1TJEA

Crystal structure of the editing domain of threonyl-trna synthetase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonyl-tRNA synthetase
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tjeA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tjeA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tjeA02
1YQ3B 1XLOA 2BS3B 2WU5B 3AEAB 3KWLA 1FRDA 1AYFA 1J7CA 2EKIA 3AE7B 3HRDD 2K22A 1SF0A 1R7SA 1ZOYB 1XLNA 3KEWA 1GAQB 1N60A 2JX5A 1E7PB 1QOBA 3NS1A 1WWTA 1TKEA 4A9AA 3B9JA 1NEKB 4YTNB 1B9RA 3SFDB 1WYGA 1QT9A 2BS2B 2CJNA 3LXFA 4YTPB 2MJ3A 3P63A 3HUIA 1FXAA 3L4PA 4YT0B 1VLBA 5GXGB 1IUEA 1SB3C 2Y5CA 1N5WA 4ZOHC 1FRRA 1NYRA 1N62A 1OQQA 2KAJA 3AEFB 5C3JB 3B2FA 2B76B 3VRAB 3FC4A 1WNUA 3HVZA 4YTMB 2K9XA 3RFNA 1N5XA 1QOGA 1ZXIA 3AE4B 2ZTGA 2DWQA 2FBWB 3RHUA 1TJEA 2PVGC 1NI3A 1E10A 2KMMA 3P4QB 1L5PA 1PFDA 1V97A 3PO0A 4US8A 1GPXA 1JWBD 1I7HA 1VJKA 1FO4A 1L6VA 4YSXB 3AEDB 2ZZFA 1WXOA 2HTME 1NVID 1RYJA 2LEKA 3AEEB 2WS3B 4HRSA 1TKYA 3AE6B 3AE1B 4IDIA 1WRIA 2WLBA 3AB5A 4JWSC 2MJDA 3FAHA 1NENB 3ETRA 1RFKA 4YSZB 1TYGB 1YJJA 1FXIA 2PVOD 2WDRB 4HROA 1J7BA 1T3QA 1ZUD2 5EE0A 3P4RB 3LB8C 2H88B 3DWGC 1RM6C 1L6UA 1KFYB 2W55A 4ITKA 1OQRA 3AM9A 2N0SB 3AE5B 4YXDB 3WQZA 1DOYA 4C7YA 1NYQA 1V8CA 2CJOA 4ZHOA 1JRPA 1PDXA 3CIRB 1A70A 1WXQA 1N61A 1YQ4B 2WP9B 3AE2B 3NVWA 3P1MA 3VR8B 3VRBB 1V4PA 1KF6B 2L52A 3NVYA 1AWDA 1TKGA 3EUB2 4JX1C 4ZHPA 2WDQB 3AEBB 3SFEB 3AV8A 2E3TA 3NVZA 1YJIA 1QOAA 2G1EA 2M19A 4WQMA 5AUIA 1F0ZA 2E1BA 4YSYB 3RPFC 3WCQA 1OFFA 2MH7A 5AUKA 1FFUA 1XLPA 3ABVB 3AMZA 3NRZA 2H89B 1DOXA 1EWYC 3AN1A 1QLBB 2M56B 2ZZGA 4WWMA 3BIID 3CWIA 4LTUA 1FMAD 1JROA 4P6VF 2PIAA 4N58A 2K5PA 2ZZEA 2L83A 2QIEB 3W9CB 1DOIA 2W3RA 5H92C 2QJLA 2WQYB 1UWMA 4C7ZA 1FFVA 3P4PB 3ZYYX 1N63A 3AE9B 5G5GA 3VR9B 1WGKA 2WDVB 2MJEA 3AE8B 3AECB 3AH7A 5C2TB 1CJEA 5EE3A 5H8YE 1E9MA 1JQ4A 2BS4B 1E6EB 2Q5WD 1CZPA 3SR6A 1JALA 1XO3A 5G5HA 1V7OA 4JWUC 2AX5A 2W54A 2ACZB 1ZP0B 2W3SA 1QOFA 1RWSA 1JW9D 3AE3B 3DWMA 1SIJA 2BT6A 2OHFA 5EE1A 3W5VB 1L0VB 5EE9A 2CU3A 1JWAD 2JQRB 3AEGB 3P4SB 5MPOA 4US9A 1QF6A 1E0ZA 3NVVA 4C80A 4N6EB 1J7AA 4USAA 1FM0D 3B2GA 1ROEA 2WU2B 3W5UB 2DBYA 4FXCA 1FIQA 1KRHA 2PKOA 4N59A 1PUTA 1DGJA 1XLQA 4KX6B 1VDVA
chains in the Genus database with same CATH superfamily
4JIOU 3BYYB 2EKIA 1GOZA 1SF0A 1BXTA 1K51A 2N7JA 2NR2A 4YL8A 2KC2A 4FJVB 1SB3C 2Y5CA 2KFJA 2NMQA 4XDDA 3QWZB 4AR8A 4GSWA 1OQYA 2FBWB 1J19A 1Z5SB 4XWWA 2QEJC 3RFZB 5LLIA 1NVID 2MRPA 2G9HD 2J52A 3FAHA 3WAOA 4GMVA 1F9JA 5DPWA 3BINA 3EI3A 3MHZA 5AZHA 3BWUD 3T3OA 1S3SG 2KVZA 2GBJA 3AM9A 4BZAA 1WIAA 4B95A 2I06A 2MBBB 3WQZA 2GRIA 3IXSA 1Q5WB 2X38A 4BAXA 3TSSA 2KFKA 1L0XB 4GDKB 4KVGB 2KMAA 3I7KA 3DBHB 3L54A 2M0XA 2WXHA 1IBXA 3ZO5B 2E1BA 1N6ZA 2I1JA 4BKSD 2DNFA 2UU7A 4IG7B 3C19A 1FMAD 5KHOA 4W9IA 3VTVA 2WQYB 2UYZB 5IA7A 4AUQC 3NZSA 4FJYA 4GDKA 2L7RA 5EE3A 2W9NA 1JQ4A 1HEZE 1E6EB 2IGGA 2W54A 3S2AA 2D3GA 2LVPA 1D5ZC 2BWFA 4WWPA 5IO9A 3W5VB 5D2MB 4KKJA 4GDLB 2ZNVB 2REXA 3B2GA 4M8MA 2GOWA 4DWFA 1KRHA 3PRZA 1SGHA 1XLOA 4XGAB 3VTUA 2D3BA 1CMXB 4WAFA 1XLNA 3BZDB 1QOBA 1YX6B 1KJTA 4GDLA 4K7UA 3DBLI 3APCA 3W1SC 2JY6A 3NHEB 1YNTE 1SJHD 3AE4B 2ZTGA 2KTFA 3RHUA 2INNE 2LVOA 4DXAB 4US8A 2V9HA 4BBNC 5DPRA 3WAPA 1L6VA 3AEDB 1BUIC 1RYJA 2NPTA 2ZPYA 3AEEB 3ZRCA 2FE8A 4GU2A 5G55A 2PMVA 4II3B 2V4IB 4YSZB 1TYGB 3MC0B 3RNFC 2J0KA 3T9LA 2HDEA 1SE2A 1TIFA 1RRBA 3LB8C 2BQQA 3P42A 3BY4B 2JVCA 1VZ7A 2K25A 3DBHI 5CX3A 2NS5A 2PJHA 4YXDB 3PSEB 1WJ4A 2CJOA 2WXGA 1PDXA 3KQ4A 4MEMA 4S17A 4B6WA 4ZHPA 3Q14C 4IWQA 4WQOB 4ZYNA 2WXOA 1BT0A 2WWZA 4HXDA 1C4PA 1D5XC 1EUVB 3U2SC 2RDHA 4EFOA 2ZZGA 1F2RC 1UWXA 3NS8A 3A9KB 4W9HA 3L16A 2QHOA 4URKA 2LI5A 5CHVC 3I57A 1N63A 4AOFA 3ZXRA 1CJEA 2NCNA 3ENEA 5DPTA 1ZE3D 3QQ8B 4GXBA 1C78A 3A9KA 2KDIA 1WSPA 1KLGD 4NAMA 1FIQA 4A6QA 2LRUA 3HVDA 3VFKA 1FRDA 2D10A 1TS5A 2JZPA 3AE7B 1TZ1A 2K22A 3ZVVA 2JZZA 2NBVB 2WGSA 3I8CA 1R4NB 5IKCM 2Y3UA 4DHZE 3DBSA 3N30A 3PVLA 3Q2AC 3Q3MC 3U52E 4LJOB 1J8CA 1TTNA 2D3AA 5E6PA 3ZU6A 4GOCA 4AP4C 2KT7A 3DOWA 2JSVX 2Y50A 1I4QA 1WNUA 3RFNA 2K9XA 4ZDVA 3ZDTA 1WZ0A 1I4XA 4DK5A 3ZTCA 4LNNA 1WE6A 1VJKA 5J18A 2BTEA 2N1WA 1UBQA 4EE2A 1UBIA 2KWCA 4OVUA 2K6DB 1T3QA 4KIKB 1D6EC 2KJRA 3B1LX 3ZXVA 1L0YB 1OEYA 4JLCA 1XVIA 3ML8A 3RUIB 3VR8B 2O6VD 3DVGX 5G2NA 2ICIA 2KK8A 2BBCA 4KIKA 2KOXA 4M01A 1XLPA 4K81A 4WURA 2KZRA 3WALA 3N32A 1WE7A 4W9JA 1FNVA 4RNAA 3AH7A 2MJEA 1WYWB 1CZPA 2L8JA 2FAZA 2W3SA 2ZPNA 4LDTB 4BKSA 1L0VB 4A08A 1ACCA 2BPSA 3TCAA 4ARFA 2UWQA 2PKOA 1PQSA 1GNUA 4MH8A 2MBOA 1PGAA 3HRDD 2KX3A 3GE8C 2LVQA 3DBRB 2LGIA 4BFRA 4F7ZA 2B5LA 2MJ3A 1D3ZA 4ZRKA 1FRRA 3AI5A 2KAJA 1WXVA 5BYSA 1V5TA 2FUG1 3FC4A 2ZOSA 1N5XA 2NTTA 5CHFA 4KZ0A 2LUEA 3EFUA 2ZZFA 5AZGA 4IDIA 1T6BX 2LRWA 2GI9A 3I5JC 1LQBA 3ZW7A 3B0AA 2IUUA 1ZUD2 2H88B 3ZWKA 4ITKA 3CSFA 3V61A 4RGOS 1X1MA 1DOYA 2JWUA 4A20A 1YX5B 3HK0A 3VRBB 4AJWA 2MCNB 4FHKA 3PRMB 4E5ZA 2IGHA 4W9FA 2X8XX 3CMMB 3IFWB 1MVKA 3LYYA 4NJCA 1DOXA 4KDIC 1QLBB 5E6NA 1IYFA 3QARA 3RNBC 3AECB 5AEKB 4B9KA 4DXGA 3KVFB 4JWUC 4B0EA 2ACZB 2HJ8A 1SBBB 2V4LA 1P7EA 3H9DA 4MELA 4LLGM 1ROEA 2DLBA 3DBRI 3C8YA 1YQ3B 4KDLB 3ECIA 3TUOA 2L32A 4I6NB 3PGEA 3IBEA 1ENFA 4CYEA 2WX1A 3B9JA 1NEKB 1SEBD 2BS2B 1KOTA 1KH0A 4YT0B 4A8XC 5IP4D 3KWVA 2B76B 3U30A 3A1QB 2BGFA 5EDSA 2AL6A 3UQAA 4PS7A 2ONQA 2BB6A 3VHTC 2RDGA 1C9FA 2IDYA 4ANUA 1E10A 3P4QB 3Q3OC 1JWBD 1I7HA 2AL3A 1T0SC 1WXOA 2HTME 1ZGUB 3RD2A 3EA6A 1HQRD 2DYBA 1HXYD 1HE8A 1WZCA 3PZ8A 3M95A 1YMHE 1P7FA 4HROA 2RPVA 4O1NA 4RM8A 1NYQA 1YJ1A 4L1BA 1JCKB 1JRPA 1SIFA 4TKNA 2OEDA 4ANVA 2O6VB 3AU5A 3WCQA 4B0MA 1STEA 4G0NB 2XK5B 3AN1A 4HDOA 4L23A 2JUOA 3EGRA 2ZZEA 2QIEB 2DYMA 2K8BA 2M0AA 3QK0A 2O6VA 4M0WA 4XYCA 3VR9B 1WGKA 3HHMA 3Q8AA 1RWSA 3N1YC 5EE1A 1FD6A 4FA6A 1YIWA 4WWOA 3ZUNA 4RCOA 2JZ3B 3TJPA 1PGXA 2L52A 3MJWA 2BKRB 2KJ6A 4H2AA 1YN5A 2MSED 4FLHA 2JYTA 4RFBA 2JX5A 1GG3A 2KC1A 2MW5A 3N9YC 2GBNA 4TSSA 5D7GA 1WWTA 1WYGA 3KW5B 1GB4A 4FHJA 4DDGD 1WFYA 1IGCA 2AYOB 3ZNGC 1L4DB 2ON8A 3MP9A 2MP2A 3QC8B 3ZQ4A 4NZLB 1NI3A 1WGDA 2KMMA 1IP9A 2KJHB 4AREA 1ET9A 1I4RA 4J6IA 2GBRA 2M4NA 4NQKE 3BYTB 3Q69A 1NENB 3EC8A 4QAYA 4WJQA 1EWCA 2BYVE 4RF1A 5EE0A 1RLFA 2LGXA 1RM6C 4GGQA 3V6EB 4E3CA 4NQLB 4FADA 4OVVA 2N0SB 1V8CA 4XR0A 1IGDA 4MGYE 1QILA 2WXJA 4G11A 2KFKB 3KUDB 4W9CA 2M19A 3T3NA 1WH3A 4JL9A 1IBXB 5D94A 2BKFA 1TZOA 2HD5B 3MC9A 3A4SC 4A0AA 1JROA 1WMHB 2ZEQA 1HZ5A 3AE9B 2WDVB 3TIXA 3TEXA 1ZDXA 2WNMA 4W9KA 2V3PA 4A11A 5MPOA 3HM6X 1RFAA 4C80A 4DBGA 1WMHA 3EI2A 4KKIA 1XLQA 1L4ZB 3I8EA 2MBHA 1AYFA 3GE3C 1C4CA 2MHJA 4OHJA 3MTNB 4PYUA 3W1YA 2ZJDA 2HYEA 3RNEC 2SAKA 1K53A 2I05A 1G6JA 2JYEA 4C00A 2LJ5A 2OOBB 3N1ZC 1C1YB 4GLSC 3OAWA 5FKAC 3VRAB 5C1ZA 2I2YA 2L05A 5T8IA 3ZNID 1AN8A 3AE1B 4DDID 4MSQB 2RSUA 3ZW3A 2IO0B 2NPTB 3SDLC 2JT4B 3QAQA 2LXCA 2KLGA 2NTSA 3D32A 1XEEA 2W82A 4W9GA 2G4SA 1KFYB 3BVZA 1I42A 3AE5B 4JGHB 3OJ3A 4IW0A 1YD8U 4KGTA 3AU4A 3OLMD 3P1MA 3X23A 3M63B 5HKHA 2KMCA 5D3IB 1V86A 1FPYA 4LJPB 3EI4A 2MH7A 2C7HA 5JHAA 1BMLC 4JE3B 1Y8RC 4M02A 4JPSA 2KWUB 3IT4B 1NDDA 3U8ZA 1UWMA 1I4PA 4HPMB 3PHXB 2ZVOA 1RAXA 3Q3JA 2IO2B 2N9LA 1E8XA 2RGFA 4RGMA 2J4XA 1JW9D 4Q2JA 2KDFB 2VH2A 2ZW0A 2MBEA 5D3DA 2WXMA 4XWTA 2DBYA 2NVUI 3ZJVA 1SSNA 2BS3B 1WY8A 4HCPB 4XR2A 3KEWA 3NOBA 4PYZA 4ANXA 1GAQB 3PS6A 3SU8X 5JXVA 3JYUA 1CQVA 1XCTL 3VXWA 1I4GA 3L13A 3RZFA 1T0RC 2N1VA 4A90A 3APDA 2N7EA 3A4RA 2LGYA 5TR5A 3OJ4B 5FK9C 1WR1A 1T0QC 3L10B 4FULA 3NY5A 2LEKA 5TSSA 3EHVA 4RGTA 4HVBA 4L2YA 1UD7A 2IY0B 3B08A 2RR9A 3TBLD 4XE0A 3I7HA 1I4HA 3I3TB 3RNGC 3TEZA 3V3XA 3DQVA 3ZJUA 4RM9A 4ZRQA 3Q8BA 1YQ4B 4XX5A 4RH6A 3EUB2 3GZNB 2I1KA 2OJRA 4ACFA 4E71A 3R3MA 1F0ZA 2N4FA 4IM2A 4F1SA 1HA5A 2IGDA 4A09A 4ZRJA 1HZ6A 4FN2A 2HJ1A 1FFVA 3P4PB 2BYEA 4BKTA 1ESFA 4NJ6A 2LGDA 4XDCA 4TQ1A 1LGRA 1VRAB 2Q5WD 2D2QA 2AX5A 2MQJA 1ZP0B 3KYDD 2BT6A 3O65B 4II2B 1ECRA 4GB9A 4RF0A 2RDBC 3J9CA 2G4DB 1VDVA 2G45B 1FCLA 1TBEA 2VH1A 3DDCB 4HDQA 2IZVB 4HPPA 3Q8EA 2DZJA 3SFDB 1VZ6A 1MG4A 1J0GA 4R3DA 3U7DA 2KDMA 2HTHA 1I35A 2K8CA 4HJGE 4DHZB 3ZX5A 1R4NI 1WX8A 1ZXIA 2J0MA 2BW2A 4W9LA 1UF0A 4PS3A 2R61A 3C0RB 2WX0A 2GMIC 2L0TA 3Q8CA 4DHJD 3AE6B 4W9DA 1WGHA 2WLBA 4MGIE 2WXFA 5BO4B 3ETRA 2N9XA 3K9OB 2PVOD 2KVRA 2ZW1A 2AWTA 3W1SA 3GZNI 1L6UA 3ZWDA 1KLUD 4NAWA 2J7QB 3DVNV 3EFCA 3RYTA 2WP9B 2L00B 1FCCC 2PW9A 3AEBB 2CR5A 2EWJA 3VUWA 1QOAA 2G1EA 2FCNA 2O2VB 2LD9A 3ABVB 2C60A 2JPHA 3SEBA 2ZCBA 4N58A 4P6VF 4ARCA 2OJWA 3ZKJC 3I89A 1Q1OA 4RGNA 4M8NA 3AE8B 3R2IA 5GMVA 2DZMA 1E9MA 3GOEA 1F52A 3SR6A 2JF5A 2LASA 4NNJB 1DYQA 1EO6A 4KV2A 2WXIA 1SIJA 2D5GA 2O2VA 4OZCA 2KTRB 1Z2MA 2KXJA 3U4EG 5EE9A 4BBNF 4AS1A 1MPEA 2BWES 1MG8A 3H7SA 2YEPB 1GUAB 1DGJA 3I7OA 3CSTA 3KWLA 4XR1A 3IVFA 2LFIA 2ZZPB 2N7DA 2IPKD 4TQ0A 4RMAA 1E7PB 2KTRA 2IJ0A 3VUYA 1MHHE 4A9AA 4YTNB 2PE6B 1WJ6A 3FKYA 2CJNA 4EKUA 1VLBA 5GXGB 1WX9A 1KTKA 1XQQA 4ZOHC 3RT3B 4MM3A 1NBFC 5C3JB 3JW0X 3WAMA 2V3SA 4M00A 5AZFA 4MJSA 2M17A 4HLEA 4YSXB 2XN9C 4XR3A 5D6JB 3AXCA 3PLUA 2K1FA 1LXDA 2Y5BB 4WH4A 5IAAC 3VVWB 3RZWC 4IC7B 2WHIA 4OVZA 4LK0M 1WX7A 2AEHA 3R2TA 1J7BA 3KUZA 1C4AA 2MLBA 3O13A 1E90A 4W9EA 3DWGC 3ZDMC 1HTOA 4XC2A 2VZKD 1WJUA 1LFDA 4D2KA 1ZKHA 3EECA 3QHTA 1JWSD 2E3TA 1QZEA 1MI0A 3I63C 2Y3AA 1F2RI 3RCZA 1FFUA 3WIMA 4WWMA 1ZPSA 4REZA 1K50A 4HEA1 3QJZA 3KYCD 5E6OA 4WJNA 1UUPA 4TZ4A 4JQWC 2KDBA 1WM2A 2BS4B 4EZJA 1XO3A 4M0WB 1V5OA 3R7RA 2ZNVC 1QOFA 3A9JA 3LJ3A 3ZTYA 4GIVA 1FXTB 2HE7A 3PRPB 1FM0D 3NZUA 1WXAA 1PUTA 1IPGA 3P2BA 2Z0EB 3AEAB 5IOIA 2XNAC 1J7CA 2QILA 2DZIA 1D4BA 2KQ4X 3V62A 1PYWD 1V80A 4YWGG 2IO1B 2FCMA 5I4DA 4IWOA 1WXSA 2JU6X 3JSVB 2MP2B 5E6JA 2KN5A 1PFDA 4ZRPA 5HG2A 2ZCCA 2DX5B 5FQDA 4HRSA 1WRIA 3IAS1 1A5RA 3HIZA 1YJJA 2DAFA 2IUTA 3TL5A 1TY2A 1YN4A 3P4RB 3JSVA 3ZLZA 5FR6A 2C7MB 2PEAA 1M4VA 2KHWB 1C79A 4KSLC 2MEKA 2Y6IA 1WR6E 3CIRB 1KLVA 1A70A 1N61A 4K3BA 3KH0A 3DVGY 3E9SA 1AWDA 1TKGA 3PLVA 2B5MA 3ALBA 4TV3A 3QX1A 2A5UA 2JXXA 2L76A 3L17A 3N1XC 3Q6BA 4YSYB 4C4VA 4EEWA 2FUHB 1OFFA 3V6CB 3FILA 2H89B 1JMLA 4LTUA 3K9PB 3GP7A 3H6NA 3W9CB 4I6PA 4ARIA 3PTFC 3E0CA 2IBIB 3WA0A 5G5GA 4CHKA 2AQ1B 1WGGA 5G5HA 1Q10A 2DAJA 2R2OA 3IT6B 3P4SB 1WJNA 3TEWA 4PK1A 3DHGC 1YN3A 1J7AA 2WYQA 4N59A 3DBLB 1K8RB 4WWNA 2WU5B 3DPDA 1MJDA 2EELA 2KWDA 1E7VA 2FCQA 4A3PA 3N3KB 3NS1A 4HJKA 3SD5A 5BMHA 1CK1A 3SHQA 1QT9A 3UINB 1MHXA 2V0GA 1FXAA 3L4PA 2TSSA 4MGKE 3NJTA 3W2DA 4AR9A 3H1UA 4MSMB 1V6EA 2PE9A 2WXKA 4HKQA 5LXIB 1GC6A 2LJIA 1WZ3A 1FO4A 4ASWC 3ZTWA 1U4AA 1TKYA 1PGBA 2KX0A 3VDZA 1E5WA 2N9EB 3E56A 3X0WA 4CI1A 2K6QA 2KN4A 2C9WB 3VUXA 1C76A 3ONSA 3BVMA 3RN9C 4C7YA 2VZKB 2CKHB 2K39A 2WXPA 1WXQA 3V05A 4KZCA 1UNSA 4LDTD 2JRHA 3AV8A 3NVZA 3BK2A 3ZTDA 3N20C 1HTQA 4ANWA 4WJOA 3AMZA 1S1QB 1OTRB 4EOYA 2GBMA 2INCC 1EM7A 4DQOC 2K5PA 2L83A 2QJLA 3ZRFA 4ZYSA 2J42A 3HM3A 1WRDB 2I38A 2L3ZA 1V7OA 3IHPC 4I6LB 1JWMD 4AR1A 1KM7A 3JVZX 1JWUD 1JWAD 2BF8B 4NJ7A 4US9A 1QF6A 1E0ZA 2L1AA 4OZAA 2FIDA 1GC7A 3ZIMA 4FXCA 4OW0A 4CO7A 4HCNB 3QA8A 3UF8A 1VCBA 1OGWA 3QCAA 3DCGA 3PZ7A 5HFYA 3URYA 1ZOYB 2CS4A 2Z59B 4KGSA 1EU4A 2DENB 5LNK1 3HUIA 3UIOB 3KLSX 4PS8A 1N62A 2PPHA 3AEFB 3WANA 1UELA 3MC8A 3RI7C 3VTWA 1NI2A 3VH4B 2A4ZA 1TJEA 2QSDA 4UDUC 2N9PC 1QQRA 3AULA 2LHEA 4XZ4A 2GBKA 3I7PA 3GB1A 4IOIE 3L0WB 2CHWA 3IAM1 1V1OA 1RFKA 2N9KA 1EF1A 3L08A 1FXIA 4AWJA 1LM8B 1Q0WB 3PZDA 1MFWA 2RPQA 1L2NA 4DXFA 3CF6E 2GLSA 2WXNA 1L7YA 2PLPA 5LXHA 4AQ7A 4MGZE 2KACA 4ZHOA 1ZW7A 2KLCA 3AE2B 4E74A 1FEHA 1V4PA 3NG0A 3NVYA 4ICUA 4PT5A 2L0FA 4WQMA 5CHWA 4NPNA 5AUKA 4EUTA 3CWIA 3BVGA 4X57B 3R8BA 4IM3A 1V1PB 1E8ZA 1V49A 4FBJB 2KYWA 3ZYYX 4EZKA 2DHZA 3VQIA 4F8CB 2VRRB 3A33B 2EMTA 2Z0DB 2JRIB 2KD0A 3DWMA 1B1ZA 4MH0E 2CU3A 3MJ5A 1H4RA 4BVUC 5KHQA 3KUCB 1VR9A 1V1PA 3W5UB 2LZ6A 1H8CA 3MFGA 5HHDG 1R4MB 2RD0A 2KO3A 3MHSD 1TKEA 4TMAB 3UIPB 4LNOA 2XBBC 4YTPB 2BYFA 2JWZA 5J2RA 1OQQA 2E6XA 2QMTA 4IM0A 2V3NA 1XF5L 3B2FA 4LNFA 3RMKC 3HVZA 3H7PB 2K0PA 4IWPA 2QDFA 1ET6A 3PPAA 1GPXA 3ML9A 3U7ZA 1TS2A 2GB1A 2KWVB 2BYTA 4JWSC 2MJDA 4CI3A 2M1MA 3RNCC 3QIJA 1LO5D 2QC8A 3H7PA 4WIPA 1FNWA 1UH6A 4BKGA 4G3XB 4K3CA 1OQRA 3R7QA 2FNJB 1SXTA 3Q8FA 3RULA 1M94A 3GS2A 3T8MA 3ZJTA 1YQBA 2BVCA 4NAWB 2NBUA 1TGZB 1YJIA 1WI0A 5AUIA 2LGSA 4AJYB 4A55A 2WXQA 1GB1A 2AQ2B 4KGRA 1P9DU 4BOSC 2LHDA 1V81A 4P1BC 3PV1A 2K3UA 1P0RA 5J17A 2ASQA 3R66C 5C2TB 2LMCA 4S0RA 5BYQA 1XXGA 1JALA 2J0JA 4HPLB 2D07B 1WGRA 3AE3B 3BK1A 2CU1A 2R2QA 2IYDB 3APFA 2B3AA 1C3TA 4USAA 1R4MI 4N9F4 2WU2B 1EF5A 4KX6B 1XD3B 4GN1A 2RMMA 1VZ8A 5BYRA 1SE4A 1R7SA 2K8HA 1XCQL 1B9RA 1WXMA 2WXLA 4FJZA 1TY0A 4KSKC 5JH5C 3LXFA 3P63A 3UI3A 1UGMA 5BMIA 4K1RB 1IUEA 2C7NB 1NYRA 2JXTA 4YTMB 3UQBA 4MM3B 3ZX4A 2AQ3B 1EU3A 2YLMA 2PVGC 4K7SA 1V97A 4LNIA 3VH3B 1P1AA 3TEYA 1TS3A 4HWIB 3AB5A 4MJSB 5BMGA 3Q3NC 1FNUA 1D5MC 5JZEB 4WJPA 2WDRB 2Y5PA 3NUHB 2KDEB 3PHWB 1F1HA 2WDTB 2W55A 1WF9A 2MA9B 3DHIC 1P98A 1UGJA 4IKGA 2C5LC 1KF6B 4JX1C 2SEBD 1E7UA 3IG3A 3SFEB 4P1CC 1ZDVA 3RPFC 3ZNHB 3RNAC 3DHHC 3M3JA 4IUMB 1EWYC 5C23A 1T5XD 4MACA 1OEYJ 5H92C 2W3RA 4C7ZA 2YEPF 3UGBB 3PT2B 1K52A 3OWEB 2EMSA 2XEWA 4G50A 3H8HA 4K7WA 2OHFA 5CTRC 1SE9A 4LCDE 3AEGB 2FIFA 3A9JB 1E8YA 5DCNA 5HI1A 3NVVA 4N6EB 1AARA 2BB5A 4MDKE 3TMPB 2NBWB 2KQSA 2ZVNA 4LNKA 5L83A 3ZUPA 2MBQA 1ZXHA 4MT5A 2LUMA 2IY1B 4NY0A 2IO3B 1N60A 3ZNZB 1WGYA 4A3OA 4HK2A 3A1QA 1TT5B 1N5WA 2WXRA 5FR3A 3ZGZA 2EKEC 2G3QB 1QOGA 3OG5A 2DWQA 2QCZA 1L5PA 2INDC 3PO0A 2KQ7A 1Y56A 2D3CA 4ZRIA 2WS3B 1VD2A 1JRUA 3NZ3A 1UZXB 4EZLA 5L95C 2V1YA 5DPSA 1GJZA 2LXAA 4A0BA 4TUUA 4WAAA 2D11A 2INPE 1V2YA 4P7IA 4ICVA 4HKZE 4CQNA 3I7LA 2FCSA 4J3OD 2PTLA 5JHBA 2J53A 3NVWA 1C77A 2WDQB 3Q3FA 4DHJB 1AW7A 2LWPA 4P16A 2YVCA 2XK5A 2MX2A 4CI2A 2IUSA 2CHZA 3NRZA 2DYOA 2M8SA 3PREA 2M56B 3BIID 3I9V1 1SJED 1ISNA 4C4VB 4BOZB 2PIAA 1YOVB 1XT9B 1DOIA 3FILB 2CHXA 3I7NA 2DZKA 4OZBA 2KANA 1T0YA 2MWSB 2KNBA 5H8YE 4C56C 1WM3A 1TS4A 1F77A 1P3QU 2KKCA 3LDZE 5IN7A 4E54A 1QKZA 2JQRB 3VAWA 3V60A 1SE3A 2Z8LA 1V9JA 3M62B 3EI1A 3DVNU 1E8WA
chains in the Genus database with same CATH topology
1YQ3B 3BYYB 1FCLA 2EKIA 3PZ7A 3TUOA 5HFYA 3URYA 1GOZA 2L32A 1SF0A 1ZOYB 1BXTA 1K51A 2N7JA 4KGSA 1ENFA 1EU4A 3B9JA 1NEKB 3Q8EA 3SFDB 5LNK1 1SEBD 2BS2B 1VZ6A 1KH0A 4YT0B 3HUIA 4R3DA 4A8XC 2KDMA 3KLSX 1SB3C 2Y5CA 2NMQA 4XDDA 1N62A 3AEFB 3KWVA 2B76B 4HJGE 4AR8A 1ZXIA 2BW2A 2FBWB 2ONQA 2R61A 1TJEA 2BB6A 2QSDA 2RDGA 4UDUC 2IDYA 1C9FA 1E10A 1QQRA 3P4QB 4XWWA 2QEJC 2LHEA 3RFZB 1JWBD 1I7HA 1WXOA 2HTME 1NVID 3Q8CA 3I7PA 3AE6B 3GB1A 4IOIE 2WLBA 2G9HD 2J52A 2WXFA 3FAHA 3IAM1 1V1OA 3EA6A 3ETRA 1HQRD 1RFKA 2N9KA 1HXYD 3PZ8A 1FXIA 1YMHE 1P7FA 2PVOD 4HROA 2ZW1A 3W1SA 3EI3A 3MHZA 3BWUD 3T3OA 2RPVA 4DXFA 4O1NA 1L6UA 2WXNA 2PLPA 3AM9A 2I06A 3WQZA 1KLUD 2GRIA 1NYQA 3IXSA 4AQ7A 2KACA 2X38A 3TSSA 4ZHOA 4L1BA 1JCKB 1JRPA 1L0XB 2OEDA 3AE2B 2WP9B 4GDKB 1FEHA 3I7KA 1V4PA 3NVYA 1FCCC 2PW9A 3AEBB 2WXHA 4PT5A 1IBXA 2EWJA 1QOAA 2G1EA 4WQMA 2E1BA 3WCQA 4B0MA 5AUKA 1STEA 3ABVB 3AN1A 4L23A 3SEBA 3CWIA 1FMAD 4P6VF 4N58A 3EGRA 4ARCA 2QIEB 3BVGA 2ZZEA 3R8BA 1V1PB 2WQYB 2DYMA 3I89A 3ZYYX 2M0AA 4M0WA 4RGNA 3VR9B 1WGKA 3AE8B 3VQIA 3R2IA 5EE3A 1E9MA 1JQ4A 1HEZE 2IGGA 1E6EB 3SR6A 2W54A 1DYQA 3Q8AA 1RWSA 3DWMA 1B1ZA 2WXIA 1SIJA 2D5GA 1D5ZC 4OZCA 5EE1A 3U4EG 3W5VB 1FD6A 5EE9A 2CU3A 4KKJA 3MJ5A 4GDLB 4AS1A 1MPEA 1VR9A 4RCOA 1V1PA 2YEPB 3B2GA 3W5UB 1PGXA 1KRHA 1DGJA 2L52A 3I7OA 1XLOA 3KWLA 4XR1A 4H2AA 1YN5A 3MFGA 2LFIA 5HHDG 4WAFA 2JYTA 2IPKD 1XLNA 4RFBA 4TQ0A 2JX5A 3BZDB 3N9YC 4TSSA 1E7PB 1QOBA 2IJ0A 5D7GA 1MHHE 1WWTA 1TKEA 4A9AA 4YTNB 4TMAB 1WYGA 2CJNA 4YTPB 1VLBA 5GXGB 1GB4A 1YNTE 1KTKA 4ZOHC 1OQQA 2E6XA 2QMTA 1SJHD 2V3NA 5C3JB 1IGCA 1XF5L 3B2FA 1L4DB 2ON8A 3MP9A 3HVZA 3AE4B 2K0PA 2ZTGA 3ZQ4A 3RHUA 2INNE 4NZLB 1NI3A 2KMMA 1ET6A 4AREA 4US8A 1GPXA 1ET9A 1I4RA 3U7ZA 1L6VA 4YSXB 3AEDB 1TS2A 1BUIC 2XN9C 4XR3A 1RYJA 2GB1A 3AEEB 3BYTB 2BYTA 2FE8A 4JWSC 2MJDA 3Q69A 1NENB 4WH4A 2PMVA 2V4IB 4YSZB 4CI3A 1TYGB 1EWCA 3MC0B 4OVZA 4LK0M 3R2TA 2HDEA 1J7BA 1SE2A 4RF1A 1LO5D 1C4AA 3O13A 4WIPA 5EE0A 3LB8C 3DWGC 1FNWA 1RM6C 3P42A 1VZ7A 1OQRA 2N0SB 1SXTA 3Q8FA 4YXDB 2VZKD 1V8CA 2CJOA 2WXGA 4XR0A 3GS2A 3ZJTA 1PDXA 3KQ4A 4D2KA 1IGDA 4NAWB 1QILA 4ZHPA 2WXJA 1JWSD 2E3TA 1YJIA 1MI0A 2WXOA 2M19A 3T3NA 5AUIA 2Y3AA 1F2RI 1C4PA 4A55A 1IBXB 2WXQA 1D5XC 1FFUA 3U2SC 1GB1A 2RDHA 2ZZGA 1TZOA 1F2RC 2AQ2B 4A0AA 4KGRA 4WWMA 1ZPSA 4REZA 1JROA 1UWXA 1K50A 2LHDA 4HEA1 2K3UA 1HZ5A 3I57A 1N63A 3AE9B 1UUPA 4TZ4A 2WDVB 3TEXA 5C2TB 1CJEA 2LMCA 5BYQA 1XXGA 1ZDXA 2BS4B 1JALA 1XO3A 1ZE3D 1QOFA 2WNMA 3AE3B 3BK1A 2V3PA 4A11A 5MPOA 1C78A 4C80A 4USAA 1FM0D 1WSPA 1KLGD 2WU2B 3EI2A 4NAMA 1FIQA 4A6QA 4KKIA 1PUTA 1XLQA 1L4ZB 4KX6B 3HVDA 3I8EA 3AEAB 2XNAC 2RMMA 1FRDA 1AYFA 1J7CA 1VZ8A 5BYRA 1TS5A 2QILA 2JZPA 3AE7B 1SE4A 2K22A 1D4BA 1C4CA 1R7SA 4OHJA 3I8CA 2KQ4X 2Y3UA 1XCQL 2HYEA 3U52E 2SAKA 1K53A 1B9RA 2WXLA 2I05A 1TY0A 2JYEA 3LXFA 3P63A 3UI3A 5BMIA 1PYWD 1IUEA 2JSVX 1NYRA 4GLSC 4YWGG 2JXTA 5FKAC 3VRAB 2Y50A 1I4QA 1WNUA 4YTMB 3RFNA 2K9XA 5I4DA 4MM3B 2AQ3B 1EU3A 1I4XA 2JU6X 2PVGC 2I2YA 5E6JA 1PFDA 1V97A 4ZRPA 5HG2A 5T8IA 1VJKA 5FQDA 1AN8A 3TEYA 2BTEA 4HRSA 1TS3A 3AE1B 4EE2A 1WRIA 3AB5A 5BMGA 3IAS1 1FNUA 1YJJA 2IUTA 1D5MC 2WDRB 1TY2A 2NTSA 1T3QA 1D6EC 1XEEA 1YN4A 2W82A 3P4RB 2Y5PA 3NUHB 1L0YB 1KFYB 2W55A 3BVZA 3AE5B 1M4VA 1C79A 2MEKA 2Y6IA 4KGTA 1UGJA 3CIRB 1A70A 4IKGA 3VR8B 1N61A 3P1MA 3E9SA 1KF6B 2ICIA 1AWDA 1TKGA 2SEBD 4JX1C 2B5MA 3SFEB 5D3IB 2BBCA 1ZDVA 4YSYB 3RPFC 1OFFA 2MH7A 3EI4A 1XLPA 3FILA 4WURA 2H89B 1BMLC 1EWYC 1JMLA 4JE3B 4LTUA 4JPSA 1T5XD 3GP7A 4MACA 3W9CB 5H92C 2W3RA 4ARIA 3IT4B 1UWMA 4C7ZA 1I4PA 3E0CA 2YEPF 1FNVA 4RNAA 5G5GA 3AH7A 1K52A 2MJEA 3OWEB 2N9LA 2AQ1B 1CZPA 5G5HA 2W3SA 4RGMA 2J4XA 3H8HA 1JW9D 1Q10A 4Q2JA 2OHFA 3IT6B 1L0VB 4A08A 1ACCA 2ZW0A 3P4SB 3AEGB 3TEWA 5D3DA 5HI1A 2WXMA 3NVVA 4XWTA 1YN3A 4ARFA 4N6EB 1J7AA 2BB5A 2DBYA 2PKOA 4N59A 3ZJVA 1SSNA 2BS3B 2WU5B 4MH8A 1ZXHA 4MT5A 2EELA 2LUMA 1PGAA 3HRDD 2KWDA 4XR2A 3KEWA 1GAQB 1N60A 2LGIA 3NS1A 5JXVA 3C8YA 5BMHA 1CK1A 1CQVA 1QT9A 1XCTL 1MHXA 2V0GA 2MJ3A 2B5LA 1FXAA 3L4PA 2TSSA 1I4GA 3W2DA 1N5WA 2WXRA 1FRRA 5FR3A 4AR9A 2KAJA 3ZGZA 4A90A 5BYSA 2FUG1 2WXKA 3FC4A 1N5XA 1QOGA 4HKQA 2DWQA 5FK9C 2NTTA 1L5PA 2LJIA 3PO0A 1Y56A 1FO4A 2ZZFA 2LEKA 5TSSA 4IDIA 2WS3B 1TKYA 4RGTA 1T6BX 1PGBA 3NZ3A 4L2YA 2GI9A 3E56A 2IUUA 4A0BA 4XE0A 4CI1A 1ZUD2 3I7HA 1I4HA 2KN4A 2H88B 2INPE 1C76A 4ITKA 3BVMA 3TEZA 4RGOS 3V3XA 4HKZE 4CQNA 4C7YA 1DOYA 3I7LA 2VZKB 3ZJUA 2JWUA 4J3OD 4ZRQA 2PTLA 3Q8BA 2J53A 1WXQA 1YQ4B 2WXPA 3V05A 3NVWA 3VRBB 1C77A 4RH6A 3EUB2 1UNSA 2WDQB 1AW7A 3AV8A 3NVZA 3BK2A 4P16A 4E5ZA 2IGHA 1F0ZA 4CI2A 2IUSA 1HA5A 1MVKA 3AMZA 3LYYA 3NRZA 4NJCA 2DYOA 2IGDA 1DOXA 1QLBB 2M56B 4A09A 3BIID 3I9V1 1SJED 1EM7A 4DQOC 2PIAA 2K5PA 2L83A 1DOIA 1HZ6A 3FILB 2QJLA 1FFVA 3P4PB 3I7NA 4OZBA 1ESFA 4ZYSA 2J42A 4XDCA 4TQ1A 3AECB 5H8YE 4C56C 1VRAB 2Q5WD 1TS4A 1F77A 2I38A 4DXGA 1V7OA 4JWUC 2AX5A 4B0EA 2ACZB 1ZP0B 1JWMD 4AR1A 2BT6A 1ECRA 1SBBB 4RF0A 1JWUD 4E54A 1QKZA 1JWAD 2JQRB 1E0ZA 3J9CA 4US9A 1QF6A 2L1AA 4OZAA 1P7EA 1SE3A 2Z8LA 4LLGM 1ROEA 4FXCA 3EI1A 2DLBA 4OW0A 1VDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ3 B;  1XLO A;  2BS3 B;  2WU5 B;  3AEA B;  3KWL A;  1FRD A;  1AYF A;  1J7C A;  2EKI A;  3AE7 B;  3HRD D;  2K22 A;  1SF0 A;  1R7S A;  1ZOY B;  1XLN A;  3KEW A;  1GAQ B;  1N60 A;  2JX5 A;  1E7P B;  1QOB A;  3NS1 A;  1WWT A;  1TKE A;  4A9A A;  3B9J A;  1NEK B;  4YTN B;  1B9R A;  3SFD B;  1WYG A;  1QT9 A;  2BS2 B;  2CJN A;  3LXF A;  4YTP B;  2MJ3 A;  3P63 A;  3HUI A;  1FXA A;  3L4P A;  4YT0 B;  1VLB A;  5GXG B;  1IUE A;  1SB3 C;  2Y5C A;  1N5W A;  4ZOH C;  1FRR A;  1NYR A;  1N62 A;  1OQQ A;  2KAJ A;  3AEF B;  5C3J B;  3B2F A;  2B76 B;  3VRA B;  3FC4 A;  1WNU A;  3HVZ A;  4YTM B;  2K9X A;  3RFN A;  1N5X A;  1QOG A;  1ZXI A;  3AE4 B;  2ZTG A;  2DWQ A;  2FBW B;  3RHU A;  1TJE A;  2PVG C;  1NI3 A;  1E10 A;  2KMM A;  3P4Q B;  1L5P A;  1PFD A;  1V97 A;  3PO0 A;  4US8 A;  1GPX A;  1JWB D;  1I7H A;  1VJK A;  1FO4 A;  1L6V A;  4YSX B;  3AED B;  2ZZF A;  1WXO A;  2HTM E;  1NVI D;  1RYJ A;  2LEK A;  3AEE B;  2WS3 B;  4HRS A;  1TKY A;  3AE6 B;  3AE1 B;  4IDI A;  1WRI A;  2WLB A;  3AB5 A;  4JWS C;  2MJD A;  3FAH A;  1NEN B;  3ETR A;  1RFK A;  4YSZ B;  1TYG B;  1YJJ A;  1FXI A;  2PVO D;  2WDR B;  4HRO A;  1J7B A;  1T3Q A;  1ZUD 2;  5EE0 A;  3P4R B;  3LB8 C;  2H88 B;  3DWG C;  1RM6 C;  1L6U A;  1KFY B;  2W55 A;  4ITK A;  1OQR A;  3AM9 A;  2N0S B;  3AE5 B;  4YXD B;  3WQZ A;  1DOY A;  4C7Y A;  1NYQ A;  1V8C A;  2CJO A;  4ZHO A;  1JRP A;  1PDX A;  3CIR B;  1A70 A;  1WXQ A;  1N61 A;  1YQ4 B;  2WP9 B;  3AE2 B;  3NVW A;  3P1M A;  3VR8 B;  3VRB B;  1V4P A;  1KF6 B;  2L52 A;  3NVY A;  1AWD A;  1TKG A;  3EUB 2;  4JX1 C;  4ZHP A;  2WDQ B;  3AEB B;  3SFE B;  3AV8 A;  2E3T A;  3NVZ A;  1YJI A;  1QOA A;  2G1E A;  2M19 A;  4WQM A;  5AUI A;  1F0Z A;  2E1B A;  4YSY B;  3RPF C;  3WCQ A;  1OFF A;  2MH7 A;  5AUK A;  1FFU A;  1XLP A;  3ABV B;  3AMZ A;  3NRZ A;  2H89 B;  1DOX A;  1EWY C;  3AN1 A;  1QLB B;  2M56 B;  2ZZG A;  4WWM A;  3BII D;  3CWI A;  4LTU A;  1FMA D;  1JRO A;  4P6V F;  2PIA A;  4N58 A;  2K5P A;  2ZZE A;  2L83 A;  2QIE B;  3W9C B;  1DOI A;  2W3R A;  5H92 C;  2QJL A;  2WQY B;  1UWM A;  4C7Z A;  1FFV A;  3P4P B;  3ZYY X;  1N63 A;  3AE9 B;  5G5G A;  3VR9 B;  1WGK A;  2WDV B;  2MJE A;  3AE8 B;  3AEC B;  3AH7 A;  5C2T B;  1CJE A;  5EE3 A;  5H8Y E;  1E9M A;  1JQ4 A;  2BS4 B;  1E6E B;  2Q5W D;  1CZP A;  3SR6 A;  1JAL A;  1XO3 A;  5G5H A;  1V7O A;  4JWU C;  2AX5 A;  2W54 A;  2ACZ B;  1ZP0 B;  2W3S A;  1QOF A;  1RWS A;  1JW9 D;  3AE3 B;  3DWM A;  1SIJ A;  2BT6 A;  2OHF A;  5EE1 A;  3W5V B;  1L0V B;  5EE9 A;  2CU3 A;  1JWA D;  2JQR B;  3AEG B;  3P4S B;  5MPO A;  4US9 A;  1QF6 A;  1E0Z A;  3NVV A;  4C80 A;  4N6E B;  1J7A A;  4USA A;  1FM0 D;  3B2G A;  1ROE A;  2WU2 B;  3W5U B;  2DBY A;  4FXC A;  1FIQ A;  1KRH A;  2PKO A;  4N59 A;  1PUT A;  1DGJ A;  1XLQ A;  4KX6 B;  1VDV A; 
#chains in the Genus database with same CATH topology
 4JIO U;  3BYY B;  2EKI A;  1GOZ A;  1SF0 A;  1BXT A;  1K51 A;  2N7J A;  2NR2 A;  4YL8 A;  2KC2 A;  4FJV B;  1SB3 C;  2Y5C A;  2KFJ A;  2NMQ A;  4XDD A;  3QWZ B;  4AR8 A;  4GSW A;  1OQY A;  2FBW B;  1J19 A;  1Z5S B;  4XWW A;  2QEJ C;  3RFZ B;  5LLI A;  1NVI D;  2MRP A;  2G9H D;  2J52 A;  3FAH A;  3WAO A;  4GMV A;  1F9J A;  5DPW A;  3BIN A;  3EI3 A;  3MHZ A;  5AZH A;  3BWU D;  3T3O A;  1S3S G;  2KVZ A;  2GBJ A;  3AM9 A;  4BZA A;  1WIA A;  4B95 A;  2I06 A;  2MBB B;  3WQZ A;  2GRI A;  3IXS A;  1Q5W B;  2X38 A;  4BAX A;  3TSS A;  2KFK A;  1L0X B;  4GDK B;  4KVG B;  2KMA A;  3I7K A;  3DBH B;  3L54 A;  2M0X A;  2WXH A;  1IBX A;  3ZO5 B;  2E1B A;  1N6Z A;  2I1J A;  4BKS D;  2DNF A;  2UU7 A;  4IG7 B;  3C19 A;  1FMA D;  5KHO A;  4W9I A;  3VTV A;  2WQY B;  2UYZ B;  5IA7 A;  4AUQ C;  3NZS A;  4FJY A;  4GDK A;  2L7R A;  5EE3 A;  2W9N A;  1JQ4 A;  1HEZ E;  1E6E B;  2IGG A;  2W54 A;  3S2A A;  2D3G A;  2LVP A;  1D5Z C;  2BWF A;  4WWP A;  5IO9 A;  3W5V B;  5D2M B;  4KKJ A;  4GDL B;  2ZNV B;  2REX A;  3B2G A;  4M8M A;  2GOW A;  4DWF A;  1KRH A;  3PRZ A;  1SGH A;  1XLO A;  4XGA B;  3VTU A;  2D3B A;  1CMX B;  4WAF A;  1XLN A;  3BZD B;  1QOB A;  1YX6 B;  1KJT A;  4GDL A;  4K7U A;  3DBL I;  3APC A;  3W1S C;  2JY6 A;  3NHE B;  1YNT E;  1SJH D;  3AE4 B;  2ZTG A;  2KTF A;  3RHU A;  2INN E;  2LVO A;  4DXA B;  4US8 A;  2V9H A;  4BBN C;  5DPR A;  3WAP A;  1L6V A;  3AED B;  1BUI C;  1RYJ A;  2NPT A;  2ZPY A;  3AEE B;  3ZRC A;  2FE8 A;  4GU2 A;  5G55 A;  2PMV A;  4II3 B;  2V4I B;  4YSZ B;  1TYG B;  3MC0 B;  3RNF C;  2J0K A;  3T9L A;  2HDE A;  1SE2 A;  1TIF A;  1RRB A;  3LB8 C;  2BQQ A;  3P42 A;  3BY4 B;  2JVC A;  1VZ7 A;  2K25 A;  3DBH I;  5CX3 A;  2NS5 A;  2PJH A;  4YXD B;  3PSE B;  1WJ4 A;  2CJO A;  2WXG A;  1PDX A;  3KQ4 A;  4MEM A;  4S17 A;  4B6W A;  4ZHP A;  3Q14 C;  4IWQ A;  4WQO B;  4ZYN A;  2WXO A;  1BT0 A;  2WWZ A;  4HXD A;  1C4P A;  1D5X C;  1EUV B;  3U2S C;  2RDH A;  4EFO A;  2ZZG A;  1F2R C;  1UWX A;  3NS8 A;  3A9K B;  4W9H A;  3L16 A;  2QHO A;  4URK A;  2LI5 A;  5CHV C;  3I57 A;  1N63 A;  4AOF A;  3ZXR A;  1CJE A;  2NCN A;  3ENE A;  5DPT A;  1ZE3 D;  3QQ8 B;  4GXB A;  1C78 A;  3A9K A;  2KDI A;  1WSP A;  1KLG D;  4NAM A;  1FIQ A;  4A6Q A;  2LRU A;  3HVD A;  3VFK A;  1FRD A;  2D10 A;  1TS5 A;  2JZP A;  3AE7 B;  1TZ1 A;  2K22 A;  3ZVV A;  2JZZ A;  2NBV B;  2WGS A;  3I8C A;  1R4N B;  5IKC M;  2Y3U A;  4DHZ E;  3DBS A;  3N30 A;  3PVL A;  3Q2A C;  3Q3M C;  3U52 E;  4LJO B;  1J8C A;  1TTN A;  2D3A A;  5E6P A;  3ZU6 A;  4GOC A;  4AP4 C;  2KT7 A;  3DOW A;  2JSV X;  2Y50 A;  1I4Q A;  1WNU A;  3RFN A;  2K9X A;  4ZDV A;  3ZDT A;  1WZ0 A;  1I4X A;  4DK5 A;  3ZTC A;  4LNN A;  1WE6 A;  1VJK A;  5J18 A;  2BTE A;  2N1W A;  1UBQ A;  4EE2 A;  1UBI A;  2KWC A;  4OVU A;  2K6D B;  1T3Q A;  4KIK B;  1D6E C;  2KJR A;  3B1L X;  3ZXV A;  1L0Y B;  1OEY A;  4JLC A;  1XVI A;  3ML8 A;  3RUI B;  3VR8 B;  2O6V D;  3DVG X;  5G2N A;  2ICI A;  2KK8 A;  2BBC A;  4KIK A;  2KOX A;  4M01 A;  1XLP A;  4K81 A;  4WUR A;  2KZR A;  3WAL A;  3N32 A;  1WE7 A;  4W9J A;  1FNV A;  4RNA A;  3AH7 A;  2MJE A;  1WYW B;  1CZP A;  2L8J A;  2FAZ A;  2W3S A;  2ZPN A;  4LDT B;  4BKS A;  1L0V B;  4A08 A;  1ACC A;  2BPS A;  3TCA A;  4ARF A;  2UWQ A;  2PKO A;  1PQS A;  1GNU A;  4MH8 A;  2MBO A;  1PGA A;  3HRD D;  2KX3 A;  3GE8 C;  2LVQ A;  3DBR B;  2LGI A;  4BFR A;  4F7Z A;  2B5L A;  2MJ3 A;  1D3Z A;  4ZRK A;  1FRR A;  3AI5 A;  2KAJ A;  1WXV A;  5BYS A;  1V5T A;  2FUG 1;  3FC4 A;  2ZOS A;  1N5X A;  2NTT A;  5CHF A;  4KZ0 A;  2LUE A;  3EFU A;  2ZZF A;  5AZG A;  4IDI A;  1T6B X;  2LRW A;  2GI9 A;  3I5J C;  1LQB A;  3ZW7 A;  3B0A A;  2IUU A;  1ZUD 2;  2H88 B;  3ZWK A;  4ITK A;  3CSF A;  3V61 A;  4RGO S;  1X1M A;  1DOY A;  2JWU A;  4A20 A;  1YX5 B;  3HK0 A;  3VRB B;  4AJW A;  2MCN B;  4FHK A;  3PRM B;  4E5Z A;  2IGH A;  4W9F A;  2X8X X;  3CMM B;  3IFW B;  1MVK A;  3LYY A;  4NJC A;  1DOX A;  4KDI C;  1QLB B;  5E6N A;  1IYF A;  3QAR A;  3RNB C;  3AEC B;  5AEK B;  4B9K A;  4DXG A;  3KVF B;  4JWU C;  4B0E A;  2ACZ B;  2HJ8 A;  1SBB B;  2V4L A;  1P7E A;  3H9D A;  4MEL A;  4LLG M;  1ROE A;  2DLB A;  3DBR I;  3C8Y A;  1YQ3 B;  4KDL B;  3ECI A;  3TUO A;  2L32 A;  4I6N B;  3PGE A;  3IBE A;  1ENF A;  4CYE A;  2WX1 A;  3B9J A;  1NEK B;  1SEB D;  2BS2 B;  1KOT A;  1KH0 A;  4YT0 B;  4A8X C;  5IP4 D;  3KWV A;  2B76 B;  3U30 A;  3A1Q B;  2BGF A;  5EDS A;  2AL6 A;  3UQA A;  4PS7 A;  2ONQ A;  2BB6 A;  3VHT C;  2RDG A;  1C9F A;  2IDY A;  4ANU A;  1E10 A;  3P4Q B;  3Q3O C;  1JWB D;  1I7H A;  2AL3 A;  1T0S C;  1WXO A;  2HTM E;  1ZGU B;  3RD2 A;  3EA6 A;  1HQR D;  2DYB A;  1HXY D;  1HE8 A;  1WZC A;  3PZ8 A;  3M95 A;  1YMH E;  1P7F A;  4HRO A;  2RPV A;  4O1N A;  4RM8 A;  1NYQ A;  1YJ1 A;  4L1B A;  1JCK B;  1JRP A;  1SIF A;  4TKN A;  2OED A;  4ANV A;  2O6V B;  3AU5 A;  3WCQ A;  4B0M A;  1STE A;  4G0N B;  2XK5 B;  3AN1 A;  4HDO A;  4L23 A;  2JUO A;  3EGR A;  2ZZE A;  2QIE B;  2DYM A;  2K8B A;  2M0A A;  3QK0 A;  2O6V A;  4M0W A;  4XYC A;  3VR9 B;  1WGK A;  3HHM A;  3Q8A A;  1RWS A;  3N1Y C;  5EE1 A;  1FD6 A;  4FA6 A;  1YIW A;  4WWO A;  3ZUN A;  4RCO A;  2JZ3 B;  3TJP A;  1PGX A;  2L52 A;  3MJW A;  2BKR B;  2KJ6 A;  4H2A A;  1YN5 A;  2MSE D;  4FLH A;  2JYT A;  4RFB A;  2JX5 A;  1GG3 A;  2KC1 A;  2MW5 A;  3N9Y C;  2GBN A;  4TSS A;  5D7G A;  1WWT A;  1WYG A;  3KW5 B;  1GB4 A;  4FHJ A;  4DDG D;  1WFY A;  1IGC A;  2AYO B;  3ZNG C;  1L4D B;  2ON8 A;  3MP9 A;  2MP2 A;  3QC8 B;  3ZQ4 A;  4NZL B;  1NI3 A;  1WGD A;  2KMM A;  1IP9 A;  2KJH B;  4ARE A;  1ET9 A;  1I4R A;  4J6I A;  2GBR A;  2M4N A;  4NQK E;  3BYT B;  3Q69 A;  1NEN B;  3EC8 A;  4QAY A;  4WJQ A;  1EWC A;  2BYV E;  4RF1 A;  5EE0 A;  1RLF A;  2LGX A;  1RM6 C;  4GGQ A;  3V6E B;  4E3C A;  4NQL B;  4FAD A;  4OVV A;  2N0S B;  1V8C A;  4XR0 A;  1IGD A;  4MGY E;  1QIL A;  2WXJ A;  4G11 A;  2KFK B;  3KUD B;  4W9C A;  2M19 A;  3T3N A;  1WH3 A;  4JL9 A;  1IBX B;  5D94 A;  2BKF A;  1TZO A;  2HD5 B;  3MC9 A;  3A4S C;  4A0A A;  1JRO A;  1WMH B;  2ZEQ A;  1HZ5 A;  3AE9 B;  2WDV B;  3TIX A;  3TEX A;  1ZDX A;  2WNM A;  4W9K A;  2V3P A;  4A11 A;  5MPO A;  3HM6 X;  1RFA A;  4C80 A;  4DBG A;  1WMH A;  3EI2 A;  4KKI A;  1XLQ A;  1L4Z B;  3I8E A;  2MBH A;  1AYF A;  3GE3 C;  1C4C A;  2MHJ A;  4OHJ A;  3MTN B;  4PYU A;  3W1Y A;  2ZJD A;  2HYE A;  3RNE C;  2SAK A;  1K53 A;  2I05 A;  1G6J A;  2JYE A;  4C00 A;  2LJ5 A;  2OOB B;  3N1Z C;  1C1Y B;  4GLS C;  3OAW A;  5FKA C;  3VRA B;  5C1Z A;  2I2Y A;  2L05 A;  5T8I A;  3ZNI D;  1AN8 A;  3AE1 B;  4DDI D;  4MSQ B;  2RSU A;  3ZW3 A;  2IO0 B;  2NPT B;  3SDL C;  2JT4 B;  3QAQ A;  2LXC A;  2KLG A;  2NTS A;  3D32 A;  1XEE A;  2W82 A;  4W9G A;  2G4S A;  1KFY B;  3BVZ A;  1I42 A;  3AE5 B;  4JGH B;  3OJ3 A;  4IW0 A;  1YD8 U;  4KGT A;  3AU4 A;  3OLM D;  3P1M A;  3X23 A;  3M63 B;  5HKH A;  2KMC A;  5D3I B;  1V86 A;  1FPY A;  4LJP B;  3EI4 A;  2MH7 A;  2C7H A;  5JHA A;  1BML C;  4JE3 B;  1Y8R C;  4M02 A;  4JPS A;  2KWU B;  3IT4 B;  1NDD A;  3U8Z A;  1UWM A;  1I4P A;  4HPM B;  3PHX B;  2ZVO A;  1RAX A;  3Q3J A;  2IO2 B;  2N9L A;  1E8X A;  2RGF A;  4RGM A;  2J4X A;  1JW9 D;  4Q2J A;  2KDF B;  2VH2 A;  2ZW0 A;  2MBE A;  5D3D A;  2WXM A;  4XWT A;  2DBY A;  2NVU I;  3ZJV A;  1SSN A;  2BS3 B;  1WY8 A;  4HCP B;  4XR2 A;  3KEW A;  3NOB A;  4PYZ A;  4ANX A;  1GAQ B;  3PS6 A;  3SU8 X;  5JXV A;  3JYU A;  1CQV A;  1XCT L;  3VXW A;  1I4G A;  3L13 A;  3RZF A;  1T0R C;  2N1V A;  4A90 A;  3APD A;  2N7E A;  3A4R A;  2LGY A;  5TR5 A;  3OJ4 B;  5FK9 C;  1WR1 A;  1T0Q C;  3L10 B;  4FUL A;  3NY5 A;  2LEK A;  5TSS A;  3EHV A;  4RGT A;  4HVB A;  4L2Y A;  1UD7 A;  2IY0 B;  3B08 A;  2RR9 A;  3TBL D;  4XE0 A;  3I7H A;  1I4H A;  3I3T B;  3RNG C;  3TEZ A;  3V3X A;  3DQV A;  3ZJU A;  4RM9 A;  4ZRQ A;  3Q8B A;  1YQ4 B;  4XX5 A;  4RH6 A;  3EUB 2;  3GZN B;  2I1K A;  2OJR A;  4ACF A;  4E71 A;  3R3M A;  1F0Z A;  2N4F A;  4IM2 A;  4F1S A;  1HA5 A;  2IGD A;  4A09 A;  4ZRJ A;  1HZ6 A;  4FN2 A;  2HJ1 A;  1FFV A;  3P4P B;  2BYE A;  4BKT A;  1ESF A;  4NJ6 A;  2LGD A;  4XDC A;  4TQ1 A;  1LGR A;  1VRA B;  2Q5W D;  2D2Q A;  2AX5 A;  2MQJ A;  1ZP0 B;  3KYD D;  2BT6 A;  3O65 B;  4II2 B;  1ECR A;  4GB9 A;  4RF0 A;  2RDB C;  3J9C A;  2G4D B;  1VDV A;  2G45 B;  1FCL A;  1TBE A;  2VH1 A;  3DDC B;  4HDQ A;  2IZV B;  4HPP A;  3Q8E A;  2DZJ A;  3SFD B;  1VZ6 A;  1MG4 A;  1J0G A;  4R3D A;  3U7D A;  2KDM A;  2HTH A;  1I35 A;  2K8C A;  4HJG E;  4DHZ B;  3ZX5 A;  1R4N I;  1WX8 A;  1ZXI A;  2J0M A;  2BW2 A;  4W9L A;  1UF0 A;  4PS3 A;  2R61 A;  3C0R B;  2WX0 A;  2GMI C;  2L0T A;  3Q8C A;  4DHJ D;  3AE6 B;  4W9D A;  1WGH A;  2WLB A;  4MGI E;  2WXF A;  5BO4 B;  3ETR A;  2N9X A;  3K9O B;  2PVO D;  2KVR A;  2ZW1 A;  2AWT A;  3W1S A;  3GZN I;  1L6U A;  3ZWD A;  1KLU D;  4NAW A;  2J7Q B;  3DVN V;  3EFC A;  3RYT A;  2WP9 B;  2L00 B;  1FCC C;  2PW9 A;  3AEB B;  2CR5 A;  2EWJ A;  3VUW A;  1QOA A;  2G1E A;  2FCN A;  2O2V B;  2LD9 A;  3ABV B;  2C60 A;  2JPH A;  3SEB A;  2ZCB A;  4N58 A;  4P6V F;  4ARC A;  2OJW A;  3ZKJ C;  3I89 A;  1Q1O A;  4RGN A;  4M8N A;  3AE8 B;  3R2I A;  5GMV A;  2DZM A;  1E9M A;  3GOE A;  1F52 A;  3SR6 A;  2JF5 A;  2LAS A;  4NNJ B;  1DYQ A;  1EO6 A;  4KV2 A;  2WXI A;  1SIJ A;  2D5G A;  2O2V A;  4OZC A;  2KTR B;  1Z2M A;  2KXJ A;  3U4E G;  5EE9 A;  4BBN F;  4AS1 A;  1MPE A;  2BWE S;  1MG8 A;  3H7S A;  2YEP B;  1GUA B;  1DGJ A;  3I7O A;  3CST A;  3KWL A;  4XR1 A;  3IVF A;  2LFI A;  2ZZP B;  2N7D A;  2IPK D;  4TQ0 A;  4RMA A;  1E7P B;  2KTR A;  2IJ0 A;  3VUY A;  1MHH E;  4A9A A;  4YTN B;  2PE6 B;  1WJ6 A;  3FKY A;  2CJN A;  4EKU A;  1VLB A;  5GXG B;  1WX9 A;  1KTK A;  1XQQ A;  4ZOH C;  3RT3 B;  4MM3 A;  1NBF C;  5C3J B;  3JW0 X;  3WAM A;  2V3S A;  4M00 A;  5AZF A;  4MJS A;  2M17 A;  4HLE A;  4YSX B;  2XN9 C;  4XR3 A;  5D6J B;  3AXC A;  3PLU A;  2K1F A;  1LXD A;  2Y5B B;  4WH4 A;  5IAA C;  3VVW B;  3RZW C;  4IC7 B;  2WHI A;  4OVZ A;  4LK0 M;  1WX7 A;  2AEH A;  3R2T A;  1J7B A;  3KUZ A;  1C4A A;  2MLB A;  3O13 A;  1E90 A;  4W9E A;  3DWG C;  3ZDM C;  1HTO A;  4XC2 A;  2VZK D;  1WJU A;  1LFD A;  4D2K A;  1ZKH A;  3EEC A;  3QHT A;  1JWS D;  2E3T A;  1QZE A;  1MI0 A;  3I63 C;  2Y3A A;  1F2R I;  3RCZ A;  1FFU A;  3WIM A;  4WWM A;  1ZPS A;  4REZ A;  1K50 A;  4HEA 1;  3QJZ A;  3KYC D;  5E6O A;  4WJN A;  1UUP A;  4TZ4 A;  4JQW C;  2KDB A;  1WM2 A;  2BS4 B;  4EZJ A;  1XO3 A;  4M0W B;  1V5O A;  3R7R A;  2ZNV C;  1QOF A;  3A9J A;  3LJ3 A;  3ZTY A;  4GIV A;  1FXT B;  2HE7 A;  3PRP B;  1FM0 D;  3NZU A;  1WXA A;  1PUT A;  1IPG A;  3P2B A;  2Z0E B;  3AEA B;  5IOI A;  2XNA C;  1J7C A;  2QIL A;  2DZI A;  1D4B A;  2KQ4 X;  3V62 A;  1PYW D;  1V80 A;  4YWG G;  2IO1 B;  2FCM A;  5I4D A;  4IWO A;  1WXS A;  2JU6 X;  3JSV B;  2MP2 B;  5E6J A;  2KN5 A;  1PFD A;  4ZRP A;  5HG2 A;  2ZCC A;  2DX5 B;  5FQD A;  4HRS A;  1WRI A;  3IAS 1;  1A5R A;  3HIZ A;  1YJJ A;  2DAF A;  2IUT A;  3TL5 A;  1TY2 A;  1YN4 A;  3P4R B;  3JSV A;  3ZLZ A;  5FR6 A;  2C7M B;  2PEA A;  1M4V A;  2KHW B;  1C79 A;  4KSL C;  2MEK A;  2Y6I A;  1WR6 E;  3CIR B;  1KLV A;  1A70 A;  1N61 A;  4K3B A;  3KH0 A;  3DVG Y;  3E9S A;  1AWD A;  1TKG A;  3PLV A;  2B5M A;  3ALB A;  4TV3 A;  3QX1 A;  2A5U A;  2JXX A;  2L76 A;  3L17 A;  3N1X C;  3Q6B A;  4YSY B;  4C4V A;  4EEW A;  2FUH B;  1OFF A;  3V6C B;  3FIL A;  2H89 B;  1JML A;  4LTU A;  3K9P B;  3GP7 A;  3H6N A;  3W9C B;  4I6P A;  4ARI A;  3PTF C;  3E0C A;  2IBI B;  3WA0 A;  5G5G A;  4CHK A;  2AQ1 B;  1WGG A;  5G5H A;  1Q10 A;  2DAJ A;  2R2O A;  3IT6 B;  3P4S B;  1WJN A;  3TEW A;  4PK1 A;  3DHG C;  1YN3 A;  1J7A A;  2WYQ A;  4N59 A;  3DBL B;  1K8R B;  4WWN A;  2WU5 B;  3DPD A;  1MJD A;  2EEL A;  2KWD A;  1E7V A;  2FCQ A;  4A3P A;  3N3K B;  3NS1 A;  4HJK A;  3SD5 A;  5BMH A;  1CK1 A;  3SHQ A;  1QT9 A;  3UIN B;  1MHX A;  2V0G A;  1FXA A;  3L4P A;  2TSS A;  4MGK E;  3NJT A;  3W2D A;  4AR9 A;  3H1U A;  4MSM B;  1V6E A;  2PE9 A;  2WXK A;  4HKQ A;  5LXI B;  1GC6 A;  2LJI A;  1WZ3 A;  1FO4 A;  4ASW C;  3ZTW A;  1U4A A;  1TKY A;  1PGB A;  2KX0 A;  3VDZ A;  1E5W A;  2N9E B;  3E56 A;  3X0W A;  4CI1 A;  2K6Q A;  2KN4 A;  2C9W B;  3VUX A;  1C76 A;  3ONS A;  3BVM A;  3RN9 C;  4C7Y A;  2VZK B;  2CKH B;  2K39 A;  2WXP A;  1WXQ A;  3V05 A;  4KZC A;  1UNS A;  4LDT D;  2JRH A;  3AV8 A;  3NVZ A;  3BK2 A;  3ZTD A;  3N20 C;  1HTQ A;  4ANW A;  4WJO A;  3AMZ A;  1S1Q B;  1OTR B;  4EOY A;  2GBM A;  2INC C;  1EM7 A;  4DQO C;  2K5P A;  2L83 A;  2QJL A;  3ZRF A;  4ZYS A;  2J42 A;  3HM3 A;  1WRD B;  2I38 A;  2L3Z A;  1V7O A;  3IHP C;  4I6L B;  1JWM D;  4AR1 A;  1KM7 A;  3JVZ X;  1JWU D;  1JWA D;  2BF8 B;  4NJ7 A;  4US9 A;  1QF6 A;  1E0Z A;  2L1A A;  4OZA A;  2FID A;  1GC7 A;  3ZIM A;  4FXC A;  4OW0 A;  4CO7 A;  4HCN B;  3QA8 A;  3UF8 A;  1VCB A;  1OGW A;  3QCA A;  3DCG A;  3PZ7 A;  5HFY A;  3URY A;  1ZOY B;  2CS4 A;  2Z59 B;  4KGS A;  1EU4 A;  2DEN B;  5LNK 1;  3HUI A;  3UIO B;  3KLS X;  4PS8 A;  1N62 A;  2PPH A;  3AEF B;  3WAN A;  1UEL A;  3MC8 A;  3RI7 C;  3VTW A;  1NI2 A;  3VH4 B;  2A4Z A;  1TJE A;  2QSD A;  4UDU C;  2N9P C;  1QQR A;  3AUL A;  2LHE A;  4XZ4 A;  2GBK A;  3I7P A;  3GB1 A;  4IOI E;  3L0W B;  2CHW A;  3IAM 1;  1V1O A;  1RFK A;  2N9K A;  1EF1 A;  3L08 A;  1FXI A;  4AWJ A;  1LM8 B;  1Q0W B;  3PZD A;  1MFW A;  2RPQ A;  1L2N A;  4DXF A;  3CF6 E;  2GLS A;  2WXN A;  1L7Y A;  2PLP A;  5LXH A;  4AQ7 A;  4MGZ E;  2KAC A;  4ZHO A;  1ZW7 A;  2KLC A;  3AE2 B;  4E74 A;  1FEH A;  1V4P A;  3NG0 A;  3NVY A;  4ICU A;  4PT5 A;  2L0F A;  4WQM A;  5CHW A;  4NPN A;  5AUK A;  4EUT A;  3CWI A;  3BVG A;  4X57 B;  3R8B A;  4IM3 A;  1V1P B;  1E8Z A;  1V49 A;  4FBJ B;  2KYW A;  3ZYY X;  4EZK A;  2DHZ A;  3VQI A;  4F8C B;  2VRR B;  3A33 B;  2EMT A;  2Z0D B;  2JRI B;  2KD0 A;  3DWM A;  1B1Z A;  4MH0 E;  2CU3 A;  3MJ5 A;  1H4R A;  4BVU C;  5KHQ A;  3KUC B;  1VR9 A;  1V1P A;  3W5U B;  2LZ6 A;  1H8C A;  3MFG A;  5HHD G;  1R4M B;  2RD0 A;  2KO3 A;  3MHS D;  1TKE A;  4TMA B;  3UIP B;  4LNO A;  2XBB C;  4YTP B;  2BYF A;  2JWZ A;  5J2R A;  1OQQ A;  2E6X A;  2QMT A;  4IM0 A;  2V3N A;  1XF5 L;  3B2F A;  4LNF A;  3RMK C;  3HVZ A;  3H7P B;  2K0P A;  4IWP A;  2QDF A;  1ET6 A;  3PPA A;  1GPX A;  3ML9 A;  3U7Z A;  1TS2 A;  2GB1 A;  2KWV B;  2BYT A;  4JWS C;  2MJD A;  4CI3 A;  2M1M A;  3RNC C;  3QIJ A;  1LO5 D;  2QC8 A;  3H7P A;  4WIP A;  1FNW A;  1UH6 A;  4BKG A;  4G3X B;  4K3C A;  1OQR A;  3R7Q A;  2FNJ B;  1SXT A;  3Q8F A;  3RUL A;  1M94 A;  3GS2 A;  3T8M A;  3ZJT A;  1YQB A;  2BVC A;  4NAW B;  2NBU A;  1TGZ B;  1YJI A;  1WI0 A;  5AUI A;  2LGS A;  4AJY B;  4A55 A;  2WXQ A;  1GB1 A;  2AQ2 B;  4KGR A;  1P9D U;  4BOS C;  2LHD A;  1V81 A;  4P1B C;  3PV1 A;  2K3U A;  1P0R A;  5J17 A;  2ASQ A;  3R66 C;  5C2T B;  2LMC A;  4S0R A;  5BYQ A;  1XXG A;  1JAL A;  2J0J A;  4HPL B;  2D07 B;  1WGR A;  3AE3 B;  3BK1 A;  2CU1 A;  2R2Q A;  2IYD B;  3APF A;  2B3A A;  1C3T A;  4USA A;  1R4M I;  4N9F 4;  2WU2 B;  1EF5 A;  4KX6 B;  1XD3 B;  4GN1 A;  2RMM A;  1VZ8 A;  5BYR A;  1SE4 A;  1R7S A;  2K8H A;  1XCQ L;  1B9R A;  1WXM A;  2WXL A;  4FJZ A;  1TY0 A;  4KSK C;  5JH5 C;  3LXF A;  3P63 A;  3UI3 A;  1UGM A;  5BMI A;  4K1R B;  1IUE A;  2C7N B;  1NYR A;  2JXT A;  4YTM B;  3UQB A;  4MM3 B;  3ZX4 A;  2AQ3 B;  1EU3 A;  2YLM A;  2PVG C;  4K7S A;  1V97 A;  4LNI A;  3VH3 B;  1P1A A;  3TEY A;  1TS3 A;  4HWI B;  3AB5 A;  4MJS B;  5BMG A;  3Q3N C;  1FNU A;  1D5M C;  5JZE B;  4WJP A;  2WDR B;  2Y5P A;  3NUH B;  2KDE B;  3PHW B;  1F1H A;  2WDT B;  2W55 A;  1WF9 A;  2MA9 B;  3DHI C;  1P98 A;  1UGJ A;  4IKG A;  2C5L C;  1KF6 B;  4JX1 C;  2SEB D;  1E7U A;  3IG3 A;  3SFE B;  4P1C C;  1ZDV A;  3RPF C;  3ZNH B;  3RNA C;  3DHH C;  3M3J A;  4IUM B;  1EWY C;  5C23 A;  1T5X D;  4MAC A;  1OEY J;  5H92 C;  2W3R A;  4C7Z A;  2YEP F;  3UGB B;  3PT2 B;  1K52 A;  3OWE B;  2EMS A;  2XEW A;  4G50 A;  3H8H A;  4K7W A;  2OHF A;  5CTR C;  1SE9 A;  4LCD E;  3AEG B;  2FIF A;  3A9J B;  1E8Y A;  5DCN A;  5HI1 A;  3NVV A;  4N6E B;  1AAR A;  2BB5 A;  4MDK E;  3TMP B;  2NBW B;  2KQS A;  2ZVN A;  4LNK A;  5L83 A;  3ZUP A;  2MBQ A;  1ZXH A;  4MT5 A;  2LUM A;  2IY1 B;  4NY0 A;  2IO3 B;  1N60 A;  3ZNZ B;  1WGY A;  4A3O A;  4HK2 A;  3A1Q A;  1TT5 B;  1N5W A;  2WXR A;  5FR3 A;  3ZGZ A;  2EKE C;  2G3Q B;  1QOG A;  3OG5 A;  2DWQ A;  2QCZ A;  1L5P A;  2IND C;  3PO0 A;  2KQ7 A;  1Y56 A;  2D3C A;  4ZRI A;  2WS3 B;  1VD2 A;  1JRU A;  3NZ3 A;  1UZX B;  4EZL A;  5L95 C;  2V1Y A;  5DPS A;  1GJZ A;  2LXA A;  4A0B A;  4TUU A;  4WAA A;  2D11 A;  2INP E;  1V2Y A;  4P7I A;  4ICV A;  4HKZ E;  4CQN A;  3I7L A;  2FCS A;  4J3O D;  2PTL A;  5JHB A;  2J53 A;  3NVW A;  1C77 A;  2WDQ B;  3Q3F A;  4DHJ B;  1AW7 A;  2LWP A;  4P16 A;  2YVC A;  2XK5 A;  2MX2 A;  4CI2 A;  2IUS A;  2CHZ A;  3NRZ A;  2DYO A;  2M8S A;  3PRE A;  2M56 B;  3BII D;  3I9V 1;  1SJE D;  1ISN A;  4C4V B;  4BOZ B;  2PIA A;  1YOV B;  1XT9 B;  1DOI A;  3FIL B;  2CHX A;  3I7N A;  2DZK A;  4OZB A;  2KAN A;  1T0Y A;  2MWS B;  2KNB A;  5H8Y E;  4C56 C;  1WM3 A;  1TS4 A;  1F77 A;  1P3Q U;  2KKC A;  3LDZ E;  5IN7 A;  4E54 A;  1QKZ A;  2JQR B;  3VAW A;  3V60 A;  1SE3 A;  2Z8L A;  1V9J A;  3M62 B;  3EI1 A;  3DVN U;  1E8W A; 
#chains in the Genus database with same CATH homology
 1YQ3 B;  3BYY B;  1FCL A;  2EKI A;  3PZ7 A;  3TUO A;  5HFY A;  3URY A;  1GOZ A;  2L32 A;  1SF0 A;  1ZOY B;  1BXT A;  1K51 A;  2N7J A;  4KGS A;  1ENF A;  1EU4 A;  3B9J A;  1NEK B;  3Q8E A;  3SFD B;  5LNK 1;  1SEB D;  2BS2 B;  1VZ6 A;  1KH0 A;  4YT0 B;  3HUI A;  4R3D A;  4A8X C;  2KDM A;  3KLS X;  1SB3 C;  2Y5C A;  2NMQ A;  4XDD A;  1N62 A;  3AEF B;  3KWV A;  2B76 B;  4HJG E;  4AR8 A;  1ZXI A;  2BW2 A;  2FBW B;  2ONQ A;  2R61 A;  1TJE A;  2BB6 A;  2QSD A;  2RDG A;  4UDU C;  2IDY A;  1C9F A;  1E10 A;  1QQR A;  3P4Q B;  4XWW A;  2QEJ C;  2LHE A;  3RFZ B;  1JWB D;  1I7H A;  1WXO A;  2HTM E;  1NVI D;  3Q8C A;  3I7P A;  3AE6 B;  3GB1 A;  4IOI E;  2WLB A;  2G9H D;  2J52 A;  2WXF A;  3FAH A;  3IAM 1;  1V1O A;  3EA6 A;  3ETR A;  1HQR D;  1RFK A;  2N9K A;  1HXY D;  3PZ8 A;  1FXI A;  1YMH E;  1P7F A;  2PVO D;  4HRO A;  2ZW1 A;  3W1S A;  3EI3 A;  3MHZ A;  3BWU D;  3T3O A;  2RPV A;  4DXF A;  4O1N A;  1L6U A;  2WXN A;  2PLP A;  3AM9 A;  2I06 A;  3WQZ A;  1KLU D;  2GRI A;  1NYQ A;  3IXS A;  4AQ7 A;  2KAC A;  2X38 A;  3TSS A;  4ZHO A;  4L1B A;  1JCK B;  1JRP A;  1L0X B;  2OED A;  3AE2 B;  2WP9 B;  4GDK B;  1FEH A;  3I7K A;  1V4P A;  3NVY A;  1FCC C;  2PW9 A;  3AEB B;  2WXH A;  4PT5 A;  1IBX A;  2EWJ A;  1QOA A;  2G1E A;  4WQM A;  2E1B A;  3WCQ A;  4B0M A;  5AUK A;  1STE A;  3ABV B;  3AN1 A;  4L23 A;  3SEB A;  3CWI A;  1FMA D;  4P6V F;  4N58 A;  3EGR A;  4ARC A;  2QIE B;  3BVG A;  2ZZE A;  3R8B A;  1V1P B;  2WQY B;  2DYM A;  3I89 A;  3ZYY X;  2M0A A;  4M0W A;  4RGN A;  3VR9 B;  1WGK A;  3AE8 B;  3VQI A;  3R2I A;  5EE3 A;  1E9M A;  1JQ4 A;  1HEZ E;  2IGG A;  1E6E B;  3SR6 A;  2W54 A;  1DYQ A;  3Q8A A;  1RWS A;  3DWM A;  1B1Z A;  2WXI A;  1SIJ A;  2D5G A;  1D5Z C;  4OZC A;  5EE1 A;  3U4E G;  3W5V B;  1FD6 A;  5EE9 A;  2CU3 A;  4KKJ A;  3MJ5 A;  4GDL B;  4AS1 A;  1MPE A;  1VR9 A;  4RCO A;  1V1P A;  2YEP B;  3B2G A;  3W5U B;  1PGX A;  1KRH A;  1DGJ A;  2L52 A;  3I7O A;  1XLO A;  3KWL A;  4XR1 A;  4H2A A;  1YN5 A;  3MFG A;  2LFI A;  5HHD G;  4WAF A;  2JYT A;  2IPK D;  1XLN A;  4RFB A;  4TQ0 A;  2JX5 A;  3BZD B;  3N9Y C;  4TSS A;  1E7P B;  1QOB A;  2IJ0 A;  5D7G A;  1MHH E;  1WWT A;  1TKE A;  4A9A A;  4YTN B;  4TMA B;  1WYG A;  2CJN A;  4YTP B;  1VLB A;  5GXG B;  1GB4 A;  1YNT E;  1KTK A;  4ZOH C;  1OQQ A;  2E6X A;  2QMT A;  1SJH D;  2V3N A;  5C3J B;  1IGC A;  1XF5 L;  3B2F A;  1L4D B;  2ON8 A;  3MP9 A;  3HVZ A;  3AE4 B;  2K0P A;  2ZTG A;  3ZQ4 A;  3RHU A;  2INN E;  4NZL B;  1NI3 A;  2KMM A;  1ET6 A;  4ARE A;  4US8 A;  1GPX A;  1ET9 A;  1I4R A;  3U7Z A;  1L6V A;  4YSX B;  3AED B;  1TS2 A;  1BUI C;  2XN9 C;  4XR3 A;  1RYJ A;  2GB1 A;  3AEE B;  3BYT B;  2BYT A;  2FE8 A;  4JWS C;  2MJD A;  3Q69 A;  1NEN B;  4WH4 A;  2PMV A;  2V4I B;  4YSZ B;  4CI3 A;  1TYG B;  1EWC A;  3MC0 B;  4OVZ A;  4LK0 M;  3R2T A;  2HDE A;  1J7B A;  1SE2 A;  4RF1 A;  1LO5 D;  1C4A A;  3O13 A;  4WIP A;  5EE0 A;  3LB8 C;  3DWG C;  1FNW A;  1RM6 C;  3P42 A;  1VZ7 A;  1OQR A;  2N0S B;  1SXT A;  3Q8F A;  4YXD B;  2VZK D;  1V8C A;  2CJO A;  2WXG A;  4XR0 A;  3GS2 A;  3ZJT A;  1PDX A;  3KQ4 A;  4D2K A;  1IGD A;  4NAW B;  1QIL A;  4ZHP A;  2WXJ A;  1JWS D;  2E3T A;  1YJI A;  1MI0 A;  2WXO A;  2M19 A;  3T3N A;  5AUI A;  2Y3A A;  1F2R I;  1C4P A;  4A55 A;  1IBX B;  2WXQ A;  1D5X C;  1FFU A;  3U2S C;  1GB1 A;  2RDH A;  2ZZG A;  1TZO A;  1F2R C;  2AQ2 B;  4A0A A;  4KGR A;  4WWM A;  1ZPS A;  4REZ A;  1JRO A;  1UWX A;  1K50 A;  2LHD A;  4HEA 1;  2K3U A;  1HZ5 A;  3I57 A;  1N63 A;  3AE9 B;  1UUP A;  4TZ4 A;  2WDV B;  3TEX A;  5C2T B;  1CJE A;  2LMC A;  5BYQ A;  1XXG A;  1ZDX A;  2BS4 B;  1JAL A;  1XO3 A;  1ZE3 D;  1QOF A;  2WNM A;  3AE3 B;  3BK1 A;  2V3P A;  4A11 A;  5MPO A;  1C78 A;  4C80 A;  4USA A;  1FM0 D;  1WSP A;  1KLG D;  2WU2 B;  3EI2 A;  4NAM A;  1FIQ A;  4A6Q A;  4KKI A;  1PUT A;  1XLQ A;  1L4Z B;  4KX6 B;  3HVD A;  3I8E A;  3AEA B;  2XNA C;  2RMM A;  1FRD A;  1AYF A;  1J7C A;  1VZ8 A;  5BYR A;  1TS5 A;  2QIL A;  2JZP A;  3AE7 B;  1SE4 A;  2K22 A;  1D4B A;  1C4C A;  1R7S A;  4OHJ A;  3I8C A;  2KQ4 X;  2Y3U A;  1XCQ L;  2HYE A;  3U52 E;  2SAK A;  1K53 A;  1B9R A;  2WXL A;  2I05 A;  1TY0 A;  2JYE A;  3LXF A;  3P63 A;  3UI3 A;  5BMI A;  1PYW D;  1IUE A;  2JSV X;  1NYR A;  4GLS C;  4YWG G;  2JXT A;  5FKA C;  3VRA B;  2Y50 A;  1I4Q A;  1WNU A;  4YTM B;  3RFN A;  2K9X A;  5I4D A;  4MM3 B;  2AQ3 B;  1EU3 A;  1I4X A;  2JU6 X;  2PVG C;  2I2Y A;  5E6J A;  1PFD A;  1V97 A;  4ZRP A;  5HG2 A;  5T8I A;  1VJK A;  5FQD A;  1AN8 A;  3TEY A;  2BTE A;  4HRS A;  1TS3 A;  3AE1 B;  4EE2 A;  1WRI A;  3AB5 A;  5BMG A;  3IAS 1;  1FNU A;  1YJJ A;  2IUT A;  1D5M C;  2WDR B;  1TY2 A;  2NTS A;  1T3Q A;  1D6E C;  1XEE A;  1YN4 A;  2W82 A;  3P4R B;  2Y5P A;  3NUH B;  1L0Y B;  1KFY B;  2W55 A;  3BVZ A;  3AE5 B;  1M4V A;  1C79 A;  2MEK A;  2Y6I A;  4KGT A;  1UGJ A;  3CIR B;  1A70 A;  4IKG A;  3VR8 B;  1N61 A;  3P1M A;  3E9S A;  1KF6 B;  2ICI A;  1AWD A;  1TKG A;  2SEB D;  4JX1 C;  2B5M A;  3SFE B;  5D3I B;  2BBC A;  1ZDV A;  4YSY B;  3RPF C;  1OFF A;  2MH7 A;  3EI4 A;  1XLP A;  3FIL A;  4WUR A;  2H89 B;  1BML C;  1EWY C;  1JML A;  4JE3 B;  4LTU A;  4JPS A;  1T5X D;  3GP7 A;  4MAC A;  3W9C B;  5H92 C;  2W3R A;  4ARI A;  3IT4 B;  1UWM A;  4C7Z A;  1I4P A;  3E0C A;  2YEP F;  1FNV A;  4RNA A;  5G5G A;  3AH7 A;  1K52 A;  2MJE A;  3OWE B;  2N9L A;  2AQ1 B;  1CZP A;  5G5H A;  2W3S A;  4RGM A;  2J4X A;  3H8H A;  1JW9 D;  1Q10 A;  4Q2J A;  2OHF A;  3IT6 B;  1L0V B;  4A08 A;  1ACC A;  2ZW0 A;  3P4S B;  3AEG B;  3TEW A;  5D3D A;  5HI1 A;  2WXM A;  3NVV A;  4XWT A;  1YN3 A;  4ARF A;  4N6E B;  1J7A A;  2BB5 A;  2DBY A;  2PKO A;  4N59 A;  3ZJV A;  1SSN A;  2BS3 B;  2WU5 B;  4MH8 A;  1ZXH A;  4MT5 A;  2EEL A;  2LUM A;  1PGA A;  3HRD D;  2KWD A;  4XR2 A;  3KEW A;  1GAQ B;  1N60 A;  2LGI A;  3NS1 A;  5JXV A;  3C8Y A;  5BMH A;  1CK1 A;  1CQV A;  1QT9 A;  1XCT L;  1MHX A;  2V0G A;  2MJ3 A;  2B5L A;  1FXA A;  3L4P A;  2TSS A;  1I4G A;  3W2D A;  1N5W A;  2WXR A;  1FRR A;  5FR3 A;  4AR9 A;  2KAJ A;  3ZGZ A;  4A90 A;  5BYS A;  2FUG 1;  2WXK A;  3FC4 A;  1N5X A;  1QOG A;  4HKQ A;  2DWQ A;  5FK9 C;  2NTT A;  1L5P A;  2LJI A;  3PO0 A;  1Y56 A;  1FO4 A;  2ZZF A;  2LEK A;  5TSS A;  4IDI A;  2WS3 B;  1TKY A;  4RGT A;  1T6B X;  1PGB A;  3NZ3 A;  4L2Y A;  2GI9 A;  3E56 A;  2IUU A;  4A0B A;  4XE0 A;  4CI1 A;  1ZUD 2;  3I7H A;  1I4H A;  2KN4 A;  2H88 B;  2INP E;  1C76 A;  4ITK A;  3BVM A;  3TEZ A;  4RGO S;  3V3X A;  4HKZ E;  4CQN A;  4C7Y A;  1DOY A;  3I7L A;  2VZK B;  3ZJU A;  2JWU A;  4J3O D;  4ZRQ A;  2PTL A;  3Q8B A;  2J53 A;  1WXQ A;  1YQ4 B;  2WXP A;  3V05 A;  3NVW A;  3VRB B;  1C77 A;  4RH6 A;  3EUB 2;  1UNS A;  2WDQ B;  1AW7 A;  3AV8 A;  3NVZ A;  3BK2 A;  4P16 A;  4E5Z A;  2IGH A;  1F0Z A;  4CI2 A;  2IUS A;  1HA5 A;  1MVK A;  3AMZ A;  3LYY A;  3NRZ A;  4NJC A;  2DYO A;  2IGD A;  1DOX A;  1QLB B;  2M56 B;  4A09 A;  3BII D;  3I9V 1;  1SJE D;  1EM7 A;  4DQO C;  2PIA A;  2K5P A;  2L83 A;  1DOI A;  1HZ6 A;  3FIL B;  2QJL A;  1FFV A;  3P4P B;  3I7N A;  4OZB A;  1ESF A;  4ZYS A;  2J42 A;  4XDC A;  4TQ1 A;  3AEC B;  5H8Y E;  4C56 C;  1VRA B;  2Q5W D;  1TS4 A;  1F77 A;  2I38 A;  4DXG A;  1V7O A;  4JWU C;  2AX5 A;  4B0E A;  2ACZ B;  1ZP0 B;  1JWM D;  4AR1 A;  2BT6 A;  1ECR A;  1SBB B;  4RF0 A;  1JWU D;  4E54 A;  1QKZ A;  1JWA D;  2JQR B;  1E0Z A;  3J9C A;  4US9 A;  1QF6 A;  2L1A A;  4OZA A;  1P7E A;  1SE3 A;  2Z8L A;  4LLG M;  1ROE A;  4FXC A;  3EI1 A;  2DLB A;  4OW0 A;  1VDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...