWB 1CJEA 1B1ZA 2IGGA 2KWDA 2JXTA 1MHHE 1PFDA 3WQZA 2BS2B 3P4QB 3EI1A 3MHZA 3VRBB 5BYRA 4XR3A 4E54A 1VDVA 1ECRA 4AR8A 4WWMA 4TZ4A 2WXHA 2MJ3A 1E7PB 4WAFA 3E0CA 1VRAB 1C76A 4NZLB 1TS5A 4RGOS 1ZOYB 4FXCA 1XO3A 3IAM1 1GB4A 5C2TB 3AE3B 4AREA 3MP9A 4ARFA 1F2RI 4US8A 3P42A 2LJIA 3KLSX 2D5GA 1FRDA 1YQ4B 2JSVX 1ZPSA 3E56A 1ZE3D 3E9SA 1QT9A 4YSZB 4H2AA 3AMZA 4ZRPA 5HFYA 2JWUA 2LHDA 2BW2A 2HYEA 2KAJA 1TZOA 2B76B 2QIEB 2B5MA 4HKQA 2KDMA 2WXKA 4O1NA 3HUIA 3AM9A 2L32A 2INNE 2NTSA 4YTPB 2V4IB 4LK0M 4E5ZA 2WXLA 1SIJA 5D3DA 2LEKA 3AEDB 1K52A 1PGXA 1WYGA 1F2RC 2WU2B 1HXYD 1K53A 1RYJA 1KF6B 3TEYA 1N60A 3MFGA 1SE4A 2N9LA 1P7FA 1V8CA 2KQ4X 2WXIA 4GLSC 3I9V1 1NYQA 2L1AA 1E10A 1KRHA 1ESFA 2WXJA 3VRAB 3BWUD 1JWAD 4TSSA 5AUKA 1SE3A 1FRRA 1ZXHA 2K9XA 1A70A 1J7AA 3Q8FA 4Q2JA 4IOIE 3W5VB 4A9AA 3I8EA 2W3SA 1HA5A 3GS2A 2IGHA 1QOAA 1SEBD 3AEGB 3HVZA 3EUB2 1TY2A 1BMLC 1PGAA 2Y6IA 4XDCA 1V7OA 4RGMA 1JWUD 1P7EA 1DYQA 2Y3AA 3KWVA 3B2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VR8 B;  1FFU A;  1TKE A;  1IUE A;  1KFY B;  1NVI D;  2W3R A;  2WQY B;  1RFK A;  3CIR B;  1DOX A;  3VR9 B;  5MPO A;  2DWQ A;  1PDX A;  2K5P A;  2BT6 A;  1V4P A;  4ZHP A;  2CJO A;  2FBW B;  5GXG B;  4C7Z A;  3AB5 A;  1NEN B;  3NVZ A;  3AE1 B;  2G1E A;  3NVY A;  3WCQ A;  3AEE B;  5C3J B;  3B9J A;  3FC4 A;  3AEF B;  1JAL A;  2MJD A;  4ITK A;  4YTN B;  1JW9 D;  4HRO A;  2AX5 A;  2WP9 B;  1N5W A;  2N0S B;  4LTU A;  1TJE A;  3AH7 A;  5EE3 A;  1EWY C;  2PVG C;  3AEA B;  1CZP A;  2K22 A;  5H92 C;  3W9C B;  1RM6 C;  1QOF A;  2PKO A;  1F0Z A;  1WGK A;  3KEW A;  1CJE A;  3AE7 B;  3RPF C;  3ZYY X;  1V97 A;  3P4R B;  1FIQ A;  1PFD A;  2BS2 B;  2EKI A;  2ACZ B;  3AE4 B;  4KX6 B;  3P1M A;  4C80 A;  3WQZ A;  3P4Q B;  5H8Y E;  3VRB B;  4ZHO A;  2PVO D;  2BS4 B;  2E3T A;  1VDV A;  2WDQ B;  1FM0 D;  1XLP A;  3ABV B;  3P4P B;  2JX5 A;  4WWM A;  2OHF A;  1FO4 A;  2MJ3 A;  1E7P B;  1JRO A;  1OFF A;  1XLQ A;  3LXF A;  3CWI A;  5EE1 A;  3AEB B;  4C7Y A;  1N63 A;  2ZTG A;  2WDV B;  1L6V A;  1OQQ A;  1ZOY B;  4FXC A;  1GPX A;  4WQM A;  1WXO A;  1XO3 A;  2Y5C A;  1UWM A;  1QLB B;  3SFE B;  1YJJ A;  3DWG C;  1NYR A;  2L83 A;  3AE3 B;  4YT0 B;  3L4P A;  5C2T B;  2ZZE A;  1E9M A;  4US8 A;  3AE6 B;  3SR6 A;  5EE9 A;  2M56 B;  1J7C A;  3LB8 C;  4JX1 C;  3P4S B;  3B2G A;  5G5H A;  2WU5 B;  1FXI A;  5G5G A;  2H88 B;  1FRD A;  3AE9 B;  1YQ4 B;  2BS3 B;  3HRD D;  3RHU A;  4JWS C;  3KWL A;  3SFD B;  2CU3 A;  4HRS A;  1J7B A;  1QT9 A;  1WNU A;  2QJL A;  1YJI A;  4YSZ B;  1VLB A;  2KMM A;  3ETR A;  4YXD B;  1WXQ A;  3AMZ A;  1SB3 C;  3AE5 B;  4N58 A;  4JWU C;  1DOY A;  2MH7 A;  1ZP0 B;  3NVV A;  2MJE A;  2H89 B;  4N59 A;  2KAJ A;  1N61 A;  1YQ3 B;  3W5U B;  2W54 A;  2B76 B;  3AEC B;  4IDI A;  2QIE B;  1GAQ B;  1ROE A;  1OQR A;  2L52 A;  2M19 A;  3HUI A;  2ZZG A;  3AM9 A;  1JWB D;  1QOG A;  3AV8 A;  1L5P A;  2CJN A;  4YSY B;  3FAH A;  1AYF A;  4YTP B;  1QOB A;  1ZUD 2;  4ZOH C;  1SIJ A;  2LEK A;  1TKG A;  3AED B;  2ZZF A;  1FMA D;  1N62 A;  1WYG A;  1I7H A;  2WU2 B;  1L0V B;  1WRI A;  1E0Z A;  2PIA A;  1RYJ A;  1KF6 B;  4P6V F;  1R7S A;  1VJK A;  4USA A;  4US9 A;  5EE0 A;  1N60 A;  1V8C A;  1NI3 A;  5AUI A;  3PO0 A;  4N6E B;  1B9R A;  2HTM E;  1FXA A;  3NVW A;  1NYQ A;  1E10 A;  4YTM B;  1KRH A;  3DWM A;  1N5X A;  1TYG B;  3VRA B;  1QF6 A;  1E6E B;  1JWA D;  5AUK A;  3AE2 B;  1FRR A;  2DBY A;  2JQR B;  1A70 A;  1J7A A;  1NEK B;  1AWD A;  2K9X A;  2W55 A;  1RWS A;  3NRZ A;  3P63 A;  3W5V B;  1ZXI A;  1DOI A;  4A9A A;  1XLO A;  2W3S A;  1WWT A;  2Q5W D;  1QOA A;  3AEG B;  3HVZ A;  1L6U A;  3EUB 2;  1JQ4 A;  3RFN A;  1FFV A;  1PUT A;  3NS1 A;  1T3Q A;  1DGJ A;  2WLB A;  1V7O A;  1JRP A;  1XLN A;  3AN1 A;  2WS3 B;  4YSX B;  2E1B A;  2WDR B;  1TKY A;  3BII D;  3B2F A;  3AE8 B;  1SF0 A; 
#chains in the Genus database with same CATH topology
 4MEL A;  3RUL A;  2KJ6 A;  4P16 A;  4JL9 A;  4ICU A;  4KV2 A;  4EEW A;  3AE1 B;  4W9H A;  3AEF B;  1YIW A;  2RDG A;  2XK5 A;  3VUX A;  1IBX B;  1Y8R C;  3QJZ A;  2LD9 A;  3RPF C;  4RGN A;  3ZYY X;  3P4R B;  4ANU A;  1YN4 A;  5D7G A;  2EKI A;  4MM3 B;  4C80 A;  3MC9 A;  2MRP A;  5H8Y E;  2MEK A;  3PLU A;  2WDQ B;  1I4H A;  2JX5 A;  2QCZ A;  5EE1 A;  1OFF A;  4MGY E;  3TEW A;  3TCA A;  4AWJ A;  5HHD G;  1IBX A;  2I2Y A;  2L8J A;  2BYF A;  4W9I A;  3PHW B;  4N9F 4;  3MJW A;  4FUL A;  4MGZ E;  2VH1 A;  4RM8 A;  4MM3 A;  3P4S B;  1VZ6 A;  2GOW A;  1WX7 A;  2BF8 B;  4B0E A;  1YJI A;  4N58 A;  3VUY A;  1P3Q U;  1LQB A;  2PMV A;  2MX2 A;  2V3N A;  4XE0 A;  2HJ8 A;  2D3B A;  2J7Q B;  2LVQ A;  1UD7 A;  4GGQ A;  1WZ0 A;  3Q69 A;  2JRI B;  4C56 C;  4TQ0 A;  5C23 A;  2L7R A;  1OEY J;  4F7Z A;  2VZK B;  1FMA D;  2WXP A;  3SU8 X;  1PGB A;  1WZC A;  1R4M I;  2IND C;  3VVW B;  1OEY A;  4ANX A;  2LZ6 A;  3DDC B;  2J53 A;  1C3T A;  3Q8A A;  1VR9 A;  4L1B A;  1ZGU B;  2JQR B;  1UH6 A;  1XLO A;  4DBG A;  4KGS A;  1FFV A;  1AW7 A;  2HJ1 A;  1T3Q A;  2K8H A;  2ZPY A;  3BII D;  3BVZ A;  2DWQ A;  1GOZ A;  4MSQ B;  4WWO A;  3IT4 B;  1H8C A;  1JAL A;  4ITK A;  2C9W B;  1CK1 A;  3UIN B;  1FNU A;  1WI0 A;  4A8X C;  1WGD A;  1F0Z A;  5D6J B;  3AE7 B;  3L0W B;  4HWI B;  1V97 A;  3U4E G;  2ZW1 A;  3P1M A;  3KUZ A;  1KH0 A;  3VQI A;  3NY5 A;  3SHQ A;  1QQR A;  2CU1 A;  3LDZ E;  2BPS A;  4JQW C;  1SJE D;  3AEB B;  2K25 A;  4KDI C;  1QIL A;  2MW5 A;  2Y5B B;  1QLB B;  5BYQ A;  2ZZE A;  4RF1 A;  4WWP A;  1HZ5 A;  2IJ0 A;  3NUH B;  1BUI C;  3VHT C;  3RHU A;  4CI2 A;  2LXA A;  3SFD B;  3QK0 A;  1J7B A;  1YJ1 A;  3Q14 C;  4J3O D;  1VLB A;  2C5L C;  3N1X C;  1C77 A;  2BYE A;  1N61 A;  1YD8 U;  3V3X A;  3TIX A;  2MLB A;  3BK1 A;  2YEP B;  3ZU6 A;  2KMC A;  3ZJV A;  5BMI A;  3TL5 A;  3LYY A;  4RFB A;  5J17 A;  4P6V F;  1R7S A;  2IUS A;  1D5Z C;  4WUR A;  4LDT D;  2JY6 A;  3GE3 C;  2HTM E;  3VUW A;  3P2B A;  1MG8 A;  4IWP A;  3I7N A;  2ZTG A;  2DBY A;  4PYU A;  3KEW A;  2KQ7 A;  3NRZ A;  1VZ8 A;  2KDE B;  3ZUN A;  1TIF A;  3M63 B;  3ZXR A;  2ZVN A;  3PPA A;  3AN1 A;  2WS3 B;  2E1B A;  1SF0 A;  1I4X A;  1L0Y B;  2V3P A;  1EF1 A;  3GZN B;  3C0R B;  3CIR B;  3ENE A;  1I4P A;  2AL3 A;  1IYF A;  1K51 A;  2QIL A;  3BYT B;  1Q1O A;  3NVY A;  4WWN A;  5C3J B;  5DPS A;  2XNA C;  2N0S B;  3ZTC A;  1TTN A;  4LNK A;  4AQ7 A;  4BKS D;  3IVF A;  2O6V B;  2WXM A;  4HDQ A;  3M95 A;  2LMC A;  4HJG E;  3VAW A;  3VFK A;  1FO4 A;  1HZ6 A;  3DBR B;  3SFE B;  1KLG D;  4KGT A;  3PGE A;  4M8N A;  1LO5 D;  1EUV B;  2O6V A;  2NBV B;  3B2G A;  2ZZP B;  2HD5 B;  3KWL A;  2MP2 B;  4XYC A;  3X0W A;  2WXF A;  2I05 A;  4ICV A;  2ZNV B;  3DQV A;  3OJ3 A;  1H4R A;  2N9E B;  5G55 A;  2WX0 A;  3PRM B;  4KZC A;  3A9K B;  2JUO A;  2KVR A;  1KOT A;  1AYF A;  1XT9 B;  4HCN B;  2MP2 A;  2RDH A;  2WHI A;  2NPT B;  2DYM A;  1L0V B;  4USA A;  3T3O A;  2JYT A;  2ICI A;  1ET9 A;  4TMA B;  5EE0 A;  4X57 B;  5HG2 A;  2KXJ A;  1FXA A;  3A9K A;  3NVW A;  4B0M A;  4FA6 A;  4YTM B;  2K8B A;  5DPT A;  1E7V A;  3B08 A;  2VH2 A;  3P63 A;  2I06 A;  1EWC A;  5JH5 C;  2NPT A;  2Q5W D;  3EA6 A;  4BVU C;  3RFN A;  2RD0 A;  2HDE A;  2D07 B;  2IUU A;  4YSX B;  5BMH A;  1I42 A;  1TKY A;  4EFO A;  1YN5 A;  3ZWK A;  4A0B A;  2N9P C;  4G50 A;  3Q3M C;  1RFA A;  2QEJ C;  4P1B C;  3JVZ X;  3QWZ B;  4KVG B;  5JHB A;  1G6J A;  3AEE B;  3B9J A;  2I38 A;  4FHK A;  1CJE A;  2KWD A;  5DPW A;  2C60 A;  3GZN I;  2JXX A;  4E54 A;  3L16 A;  4OVU A;  1VDV A;  3OJ4 B;  4W9K A;  4AR8 A;  3E0C A;  2D3C A;  2C7H A;  4RGO S;  5CX3 A;  2BVC A;  1ZOY B;  3N1Y C;  4FXC A;  1GB4 A;  5C2T B;  1YX6 B;  2PE6 B;  3MP9 A;  4ARF A;  1F2R I;  2LI5 A;  2RR9 A;  4US8 A;  2R2O A;  2D5G A;  1HTO A;  4OVV A;  5J18 A;  4B9K A;  4YSZ B;  1TBE A;  5HFY A;  3IHP C;  3ZUP A;  3A4R A;  2DX5 B;  1TZO A;  3DBR I;  2EMS A;  4O1N A;  3R3M A;  3HUI A;  1IP9 A;  3AM9 A;  3U8Z A;  2NTS A;  4TV3 A;  3BIN A;  2WXL A;  2GMI C;  5D3D A;  2LEK A;  3RCZ A;  3AED B;  1PGX A;  1WYG A;  3CST A;  1RYJ A;  1YOV B;  1VD2 A;  2N9L A;  2WXI A;  3I9V 1;  3DHI C;  4W9J A;  1ESF A;  4M02 A;  2K9X A;  3Q8F A;  4Q2J A;  3JSV B;  4IOI E;  1QOA A;  3AEG B;  1GG3 A;  1BML C;  2J0J A;  1WX9 A;  4I6N B;  4RGM A;  1S1Q B;  3RNF C;  1DYQ A;  3MTN B;  3VH4 B;  2D11 A;  2BKR B;  3ZDM C;  1E8Y A;  5JXV A;  4ZHP A;  3Q2A C;  5LNK 1;  1MVK A;  5GXG B;  3AB5 A;  1NEN B;  3JSV A;  1J0G A;  3ML8 A;  2BB6 A;  3A4S C;  2NS5 A;  3ECI A;  2K22 A;  2KHW B;  2JWZ A;  2JYE A;  5D3I B;  3NS8 A;  3MC0 B;  2X38 A;  2V3S A;  2K6D B;  2LWP A;  3Q8B A;  4E71 A;  1I35 A;  3DHG C;  3BVG A;  3LXF A;  4DHZ E;  1LXD A;  4OZB A;  1BXT A;  4REZ A;  1QKZ A;  2EEL A;  1XCQ L;  1WXO A;  2DEN B;  3A33 B;  3QAR A;  4FJZ A;  3AI5 A;  1IGC A;  5IKC M;  4NY0 A;  1QZE A;  4HRS A;  4MGI E;  2GRI A;  1TZ1 A;  2BWF A;  2WXG A;  4P1C C;  2WXR A;  3AEC B;  2KWU B;  3DOW A;  1WXM A;  1JWB D;  3QX1 A;  1L5P A;  3AU4 A;  1ET6 A;  2OJR A;  2MBE A;  4XWW A;  1SE2 A;  2JT4 B;  3BK2 A;  1N6Z A;  1I7H A;  3IAS 1;  4CO7 A;  4BFR A;  1WF9 A;  4A11 A;  4BOZ B;  2REX A;  3I5J C;  1WJU A;  5AUI A;  2FCQ A;  2KWV B;  1TYG B;  4A6Q A;  3T3N A;  3H9D A;  1P0R A;  3M62 B;  3RNC C;  1V49 A;  1MJD A;  2KD0 A;  2BBC A;  2ZCC A;  1JQ4 A;  3I3T B;  2WLB A;  3EFC A;  3LJ3 A;  1EU3 A;  2JZZ A;  3DVG X;  5FK9 C;  2V1Y A;  3VR8 B;  1IUE A;  1NVI D;  3ZDT A;  4ZYS A;  5CHV C;  4W9G A;  1AN8 A;  4DHJ D;  2FBW B;  1ACC A;  3NVZ A;  3PT2 B;  4A0A A;  4WH4 A;  3MJ5 A;  4FLH A;  3IG3 A;  1E8X A;  2PW9 A;  3AH7 A;  2V0G A;  4MH8 A;  4FBJ B;  2D3A A;  2JZ3 B;  3Q8E A;  2ACZ B;  3AE4 B;  4NAM A;  4GXB A;  1E7U A;  2BTE A;  5AZH A;  2PVO D;  3WAN A;  2E3T A;  4L23 A;  4R3D A;  1GJZ A;  1FM0 D;  2M1M A;  3EHV A;  2K3U A;  1GNU A;  3CWI A;  3DCG A;  2IO1 B;  2WX1 A;  5AZF A;  1XXG A;  2M56 B;  3T8M A;  2Z59 B;  4NPN A;  3TSS A;  4AUQ C;  2K8C A;  4P7I A;  3Q3N C;  2CU3 A;  4LNI A;  3GP7 A;  3ZX4 A;  1XQQ A;  2FUH B;  1WXA A;  3Q6B A;  1JWS D;  4CI3 A;  4ARC A;  4XDD A;  1A5R A;  2LUM A;  3CMM B;  4IDI A;  4HPP A;  1ROE A;  4GDL B;  1OQR A;  3HHM A;  2J0M A;  2INP E;  2CJN A;  4YSY B;  3FAH A;  4XX5 A;  2KKC A;  2JU6 X;  5DPR A;  4ZRK A;  2ZW0 A;  3X23 A;  1PYW D;  4WJO A;  4GDL A;  3Q3J A;  4GU2 A;  3BYY B;  1YNT E;  2GBN A;  1WNU A;  4K3B A;  4A08 A;  2W55 A;  1ZXI A;  4HXD A;  5FKA C;  1WWT A;  2IBI B;  2QMT A;  1V80 A;  1MPE A;  2DZK A;  5LLI A;  5FR3 A;  2Y50 A;  1TKE A;  2BB5 A;  4RF0 A;  3R7R A;  2JF5 A;  1V4P A;  4XR2 A;  2EMT A;  3ZNG C;  2JZP A;  3N20 C;  4YTN B;  3VTU A;  2WP9 B;  1TJE A;  2UWQ A;  3AEA B;  3EGR A;  4FN2 A;  3KQ4 A;  1UGM A;  1TY0 A;  1I4Q A;  3IXS A;  1MG4 A;  1WM2 A;  3TBL D;  2IGD A;  1SIF A;  4OZC A;  4K7U A;  2MQJ A;  4WJP A;  2J0K A;  3ABV B;  1LM8 B;  2N9K A;  4WIP A;  2VRR B;  3ZWD A;  1OQQ A;  2LGX A;  2KX3 A;  1SSN A;  4JE3 B;  2L83 A;  3KYC D;  2FUG 1;  2M0A A;  4M01 A;  2LUE A;  2BS3 B;  3RI7 C;  2Z8L A;  1WGH A;  4D2K A;  4M0W B;  1HQR D;  5D2M B;  2MH7 A;  1ZP0 B;  3BY4 B;  2LVO A;  5IOI A;  1CQV A;  2Y3U A;  2ON8 A;  3RUI B;  3ZJT A;  1OQY A;  1C4C A;  1QOB A;  1YQB A;  1ZUD 2;  2AL6 A;  1L7Y A;  3ZW7 A;  1UZX B;  2C7N B;  4M0W A;  1E8Z A;  4E74 A;  3RZF A;  2AQ1 B;  2HTH A;  2PIA A;  1I4G A;  4HJK A;  5IN7 A;  2GLS A;  1FXT B;  2MHJ A;  4N6E B;  3IBE A;  3H6N A;  1C4A A;  1EM7 A;  4CI1 A;  3AE2 B;  3SEB A;  2ASQ A;  3U30 A;  2K39 A;  3QQ8 B;  4E3C A;  4ARI A;  3RD2 A;  3PRE A;  3ZJU A;  5T8I A;  4L2Y A;  2IYD B;  1WJ4 A;  1V81 A;  4MT5 A;  4ANW A;  1DOX A;  2ZVO A;  2QHO A;  4HCP B;  2AX5 A;  1N5W A;  3ZGZ A;  4HDO A;  1QOF A;  4ZYN A;  4WAA A;  2KC2 A;  4G0N B;  1MHH E;  2BS2 B;  1ISN A;  3N3K B;  2MBQ A;  1V6E A;  1ECR A;  4WWM A;  1J8C A;  4TZ4 A;  2WXH A;  1E7P B;  2NVU I;  4WAF A;  2EKE C;  4GIV A;  4NZL B;  5AEK B;  3B1L X;  1XO3 A;  3IAM 1;  4KZ0 A;  3AE3 B;  4ARE A;  4F1S A;  3A1Q B;  2IY0 B;  3P42 A;  3Q3F A;  2KT7 A;  3RMK C;  4DDI D;  2BQQ A;  1YQ4 B;  2JSV X;  3NHE B;  3VTV A;  3DPD A;  3NJT A;  3RZW C;  2AYO B;  1ZE3 D;  1QT9 A;  5GMV A;  2I1J A;  3AMZ A;  2HYE A;  4PS7 A;  2QIE B;  3RNE C;  2KDM A;  3A1Q A;  2A4Z A;  3EFU A;  2FNJ B;  2INC C;  5KHQ A;  4GSW A;  2W9N A;  1K52 A;  2PEA A;  1F2R C;  2WU2 B;  1HXY D;  1K53 A;  3ML9 A;  3PVL A;  4TUU A;  1N60 A;  2BWE S;  1SE4 A;  3MFG A;  4DHJ B;  2BKF A;  2KQ4 X;  2WYQ A;  2FCS A;  2KNB A;  1WXS A;  2BGF A;  4B6W A;  2R2Q A;  3VRA B;  4TSS A;  1FRR A;  1ZXH A;  1A70 A;  1J7A A;  3I8E A;  2DAJ A;  2KQS A;  4HK2 A;  1HA5 A;  1SEB D;  3EUB 2;  2L0F A;  1X1M A;  1JWU D;  3APF A;  2Y3A A;  3KWV A;  3B2F A;  1D5X C;  2W3R A;  2WQY B;  2ZNV C;  3O65 B;  4OZA A;  4LJP B;  2CJO A;  2RMM A;  5E6J A;  1XD3 B;  2GBJ A;  2KK8 A;  2RPQ A;  3L54 A;  2YEP F;  2KX0 A;  2PJH A;  4XC2 A;  1C4P A;  1EWY C;  4GN1 A;  5CTR C;  1D6E C;  3K9P B;  2L0T A;  4IG7 B;  1FIQ A;  2QDF A;  4KX6 B;  2IY1 B;  4G11 A;  2K0P A;  4W9C A;  1SGH A;  3PZ7 A;  3J9C A;  1FPY A;  4RH6 A;  3VDZ A;  2CHZ A;  4KKI A;  1GC6 A;  1TT5 B;  2IO0 B;  2V4L A;  3IT6 B;  2KOX A;  2LRU A;  2WDV B;  5BMG A;  3ZVV A;  4JLC A;  1NYR A;  3HVD A;  1E9M A;  1WJ6 A;  2J42 A;  3DBL B;  2OOB B;  2KVZ A;  5DCN A;  3WAM A;  2Z0D B;  2KFK B;  3PRZ A;  3DVN V;  1STE A;  1I4R A;  3NG0 A;  3APD A;  2KMM A;  2CKH B;  1SB3 C;  5BYS A;  2H89 B;  1NI2 A;  4N59 A;  4ZDV A;  4NQK E;  1VZ7 A;  2G9H D;  2KDB A;  2ZPN A;  3R8B A;  1P98 A;  4W9E A;  2E6X A;  1SE9 A;  1QOG A;  3CF6 E;  3AV8 A;  2J52 A;  2OJW A;  1WRD B;  2KFK A;  1Q5W B;  2L3Z A;  1T0R C;  1TKG A;  4HEA 1;  1IPG A;  4AP4 C;  2L00 B;  3OWE B;  1JML A;  1WE6 A;  1NI3 A;  1E5W A;  5TR5 A;  1U4A A;  4F8C B;  1UGJ A;  1N5X A;  1V2Y A;  3FIL B;  4EZJ A;  1C9F A;  1WGY A;  2YLM A;  2KO3 A;  1T0Q C;  4ASW C;  4K7W A;  3U7D A;  4EE2 A;  4II2 B;  2M4N A;  3WA0 A;  4CQN A;  1JWM D;  3VR9 B;  4DXA B;  3FIL A;  3W1Y A;  1Z2M A;  4DXF A;  4C7Z A;  3WCQ A;  2G1E A;  4XGA B;  2LGY A;  2NTT A;  4LTU A;  2J4X A;  1V86 A;  2AWT A;  3EEC A;  2IUT A;  2PKO A;  1WGK A;  2FCM A;  4MGK E;  4DK5 A;  1WX8 A;  4WJN A;  1RAX A;  3ONS A;  3I7K A;  2LAS A;  4KKJ A;  1JRO A;  4KDL B;  5D94 A;  4RGT A;  1L6V A;  1GPX A;  3W1S A;  2KTR A;  2DAF A;  4CYE A;  3L4P A;  2RDB C;  2IDY A;  2WU5 B;  3HRD D;  4RCO A;  4JWS C;  4GOC A;  4UDU C;  2KAC A;  1FD6 A;  4K1R B;  3KW5 B;  3A9J B;  3ZRF A;  4AJY B;  1C1Y B;  3I7L A;  2N4F A;  3BVM A;  1MHX A;  2W54 A;  4IWO A;  3R66 C;  4JPS A;  4IM2 A;  4BOS C;  4AS1 A;  2AEH A;  4A90 A;  3AU5 A;  3DBL I;  4IUM B;  4S17 A;  5HKH A;  5I4D A;  1TS4 A;  2WXQ A;  1N62 A;  1V1P B;  3A9J A;  4DQO C;  4ZRQ A;  1TGZ B;  2DLB A;  2RPV A;  1UBI A;  3NZS A;  3O13 A;  3RT3 B;  1B9R A;  3HM3 A;  3PZ8 A;  1GC7 A;  4FHJ A;  1RRB A;  3U2S C;  1KLU D;  2B5L A;  3PZD A;  1UF0 A;  4PS8 A;  2D2Q A;  3V05 A;  1L2N A;  4M8M A;  2OED A;  4AR1 A;  4FAD A;  4QAY A;  1L6U A;  1V1P A;  3UIO B;  3NS1 A;  5IP4 D;  5MPO A;  3OLM D;  2K5P A;  4RMA A;  3Q3O C;  3ZXV A;  1V5T A;  1WY8 A;  1FCC C;  2N7D A;  3NZU A;  3MC8 A;  1HTQ A;  1WR6 E;  2ONQ A;  1YN3 A;  4BKG A;  2N7J A;  1LFD A;  1L4Z B;  1L4D B;  2LGS A;  1K50 A;  3P4P B;  3S2A A;  1XLQ A;  2YVC A;  4FJV B;  1ENF A;  1YJJ A;  4S0R A;  2MBH A;  1V1O A;  1MI0 A;  1EO6 A;  4JX1 C;  5G5G A;  3H8H A;  2JVC A;  2M8S A;  4URK A;  1L0X B;  1WFY A;  4IKG A;  3KH0 A;  2PTL A;  2PLP A;  3U52 E;  1DOY A;  1FCL A;  3DVG Y;  3UF8 A;  4JWU C;  3NVV A;  3ZTY A;  1T0S C;  1GAQ B;  1TS3 A;  4DDG D;  3KVF B;  2TSS A;  5JHA A;  2KLC A;  3H1U A;  4ZRI A;  3C19 A;  4I6P A;  4MDK E;  3U7Z A;  3PTF C;  1ZKH A;  3QC8 B;  1WE7 A;  1KJT A;  1SJH D;  4PT5 A;  2FAZ A;  3EI2 A;  2L76 A;  3QHT A;  1D5M C;  1F9J A;  2LHE A;  2LGI A;  1P9D U;  4XR1 A;  2DZM A;  2LVP A;  1M4V A;  4FJY A;  2CS4 A;  1AAR A;  2FIF A;  4BZA A;  4WQO B;  1T0Y A;  3ZX5 A;  4LNF A;  2NMQ A;  4K7S A;  2KN4 A;  2WWZ A;  2IZV B;  3RFZ B;  2L05 A;  1IGD A;  5CHF A;  3ZRC A;  4OVZ A;  3RN9 C;  2DYB A;  3ZNZ B;  1V9J A;  1FNV A;  2MSE D;  3T9L A;  4LJO B;  2LJ5 A;  1RM6 C;  3H7S A;  4LCD E;  1B1Z A;  2IGG A;  5IAA C;  1PFD A;  4II3 B;  2G45 B;  3P4Q B;  5BYR A;  2G3Q B;  1HE8 A;  3N32 A;  4MH0 E;  3HM6 X;  3L10 B;  4M00 A;  3KLS X;  2M17 A;  2KC1 A;  2N9X A;  3PS6 A;  2KLG A;  3VTW A;  5IO9 A;  4CHK A;  4ZRP A;  2JRH A;  2LHD A;  2BW2 A;  1BT0 A;  2B5M A;  4HKQ A;  1D3Z A;  2X8X X;  3H7P B;  2NCN A;  1WYW B;  2INN E;  4YTP B;  3HIZ A;  4E5Z A;  1NDD A;  5J2R A;  2KTF A;  1KLV A;  5E6N A;  2D10 A;  3AUL A;  1NBF C;  1V8C A;  3KUD B;  3H7P A;  1NYQ A;  1E10 A;  4PK1 A;  1KRH A;  3DBH B;  2WXJ A;  1Q0W B;  3BWU D;  1JWA D;  5AUK A;  1SE3 A;  3FKY A;  3W5V B;  4A9A A;  2UYZ B;  3HVZ A;  1TY2 A;  2Y6I A;  1CMX B;  2RSU A;  4XDC A;  2MCN B;  2Z0E B;  2LGD A;  3OAW A;  1FFU A;  1MFW A;  3I63 C;  3QIJ A;  1OTR B;  3ZQ4 A;  3ZKJ C;  3MHS D;  1GUA B;  1RLF A;  3FC4 A;  3ZTD A;  1D4B A;  2UU7 A;  3R2T A;  5LXH A;  4AJW A;  2G4D B;  3V6E B;  4JGH B;  2GI9 A;  2XEW A;  4BBN C;  1XLP A;  3KUC B;  1R4N B;  4GB9 A;  2GB1 A;  2CR5 A;  2OHF A;  2N7E A;  2LXC A;  1WZ3 A;  4C7Y A;  3UQA A;  2B3A A;  2MBB B;  1YMH E;  1ZDX A;  2KMA A;  2DYO A;  4OHJ A;  3R2I A;  2G4S A;  4ZRJ A;  1E90 A;  5EE9 A;  5EDS A;  2FCN A;  3ZLZ A;  1F1H A;  2H88 B;  1F52 A;  3RYT A;  1WXV A;  4RM9 A;  4ACF A;  2O2V B;  2ZOS A;  3D32 A;  5AZG A;  3URY A;  3V60 A;  4GMV A;  4YXD B;  2V9H A;  2BYV E;  3WAL A;  3V6C B;  2D3G A;  3WIM A;  2IO2 B;  2M19 A;  2PE9 A;  4TKN A;  3EI3 A;  4NJ6 A;  3VXW A;  1P1A A;  3Q8C A;  2O2V A;  2MWS B;  5E6P A;  3UI3 A;  4US9 A;  3PRP B;  5LXI B;  1WSP A;  4PS3 A;  3QCA A;  2K1F A;  4NNJ B;  4OW0 A;  3DBS A;  3DWM A;  1T5X D;  1LGR A;  5KHO A;  1E0Z A;  2GBM A;  3ZNH B;  3DVN U;  1DOI A;  3K9O B;  1XCT L;  2BYT A;  2WDT B;  1PUT A;  3V61 A;  3GE8 C;  1DGJ A;  2GBK A;  4NQL B;  4XR0 A;  3N9Y C;  3QA8 A;  4B95 A;  1KFY B;  3TEX A;  4ANV A;  3DBH I;  5IA7 A;  2BT6 A;  2KDI A;  3I57 A;  3N30 A;  4HRO A;  2AQ2 B;  2PVG C;  1GB1 A;  3W9C B;  4AR9 A;  3GB1 A;  1VCB A;  3R7Q A;  1UNS A;  4BBN F;  4HVB A;  4YWG G;  1Y56 A;  2R61 A;  2IPK D;  2DHZ A;  4ZHO A;  2C7M B;  1WGG A;  1UUP A;  2WXN A;  4NJC A;  3RNB C;  4KSK C;  2N1V A;  3EC8 A;  2MA9 B;  3PLV A;  3M3J A;  4WQM A;  4MSM B;  4IC7 B;  3SD5 A;  4KSL C;  1KM7 A;  2PPH A;  3AE6 B;  3I7H A;  5G5H A;  3NZ3 A;  4NJ7 A;  1OGW A;  4A55 A;  1R4N I;  1WXQ A;  3AE5 B;  2W82 A;  2MJE A;  1WR1 A;  2WNM A;  3TEZ A;  2XN9 C;  3W5U B;  2DNF A;  4LNN A;  1JCK B;  1S3S G;  1WIA A;  2L52 A;  4IW0 A;  2ZZG A;  2DZI A;  2SAK A;  2Y5P A;  2CHX A;  3PSE B;  2ZZF A;  2DZJ A;  5FQD A;  1VJK A;  2KAN A;  3TJP A;  4PYZ A;  5E6O A;  2KDF B;  4W9L A;  1K8R B;  4HLE A;  1QF6 A;  3UQB A;  3N1Z C;  1NEK B;  2K6Q A;  1RWS A;  2RGF A;  2LFI A;  4EZK A;  3GOE A;  4BAX A;  1JRU A;  1WJN A;  3QAQ A;  5C1Z A;  1SXT A;  3I7P A;  1JRP A;  1XEE A;  1UBQ A;  2VZK D;  2ZCB A;  1E8W A;  4HPL B;  3ZO5 B;  3L08 A;  3KYD D;  1RFK A;  1PDX A;  3NOB A;  4LLG M;  1UWX A;  2CHW A;  3JW0 X;  1XVI A;  1JW9 D;  5EE3 A;  2M0X A;  1CZP A;  3BZD B;  2KFJ A;  5HI1 A;  1ZDV A;  1KTK A;  5JZE B;  3OG5 A;  1WH3 A;  2KZR A;  4EZL A;  1C79 A;  1TS2 A;  2NBU A;  2BS4 B;  4XWT A;  3APC A;  4DHZ B;  3ZW3 A;  3PV1 A;  1N63 A;  2A5U A;  3C8Y A;  5TSS A;  2N1W A;  3CSF A;  2Y5C A;  1UWM A;  3ALB A;  2I1K A;  3DWG C;  4YT0 B;  4AOF A;  1FEH A;  2LRW A;  3SR6 A;  1J7C A;  3LB8 C;  2KTR B;  1FXI A;  1F77 A;  5G2N A;  3AE9 B;  3ZIM A;  3I89 A;  3I8C A;  1Q10 A;  2QJL A;  5FR6 A;  4BKT A;  5BO4 B;  3ETR A;  2SEB D;  2FE8 A;  3L17 A;  1WMH B;  1YQ3 B;  3EI4 A;  2AQ3 B;  4TQ1 A;  3UGB B;  1FNW A;  2QSD A;  1HEZ E;  4HPM B;  2JPH A;  2WXO A;  3W2D A;  4ZOH C;  3W1S C;  2NBW B;  1XF5 L;  3RNG C;  1WRI A;  4WJQ A;  1T6B X;  1WMH A;  4HKZ E;  3PO0 A;  4A3O A;  4IM3 A;  2MBO A;  2EWJ A;  3TUO A;  2KJR A;  1E6E B;  4JIO U;  1ZW7 A;  1AWD A;  2ZEQ A;  4KGR A;  4KIK B;  1SBB B;  3WAP A;  1V5O A;  3WAO A;  3I7O A;  3L13 A;  1XLN A;  1EU4 A;  2KJH B;  2WDR B;  4DXG A;  3AE8 B;  4MJS B;  4K3C A;  4A09 A;  4RNA A;  2MJD A;  4GDK B;  4W9F A;  1M94 A;  4KIK A;  5H92 C;  1C78 A;  2WGS A;  4MAC A;  4NAW B;  2KN5 A;  2JXT A;  1WM3 A;  4IM0 A;  3PHX B;  3WQZ A;  4LDT B;  4A3P A;  3EI1 A;  3VH3 B;  4EOY A;  3MHZ A;  1EF5 A;  3VRB B;  4MJS A;  4XR3 A;  4IWQ A;  2MJ3 A;  3RNA C;  1VRA B;  3ZNI D;  1C76 A;  5L95 C;  1PQS A;  1TS5 A;  4GDK A;  4K81 A;  4NAW A;  1J19 A;  2LJI A;  1FRD A;  2IO3 B;  4G3X B;  2QC8 A;  4C4V B;  1ZPS A;  3E56 A;  1YX5 B;  3E9S A;  2O6V D;  4LNO A;  3B0A A;  4H2A A;  3SDL C;  1R4M B;  2JWU A;  2KAJ A;  2KYW A;  2HE7 A;  2B76 B;  2WXK A;  3V62 A;  2FID A;  2L32 A;  1WGR A;  4J6I A;  3DHH C;  3IFW B;  4W9D A;  3UIP B;  2V4I B;  4LK0 M;  1UEL A;  2XBB C;  3JYU A;  4C00 A;  4C4V A;  1SIJ A;  1KF6 B;  3TMP B;  3ZTW A;  3TEY A;  4EUT A;  1P7F A;  4GLS C;  1Z5S B;  2GBR A;  2L1A A;  4MEM A;  2ZJD A;  4BKS A;  4DWF A;  4EKU A;  4A20 A;  3HK0 A;  2W3S A;  3GS2 A;  2IGH A;  4I6L B;  2XK5 B;  1PGA A;  3AXC A;  1V7O A;  2NR2 A;  2KWC A;  5CHW A;  1P7E A;  4XZ4 A;  5L83 A;  4YL8 A; 
#chains in the Genus database with same CATH homology
 1D5X C;  1FFU A;  2W3R A;  2WQY B;  4P16 A;  5JXV A;  4ZHP A;  4OZA A;  3ZQ4 A;  2CJO A;  5LNK 1;  1MVK A;  5GXG B;  3AB5 A;  1NEN B;  2RMM A;  5E6J A;  3AE1 B;  2BB6 A;  2YEP F;  3AEF B;  3FC4 A;  2RDG A;  1D4B A;  1C4P A;  1EWY C;  2K22 A;  1IBX B;  1D6E C;  3R2T A;  2JYE A;  5D3I B;  3RPF C;  4RGN A;  3ZYY X;  3P4R B;  1YN4 A;  1FIQ A;  2X38 A;  2EKI A;  3MC0 B;  4KX6 B;  4MM3 B;  5D7G A;  4C80 A;  2K0P A;  5H8Y E;  3PZ7 A;  2MEK A;  2GI9 A;  3J9C A;  3Q8B A;  2WDQ B;  4RH6 A;  1I4H A;  1XLP A;  2JX5 A;  2GB1 A;  2OHF A;  3BVG A;  4KKI A;  3LXF A;  1OFF A;  5EE1 A;  3TEW A;  3IT6 B;  4OZB A;  4C7Y A;  1BXT A;  4REZ A;  1QKZ A;  2WDV B;  2EEL A;  5BMG A;  1XCQ L;  5HHD G;  1WXO A;  1YMH E;  1ZDX A;  2I2Y A;  1IBX A;  1NYR A;  2DYO A;  4OHJ A;  3R2I A;  3HVD A;  1E9M A;  2J42 A;  1IGC A;  5EE9 A;  3P4S B;  2H88 B;  1VZ6 A;  1STE A;  4B0E A;  1I4R A;  4HRS A;  3URY A;  1YJI A;  2KMM A;  4YXD B;  1SB3 C;  2GRI A;  4N58 A;  5BYS A;  2H89 B;  2WXG A;  4N59 A;  2PMV A;  1VZ7 A;  2G9H D;  2V3N A;  2WXR A;  3AEC B;  3R8B A;  4XE0 A;  2M19 A;  2E6X A;  1JWB D;  1QOG A;  3AV8 A;  2J52 A;  3EI3 A;  1L5P A;  1ET6 A;  3Q69 A;  4C56 C;  4TQ0 A;  4XWW A;  1SE2 A;  3Q8C A;  2VZK B;  1TKG A;  1FMA D;  3BK2 A;  4HEA 1;  1I7H A;  2WXP A;  3IAS 1;  3OWE B;  3UI3 A;  1PGB A;  4A11 A;  4US9 A;  1WSP A;  1JML A;  1NI3 A;  5AUI A;  2J53 A;  4OW0 A;  3Q8A A;  3DWM A;  1N5X A;  1TYG B;  1UGJ A;  1VR9 A;  4A6Q A;  3T3N A;  1T5X D;  3FIL B;  4L1B A;  1C9F A;  2JQR B;  1E0Z A;  1DOI A;  1XLO A;  2BBC A;  1XCT L;  4KGS A;  2BYT A;  4EE2 A;  1JQ4 A;  1FFV A;  1PUT A;  1AW7 A;  1T3Q A;  1DGJ A;  2WLB A;  1EU3 A;  3BII D;  5FK9 C;  4XR0 A;  3N9Y C;  4CQN A;  3VR8 B;  1IUE A;  1JWM D;  1KFY B;  1NVI D;  3BVZ A;  3TEX A;  4ZYS A;  3VR9 B;  1AN8 A;  2DWQ A;  2BT6 A;  3FIL A;  1GOZ A;  2FBW B;  4DXF A;  3I57 A;  1ACC A;  3IT4 B;  4C7Z A;  3NVZ A;  3WCQ A;  2G1E A;  1JAL A;  4A0A A;  2NTT A;  3MJ5 A;  4ITK A;  4HRO A;  4LTU A;  4WH4 A;  2J4X A;  1CK1 A;  2PW9 A;  2AQ2 B;  3AH7 A;  1FNU A;  2V0G A;  2PVG C;  4MH8 A;  1GB1 A;  2IUT A;  3W9C B;  2PKO A;  4A8X C;  1F0Z A;  1WGK A;  4AR9 A;  3GB1 A;  3AE7 B;  1V97 A;  3U4E G;  1UNS A;  2ZW1 A;  3Q8E A;  2ACZ B;  3AE4 B;  4NAM A;  3P1M A;  4YWG G;  1Y56 A;  2R61 A;  2IPK D;  2BTE A;  1KH0 A;  4ZHO A;  3VQI A;  2PVO D;  2E3T A;  4L23 A;  3I7K A;  4R3D A;  1QQR A;  1FM0 D;  1UUP A;  2K3U A;  2WXN A;  4KKJ A;  1JRO A;  4NJC A;  1SJE D;  3CWI A;  3AEB B;  4RGT A;  1L6V A;  1GPX A;  1QIL A;  4WQM A;  3W1S A;  1QLB B;  5BYQ A;  2ZZE A;  3L4P A;  4RF1 A;  3AE6 B;  1XXG A;  2IDY A;  1HZ5 A;  2IJ0 A;  3I7H A;  2M56 B;  1BUI C;  3NUH B;  5G5H A;  2WU5 B;  3TSS A;  3NZ3 A;  3HRD D;  4RCO A;  3RHU A;  4JWS C;  4CI2 A;  3SFD B;  2CU3 A;  4UDU C;  4A55 A;  1J7B A;  2KAC A;  1FD6 A;  3GP7 A;  4J3O D;  1VLB A;  1JWS D;  1WXQ A;  1C77 A;  3AE5 B;  2W82 A;  4CI3 A;  2MJE A;  4ARC A;  2WNM A;  4XDD A;  3I7L A;  1N61 A;  3BVM A;  1MHX A;  2LUM A;  3V3X A;  3TEZ A;  2XN9 C;  3W5U B;  2W54 A;  4IDI A;  4JPS A;  1ROE A;  1JCK B;  4GDL B;  4AS1 A;  1OQR A;  2L52 A;  3BK1 A;  2ZZG A;  2YEP B;  2INP E;  4A90 A;  2CJN A;  4YSY B;  3FAH A;  3ZJV A;  5BMI A;  2SAK A;  2Y5P A;  5I4D A;  1TS4 A;  2WXQ A;  3LYY A;  1N62 A;  2ZZF A;  1V1P B;  4RFB A;  5FQD A;  4DQO C;  4ZRQ A;  2DLB A;  4P6V F;  1R7S A;  1VJK A;  2JU6 X;  2RPV A;  1D5Z C;  2IUS A;  4WUR A;  2ZW0 A;  3O13 A;  1PYW D;  1B9R A;  2HTM E;  3PZ8 A;  3U2S C;  1KLU D;  2B5L A;  3BYY B;  1YNT E;  1QF6 A;  3I7N A;  3V05 A;  2ZTG A;  2DBY A;  3KEW A;  1NEK B;  1WNU A;  4A08 A;  2OED A;  1RWS A;  2W55 A;  3NRZ A;  4AR1 A;  1ZXI A;  2LFI A;  1VZ8 A;  5FKA C;  1WWT A;  2QMT A;  1L6U A;  1V1P A;  1MPE A;  1SXT A;  3NS1 A;  3I7P A;  1JRP A;  1XEE A;  3AN1 A;  2WS3 B;  2VZK D;  2E1B A;  5FR3 A;  1SF0 A;  1I4X A;  1L0Y B;  2V3P A;  2Y50 A;  1TKE A;  2BB5 A;  4RF0 A;  1RFK A;  3CIR B;  5MPO A;  1I4P A;  1PDX A;  2K5P A;  1V4P A;  4XR2 A;  4LLG M;  1UWX A;  1K51 A;  2QIL A;  3BYT B;  3NVY A;  2JZP A;  5C3J B;  1FCC C;  4YTN B;  1JW9 D;  5EE3 A;  2WP9 B;  2XNA C;  2N0S B;  1TJE A;  3AEA B;  1CZP A;  3BZD B;  3EGR A;  3KQ4 A;  4AQ7 A;  1TY0 A;  2ONQ A;  1ZDV A;  5HI1 A;  1YN3 A;  1I4Q A;  1KTK A;  3IXS A;  2WXM A;  2N7J A;  2IGD A;  4OZC A;  1C79 A;  2LMC A;  1L4Z B;  1L4D B;  1TS2 A;  4HJG E;  2BS4 B;  4XWT A;  1K50 A;  3ABV B;  3P4P B;  2N9K A;  1FO4 A;  1XLQ A;  1N63 A;  4WIP A;  3C8Y A;  1OQQ A;  1HZ6 A;  1ENF A;  5TSS A;  2Y5C A;  1SSN A;  1UWM A;  4JE3 B;  3SFE B;  1YJJ A;  1KLG D;  3DWG C;  2L83 A;  4KGT A;  4YT0 B;  1FEH A;  1V1O A;  1MI0 A;  2FUG 1;  1LO5 D;  3SR6 A;  1J7C A;  2M0A A;  3LB8 C;  4JX1 C;  3B2G A;  5G5G A;  1FXI A;  1F77 A;  3H8H A;  3AE9 B;  2BS3 B;  2Z8L A;  3I89 A;  3KWL A;  1L0X B;  3I8C A;  4IKG A;  2WXF A;  4D2K A;  2I05 A;  1Q10 A;  1HQR D;  2QJL A;  2PTL A;  2PLP A;  3U52 E;  1DOY A;  3ETR A;  1FCL A;  2SEB D;  4JWU C;  2MH7 A;  1ZP0 B;  2FE8 A;  3NVV A;  1YQ3 B;  3EI4 A;  1CQV A;  1GAQ B;  2AQ3 B;  4TQ1 A;  1TS3 A;  2Y3U A;  2TSS A;  2ON8 A;  1FNW A;  2QSD A;  3ZJT A;  1HEZ E;  1AYF A;  2WXO A;  1C4C A;  3U7Z A;  1QOB A;  3W2D A;  1ZUD 2;  2RDH A;  4ZOH C;  4M0W A;  1XF5 L;  2DYM A;  1SJH D;  4PT5 A;  1L0V B;  1WRI A;  2AQ1 B;  2PIA A;  1I4G A;  4USA A;  3T3O A;  3EI2 A;  1T6B X;  2JYT A;  1D5M C;  2ICI A;  1ET9 A;  4TMA B;  5EE0 A;  2LHE A;  4HKZ E;  3PO0 A;  4N6E B;  2LGI A;  5HG2 A;  4XR1 A;  4B0M A;  1FXA A;  3NVW A;  4YTM B;  2EWJ A;  3TUO A;  1M4V A;  1C4A A;  1E6E B;  1EM7 A;  4CI1 A;  3AE2 B;  3SEB A;  3P63 A;  1AWD A;  2I06 A;  1EWC A;  4KGR A;  2Q5W D;  3EA6 A;  4ARI A;  1SBB B;  3RFN A;  2HDE A;  3ZJU A;  5T8I A;  3I7O A;  4L2Y A;  1XLN A;  2NMQ A;  1EU4 A;  2KN4 A;  2IUU A;  4YSX B;  5BMH A;  2WDR B;  1TKY A;  4DXG A;  3RFZ B;  1YN5 A;  3AE8 B;  4A0B A;  1IGD A;  4MT5 A;  4OVZ A;  1DOX A;  2QEJ C;  4A09 A;  3AEE B;  3B9J A;  4RNA A;  2MJD A;  1FNV A;  2AX5 A;  4GDK B;  1N5W A;  3ZGZ A;  5H92 C;  1C78 A;  1RM6 C;  1QOF A;  2I38 A;  4MAC A;  4NAW B;  1CJE A;  1B1Z A;  2IGG A;  2KWD A;  2JXT A;  1MHH E;  1PFD A;  3WQZ A;  2BS2 B;  3P4Q B;  3EI1 A;  3MHZ A;  3VRB B;  5BYR A;  4XR3 A;  4E54 A;  1VDV A;  1ECR A;  4AR8 A;  4WWM A;  4TZ4 A;  2WXH A;  2MJ3 A;  1E7P B;  4WAF A;  3E0C A;  1VRA B;  1C76 A;  4NZL B;  1TS5 A;  4RGO S;  1ZOY B;  4FXC A;  1XO3 A;  3IAM 1;  1GB4 A;  5C2T B;  3AE3 B;  4ARE A;  3MP9 A;  4ARF A;  1F2R I;  4US8 A;  3P42 A;  2LJI A;  3KLS X;  2D5G A;  1FRD A;  1YQ4 B;  2JSV X;  1ZPS A;  3E56 A;  1ZE3 D;  3E9S A;  1QT9 A;  4YSZ B;  4H2A A;  3AMZ A;  4ZRP A;  5HFY A;  2JWU A;  2LHD A;  2BW2 A;  2HYE A;  2KAJ A;  1TZO A;  2B76 B;  2QIE B;  2B5M A;  4HKQ A;  2KDM A;  2WXK A;  4O1N A;  3HUI A;  3AM9 A;  2L32 A;  2INN E;  2NTS A;  4YTP B;  2V4I B;  4LK0 M;  4E5Z A;  2WXL A;  1SIJ A;  5D3D A;  2LEK A;  3AED B;  1K52 A;  1PGX A;  1WYG A;  1F2R C;  2WU2 B;  1HXY D;  1K53 A;  1RYJ A;  1KF6 B;  3TEY A;  1N60 A;  3MFG A;  1SE4 A;  2N9L A;  1P7F A;  1V8C A;  2KQ4 X;  2WXI A;  4GLS C;  3I9V 1;  1NYQ A;  2L1A A;  1E10 A;  1KRH A;  1ESF A;  2WXJ A;  3VRA B;  3BWU D;  1JWA D;  4TSS A;  5AUK A;  1SE3 A;  1FRR A;  1ZXH A;  2K9X A;  1A70 A;  1J7A A;  3Q8F A;  4Q2J A;  4IOI E;  3W5V B;  4A9A A;  3I8E A;  2W3S A;  1HA5 A;  3GS2 A;  2IGH A;  1QOA A;  1SEB D;  3AEG B;  3HVZ A;  3EUB 2;  1TY2 A;  1BML C;  1PGA A;  2Y6I A;  4XDC A;  1V7O A;  4RGM A;  1JWU D;  1P7E A;  1DYQ A;  2Y3A A;  3KWV A;  3B2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...