1TJEA

Crystal structure of the editing domain of threonyl-trna synthetase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonyl-tRNA synthetase
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tjeA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tjeA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tjeA02
3AH7A 1FFVA 2CJOA 3CWIA 1DOIA 3AM9A 1XLOA 2DWQA 2ACZB 1KFYB 3AB5A 2ZZGA 1AYFA 1L5PA 3HRDD 3AEFB 3P4RB 1FRDA 1JROA 5EE3A 4YSXB 1WYGA 2B76B 3SR6A 1EWYC 3ETRA 2ZZFA 1FIQA 2WS3B 1QT9A 3RFNA 1YJJA 1V4PA 3AE5B 4US8A 4A9AA 3WCQA 1RFKA 3NVWA 4HROA 4HRSA 3RPFC 1SB3C 2H88B 2PVOD 4YT0B 4YSYB 4JWSC 3VR8B 1R7SA 3VR9B 1RM6C 1N61A 1ZP0B 1ZUD2 3FAHA 2BT6A 3B2FA 2N0SB 2M56B 2PIAA 1ROEA 2KAJA 2K5PA 3AE7B 4WWMA 2E1BA 1DGJA 3SFEB 1E9MA 3AE2B 1E7PB 1WRIA 2CU3A 1NI3A 1QLBB 1OFFA 1V8CA 2WDQB 3AE4B 5GXGB 2QJLA 3AE6B 3LB8C 1WXOA 1TKEA 2WP9B 3NRZA 2LEKA 3AEEB 2PKOA 2ZZEA 1CJEA 2FBWB 5C2TB 2BS3B 2MJ3A 2L83A 3W5VB 5C3JB 1FFUA 5G5HA 1N63A 1DOYA 1ZOYB 1YQ4B 1QOGA 2PVGC 2E3TA 3B2GA 1WXQA 3AECB 4N58A 4P6VF 1OQRA 1I7HA 2W55A 3AE3B 5AUIA 1NVID 2OHFA 1N62A 1JWBD 1RWSA 1J7AA 4FXCA 1QOBA 1FMAD 1N5XA 1JRPA 1QOAA 3AE1B 1NYRA 1E6EB 1L6UA 2KMMA 2W54A 2EKIA 2JX5A 3AEGB 1XLQA 4YSZB 2MH7A 4YXDB 1TYGB 1F0ZA 3CIRB 3P63A 4ZHPA 1PFDA 2WLBA 3BIID 1XLPA 3VRAB 1XO3A 4ITKA 3VRBB 1TKGA 3AE9B 1ZXIA 3AV8A 1VJKA 5EE9A 2ZTGA 3AEBB 1IUEA 1KRHA 1RYJA 2QIEB 1J7BA 1PDXA 4IDIA 3P4QB 1QF6A 5MPOA 1FM0D 1YQ3B 1B9RA 3ZYYX 2WQYB 2JQRB 1NYQA 4KX6B 3NVYA 1A70A 1WWTA 1NENB 2L52A 1NEKB 4WQMA 1DOXA 4N59A 1T3QA 1FO4A 3RHUA 2W3RA 3KWLA 3SFDB 5H92C 3P4SB 3AN1A 1JWAD 1SIJA 2WU2B 1OQQA 4YTPB 3ABVB 5H8YE 4USAA 3P4PB 3AE8B 2H89B 5G5GA 3P1MA 4US9A 4YTNB 4ZHOA 1TKYA 1VDVA 2MJDA 3FC4A 4N6EB 3EUB2 3AEDB 2MJEA 1SF0A 3DWMA 2BS4B 2K22A 2W3SA 4C7YA 2K9XA 4YTMB 2DBYA 1JALA 1KF6B 3B9JA 3W5UB 1UWMA 5EE0A 4LTUA 1AWDA 1WNUA 5AUKA 1J7CA 1JW9D 3AMZA 1E0ZA 1L0VB 2HTME 1V97A 2CJNA 1FRRA 2G1EA 2Y5CA 4ZOHC 1PUTA 5EE1A 1L6VA 1E10A 1N60A 2AX5A 2WDRB 3L4PA 3NVVA 1JQ4A 1V7OA 3AEAB 2M19A 1GAQB 1FXAA 4JX1C 1WGKA 1CZPA 1TJEA 1YJIA 3HVZA 3LXFA 3NVZA 3WQZA 2WDVB 2BS2B 3DWGC 3NS1A 3W9CB 4C80A 3PO0A 1XLNA 4C7ZA 3HUIA 3KEWA 1GPXA 1FXIA 1QOFA 2WU5B 1VLBA 1N5WA 2Q5WD 4JWUC
chains in the Genus database with same CATH superfamily
3LDZE 4WAFA 2LMCA 1FRDA 1YN4A 3PVLA 2I2YA 3BWUD 3U8ZA 2RMMA 4HEA1 3WCQA 4HRSA 1Z5SB 2IUSA 2GBKA 4AUQC 1RM6C 2KKCA 2KACA 3SFDB 3ZTWA 5BYRA 3PREA 4BAXA 3AE4B 3AE6B 2LEKA 4EZKA 2PKOA 5BMGA 2ZZEA 3ZXVA 1PQSA 4EE2A 5C3JB 5EDSA 2INPE 1N63A 2J0KA 1ZOYB 1SE4A 4PT5A 3DPDA 1QOGA 5HHDG 2J42A 3IG3A 3R3MA 3VH4B 4HLEA 1SEBD 1ENFA 1QOAA 3V62A 3VQIA 2KMMA 3QQ8B 4ZDVA 1TYGB 1YMHE 4W9DA 3RN9C 3X0WA 3K9OB 2Y5BB 4DHZE 1VJKA 1A5RA 2ZTGA 5IN7A 2XEWA 4TKNA 2I38A 2OJRA 2C9WB 3U7DA 3RNFC 4HDQA 4C4VA 4WQMA 1LXDA 1J0GA 2RPVA 1L7YA 1J19A 1UBQA 3AE8B 2C7NB 1OQYA 1M94A 3IFWB 2WGSA 3W5UB 3QA8A 4A6QA 2KD0A 2G4SA 3VTWA 4AREA 4BVUC 1N60A 3PPAA 4RF0A 1TJEA 1VR9A 2NTTA 4GXBA 2KQ7A 1S1QB 4NJCA 1MFWA 1BUIC 2Q5WD 4BKTA 1L2NA 3H1UA 2LRWA 4ICUA 1GNUA 2WXMA 4FLHA 2N7JA 3DHIC 1FNVA 3R7QA 4K7WA 3SR6A 2M17A 4F7ZA 5C1ZA 4WQOB 1LGRA 4FBJB 3KYCD 2BWES 5D7GA 1MG8A 2J52A 4MGIE 2N9KA 3NUHB 2FCQA 3MC0B 4YT0B 2G4DB 4E74A 1XF5L 4YSYB 5LLIA 1G6JA 2M8SA 5D3IB 1ZP0B 3WIMA 3HHMA 1WSPA 5HG2A 1XXGA 2ICIA 2Y3UA 1EWCA 2XK5A 3ZW3A 2MSED 4ASWC 4EUTA 4NJ7A 2KLGA 2ZVNA 2BW2A 2KOXA 3DQVA 4WAAA 4K7SA 1P98A 2KT7A 4BOZB 1WJUA 3Q3OC 2MBQA 3VAWA 2FCNA 1HQRD 4EZJA 3H9DA 3VRAB 3DVNU 3QHTA 1ZW7A 4M01A 4CI2A 4GDKB 1C1YB 2KZRA 2LFIA 3TSSA 3I89A 3ZTCA 3KUZA 4D2KA 1DOXA 4XR2A 4EFOA 1V1OA 2MRPA 3Q69A 2L1AA 2KNBA 1MPEA 5DPRA 3X23A 1F2RI 1HTOA 2KO3A 2KN4A 2WXHA 1KF6B 1J7CA 3UQAA 2HTME 5EE1A 4C4VB 4FHKA 4P1CC 3NVVA 3AEAB 2ZOSA 1GAQB 1BXTA 2FUHB 3NVZA 1XLNA 1CK1A 4F1SA 2DHZA 2A4ZA 3WAOA 5JH5C 3KEWA 2W54A 2D5GA 3ZUNA 1NDDA 4A0BA 3I57A 2ACZB 1HTQA 3LJ3A 1AYFA 3P2BA 2MP2A 1EM7A 2BGFA 2LHEA 2G3QB 2KYWA 2WXIA 2LI5A 1JWUD 3ZNZB 2KTRA 2KVRA 4LNOA 4XZ4A 2XNAC 3VR9B 1R7SA 3QJZA 1HE8A 3B2FA 3EFUA 2HE7A 3AI5A 4XR3A 2PTLA 1K52A 2KTFA 2LGXA 2MJ3A 2ZW1A 1TBEA 1E5WA 4S0RA 1OQRA 3A4RA 1JWSD 2BYVE 4NJ6A 2XK5B 2N7DA 1E6EB 1UD7A 4A90A 4DHJD 4ZRQA 2JX5A 2L76A 4LK0M 2K8HA 3NOBA 1TKGA 4OZAA 4S17A 4BFRA 3ZVVA 4ZYNA 2CHWA 2O2VB 2BF8B 3OLMD 3A1QA 4IDIA 3UIOB 3PT2B 5MPOA 3TEXA 2MLBA 1K51A 4RM8A 2HJ8A 2AL6A 2MBOA 1UGJA 1TS3A 1I42A 4WWNA 3IAM1 1VRAB 5H8YE 2MQJA 5G5GA 3VVWB 2N1WA 1OTRB 4C7YA 2K9XA 1V1PB 2AQ2B 3Q3FA 1WNUA 2J53A 1L0VB 4LNFA 2CJNA 3RNEC 1FCLA 3FKYA 1XT9B 2QMTA 2D3BA 1YJIA 3HVZA 3APFA 1E7VA 1FXIA 1QOFA 3CWIA 1YOVB 2C7HA 2IZVB 3EI3A 1YN5A 2YEPB 3GB1A 1GOZA 4IKGA 4GDLA 2KN5A 3ZWDA 2MEKA 4M8MA 4TV3A 1Q10A 2ZJDA 3VR8B 4NPNA 2WXRA 2FIFA 2TSSA 2IGHA 2KAJA 5JHBA 2E1BA 2MP2B 1SSNA 4ARIA 1WRIA 1L4DB 1NI3A 3M95A 2DAJA 2NBWB 4NQLB 3DBHI 3Q8BA 1T0YA 5C2TB 2N9XA 3QC8B 1TZ1A 3ONSA 3OG5A 1GUAB 2WXLA 3RNGC 5L83A 1WXQA 3KYDD 4KSLC 4LNNA 3V6EB 4DDID 3ZU6A 3TEZA 2HDEA 5AUIA 2CHXA 1RWSA 1FMAD 3VFKA 1L6UA 4KDLB 4NAMA 3RULA 4PS7A 2K0PA 3ZQ4A 3HVDA 1TT5B 3URYA 3TEWA 4GB9A 1IGDA 3PRPB 4WJPA 3NY5A 1FM0D 3B08A 4JLCA 3U7ZA 4GIVA 1SE2A 5LNK1 1WWTA 3I7LA 2MWSB 3MP9A 5FR3A 4M0WA 3KWLA 5C23A 1WH3A 4IWQA 3R2TA 1Z2MA 3N1ZC 4JIOU 5GMVA 3EUB2 3RNAC 3AEDB 2MJEA 3N9YC 4OVZA 2PMVA 1JRUA 1ZGUB 4OHJA 1XCQL 3A1QB 4G11A 1JMLA 1ESFA 3ML8A 3AMZA 2Y5CA 2IDYA 4RGTA 3DBRI 1L6VA 2ASQA 2M19A 3E56A 3RUIB 3LXFA 4II2B 4FULA 2BS2B 2I05A 2LGYA 4C7ZA 4YL8A 1VLBA 5IO9A 2CJOA 4MJSA 4P7IA 4DXGA 1SGHA 1YX6B 5J2RA 4KSKC 1L5PA 1EF5A 1KM7A 2JYTA 1Y56A 2VZKD 2LJ5A 1GJZA 2J4XA 4US8A 4IC7B 4WWOA 2MBHA 5CTRC 2IO2B 2H88B 1U4AA 3W2DA 4KGSA 3Q6BA 2BTEA 1WJ4A 3U4EG 3BYYB 1ROEA 2A5UA 1V5TA 1WR1A 4E71A 4OZBA 1V80A 3EI2A 3L54A 1MJDA 3NRZA 2I1KA 3CF6E 2LUEA 4BKSA 2CHZA 3OAWA 2WYQA 4ZYSA 2BYFA 2OHFA 3M62B 4FXCA 4J3OD 1WXVA 3RCZA 4J6IA 1WXSA 2ZPYA 1FNWA 1VD2A 2EMSA 2Z8LA 3Q2AC 3RZWC 1PGAA 4A09A 1ACCA 3Q3MC 1WYWB 3T3OA 1J7BA 4A08A 3DCGA 3DVGX 3S2AA 4II3B 1WGRA 5H92C 4F8CB 4WURA 2KDIA 1ET9A 3B1LX 5J17A 2PLPA 3ZWKA 2DYBA 3QARA 4ARCA 2GBNA 1FXAA 1MI0A 2AQ3B 3IAS1 2KQ4X 1IBXB 3W9CB 4C80A 2YVCA 2M1MA 1KTKA 4XC2A 2N7EA 1FFVA 1C4AA 3KUCB 1FIQA 2WS3B 2LJIA 3L0WB 3SHQA 1GB1A 4A9AA 1RFKA 3NVWA 4HROA 2ZW0A 4IUMB 2O6VD 5D2MB 5KHQA 1D6EC 2PVOD 2CS4A 2IJ0A 4IWOA 2NR2A 3SFEB 2BWFA 3SEBA 5GXGB 1C78A 3PHXB 2JU6X 4JPSA 2KX3A 3N1XC 4X57B 2JWUA 3A9JA 3JVZX 3GS2A 4A55A 2MX2A 4HK2A 2FUG1 3NZ3A 3AE3B 1NVID 4MM3B 2GMIC 2N9EB 1F0ZA 3CIRB 1SJHD 4G50A 3JW0X 1XLPA 3VTVA 1BT0A 4I6PA 4HKQA 2LVOA 2JSVX 4BKSD 4JGHB 3Q8AA 2Y3AA 2D3AA 2M0XA 3Q3JA 1H4RA 4GDKA 5IKCM 4HWIB 2AQ1B 2HJ1A 1L4ZB 2D11A 2QHOA 2RSUA 4MGYE 2ZZPB 4LDTB 2DZIA 3NZSA 1I4RA 3RNCC 1R4MI 1TKYA 4AP4C 1CMXB 3R66C 4RMAA 5E6PA 1K53A 2R2QA 3DWMA 4TUUA 1TY2A 4M8NA 4LTUA 4FN2A 1WZCA 4MEMA 1FRRA 3L16A 3T3NA 3WALA 1AW7A 2BVCA 4G0NB 2WDVB 3ZDMC 3T8MA 2KQSA 1HZ5A 5JHAA 5DPWA 2DX5B 4DBGA 3U30A 4HVBA 3U2SC 4KKIA 2IO1B 2D07B 2KWVB 2OEDA 1HA5A 5LXIB 1H8CA 2KANA 1KLVA 5FR6A 1FXTB 2DZKA 1E90A 4AR9A 4ANUA 2E6XA 3PGEA 4FJVB 3ZX4A 3EGRA 2JZZA 3ZTDA 3VDZA 4BOSC 4GMVA 4TQ0A 1FFUA 5BMIA 2VRRB 2WDTB 3RI7C 4HKZE 5D6JB 2INCC 3Q8EA 3ZDTA 3ZNGC 1XVIA 2DZMA 1JRPA 5DPTA 3VUYA 4YXDB 1XLQA 4PK1A 3NHEB 5DCNA 3RZFA 3VH3B 3A9JB 2RGFA 4W9JA 1J8CA 2WXPA 3ENEA 3DHGC 4AJWA 1FNUA 4ZRIA 3P4QB 2KDMA 3GOEA 1WGHA 2N9PC 2O2VA 1R4NI 2WQYB 3KLSX 3V05A 1A70A 4URKA 4E54A 3BZDB 4QAYA 2GBJA 2Z0DB 4K7UA 4WJQA 3M3JA 5AZHA 3ML9A 2KJRA 2WU2B 4W9FA 3ABVB 5E6NA 2G9HD 1T0QC 5IP4D 2FCSA 4MDKE 2KC1A 3KQ4A 2W3SA 4GU2A 3RMKC 2D10A 1JALA 4P1BC 3AU4A 3PZ8A 1V1PA 1RFAA 4FJZA 1AN8A 4ARFA 2W9NA 4KZCA 3EI1A 1PGBA 1UBIA 2MBBB 3UQBA 2IUUA 3N1YC 1I4HA 1C77A 1V5OA 1WMHB 4TZ4A 2LXCA 1DOIA 1IPGA 3ZJTA 2ZZGA 2N1VA 1VZ7A 4YSXB 2VH2A 5IAAC 4ANWA 2WX1A 3RYTA 2KC2A 4KIKA 1WJNA 4HJKA 1V4PA 4W9IA 1X1MA 2INDC 4DK5A 1QZEA 1WF9A 3Q8CA 3FAHA 3DVGY 4L23A 3AE2B 1C9FA 1YN3A 3A33B 2KXJA 4GLSC 2JZPA 4EKUA 4E3CA 2L00B 3WA0A 5J18A 1WXMA 2CKHB 3Q8FA 2EMTA 2OJWA 1T5XD 2RDHA 3N20C 2IGGA 2W55A 5T8IA 4MACA 1XQQA 2QDFA 2IY0B 3KWVA 4EOYA 1V86A 4ZHPA 2WLBA 3DHHC 4NNJB 1OGWA 4IG7B 3ZNID 4B95A 3GP7A 4A8XC 4ANVA 4AJYB 1HZ6A 4A3OA 2V4IB 1WIAA 4DXFA 1WFYA 1YQBA 1KJTA 4BBNF 3ZXRA 2V4LA 2HD5B 1F9JA 3W1SC 3MJWA 2ONQA 1Y8RC 4DQOC 1WX9A 5EE0A 2KFJA 1WX8A 2ZEQA 5HI1A 4OW0A 1E0ZA 3ZO5B 1M4VA 1PYWD 1PUTA 1L0XB 2RDBC 1MHHE 3IBEA 4GOCA 1HXYD 2BBCA 3DWGC 3NS1A 2WNMA 2LXAA 3BVMA 2WU5B 1F1HA 3AH7A 3AM9A 2KWUB 2MA9B 3MC9A 4P16A 5TSSA 1UWXA 3IT6B 4MGKE 3AEFB 1VZ8A 2IYDB 3DBSA 3T9LA 2WXJA 2LWPA 3KW5B 1PGXA 1B1ZA 3H6NA 1QILA 1BMLC 1QKZA 3HK0A 2J0MA 3AE7B 3BVGA 4MGZE 1YD8U 1YJ1A 4HPPA 3MHZA 2R61A 1OEYA 4KIKB 3RNBC 3AEEB 2RD0A 3TCAA 1E8YA 1D5XC 5G5HA 2JY6A 1UNSA 2FAZA 4JE3B 3I8EA 1C4CA 2INNE 2AEHA 4DDGD 3J9CA 3KH0A 1UH6A 1J7AA 3EI4A 2UWQA 3BK1A 4YWGG 2K8CA 2KMAA 3P63A 3GZNI 4K3BA 3VRBB 2L0FA 5EE9A 2KDFB 5BYSA 4TQ1A 2JQRB 1WGGA 1NYQA 2G45B 1ZXHA 3P4SB 4OVUA 3VTUA 4YTNB 2MJDA 3P42A 5AZGA 4GGQA 1GB4A 1RAXA 4B0MA 2B5LA 5FQDA 4FHJA 3C19A 1IBXA 1AARA 3AB5A 4WIPA 4A0AA 1SXTA 4LJOB 2B76B 2K6DB 1QT9A 3NJTA 3TL5A 1YIWA 5FKAC 3UGBB 2JZ3B 4XR1A 4KKJA 3FILB 4CO7A 4ZRJA 4RCOA 3SDLC 4PS8A 3QCAA 2KJ6A 2QSDA 4E5ZA 2M56B 4WWMA 4JL9A 3AULA 1DGJA 2K8BA 2OOBB 1E9MA 1K8RB 3R2IA 4R3DA 2ZVOA 3IVFA 1RRBA 1V6EA 4HXDA 4MSQB 2LVQA 2AWTA 3EECA 4K81A 1C4PA 3KVFB 2JT4B 2RPQA 2X38A 2E3TA 3QX1A 2LASA 4NY0A 3ZIMA 2K39A 3I3TB 3AE1B 4A20A 1WJ6A 4KV2A 2EKIA 4MM3A 1PFDA 1WM2A 3BIID 4WH4A 4DHZB 1LO5D 4XGAB 5L95C 2LZ6A 2L3ZA 1KRHA 3ZKJC 4L1BA 1SIFA 1WRDB 2MHJA 1B9RA 2XBBC 2IBIB 1FO4A 1GC7A 1JWAD 3ECIA 2DLBA 3I7PA 2QC8A 5JZEB 4N6EB 5CHVC 2IUTA 1WGYA 2BS4B 4HCPB 3JYUA 3DDCB 1LFDA 3DOWA 4YTMB 1V9JA 3CSTA 3DBHB 3ZJUA 1D3ZA 3ALBA 3ZUPA 1C3TA 3PLUA 1WGKA 1F2RC 3RFZB 4G3XB 5KHOA 2WXNA 1ZPSA 1NI2A 2KHWB 2GBRA 4KVGB 3L10B 2DWQA 3BVZA 2WHIA 1YNTE 3HM6X 3HRDD 1WE7A 1WYGA 3I9V1 2V9HA 2WX0A 4HDOA 5CHFA 5IOIA 4LLGM 3I7KA 4UDUC 2BPSA 1P1AA 4KDIC 2LGSA 3UF8A 5BO4B 4OVVA 3W1SA 2BT6A 3IT4B 2K5PA 2MW5A 2QEJC 1OFFA 2WDQB 2ZNVC 3RD2A 1I35A 2V3PA 2V3NA 3I8CA 4B9KA 2FBWB 3DBRB 3DBLB 2K6QA 4MH8A 3L08A 4N58A 1ECRA 1TS5A 1WI0A 1K50A 3M63B 1EF1A 3PRMB 3A9KA 4MH0E 4IM2A 4HPMB 4W9KA 1RLFA 2PE9A 2WXKA 3AE9B 3AV8A 4A3PA 3DVNV 1IUEA 3AEBB 4NAWB 5BMHA 2KDBA 2N9LA 1TS4A 2R2OA 2JYEA 3CSFA 3VUWA 5G55A 4W9LA 1NENB 3IXSA 4ZRKA 2W3RA 4AOFA 2Y5PA 4H2AA 4AR1A 1QQRA 4ZHOA 2LVPA 4LJPB 2NPTA 3PHWB 4A11A 3N3KB 4LCDE 1WGDA 1F77A 1V97A 1I4PA 2WDRB 4EZLA 2IO0B 1GG3A 4XR0A 2CR5A 4LDTD 3P1MA 2KFKB 4JWUC 3H8HA 1WMHA 2ZCBA 2K1FA 2IGDA 1EWYC 4HCNB 2JRHA 2JXXA 2SEBD 1YJJA 1Q0WB 2NCNA 2C7MB 3RPFC 4W9EA 4N9F4 1ET6A 4JWSC 4IW0A 2RDGA 1JWMD 3ZRCA 3VHTC 2Z59B 3ZTYA 2PIAA 2CU3A 3WAMA 1QLBB 1D4BA 2QCZA 1XCTL 2GLSA 2QJLA 2L32A 4AR8A 2REXA 1XEEA 4L2YA 2BKRB 2WP9B 3TUOA 2L83A 3W5VB 2LD9A 4RNAA 3B2GA 3QWZB 5TR5A 1UGMA 4P6VF 3SU8X 3PLVA 4B0EA 2X8XX 3PRZA 4C00A 1QOBA 2FE8A 3KUDB 2D2QA 2Y6IA 2FCMA 1L0YB 3BK2A 1EU4A 4WJNA 1ZXIA 4AS1A 3UIPB 3PZDA 2JUOA 2D3CA 4I6LB 4KX6B 3AXCA 3Q3NC 1T3QA 2EKEC 3VXWA 3AN1A 1TY0A 1SIJA 2NMQA 3A9KB 1TZOA 4CQNA 1FCCC 1EUVB 2K22A 2DBYA 3B9JA 5G2NA 2Z0EB 3ZNHB 2JPHA 3LYYA 1JW9D 3JSVB 1V49A 1E10A 2JRIB 4HPLB 2C5LC 2AX5A 1Q5WB 4I6NB 3WQZA 1LQBA 2KLCA 1IYFA 2J7QB 3NZUA 2ZPNA 1VDVA 1P0RA 2NS5A 4RF1A 3IHPC 3AU5A 2NPTB 3R7RA 2JVCA 2JWZA 3NG0A 2M0AA 3C8YA 3SD5A 3RFNA 2KMCA 3V60A 4W9GA 4K3CA 3V61A 2GRIA 4RGMA 2ZCCA 2NVUI 4TSSA 5CX3A 1WR6E 3K9PB 1ZUD2 1EO6A 2N0SB 1WY8A 3E0CA 4AWJA 3HM3A 1R4MB 4RFBA 1I4XA 2PEAA 1I4GA 2UYZB 2GB1A 3TIXA 2BS3B 2PJHA 1E8WA 4WJOA 1DOYA 2GBMA 4NQKE 2IPKD 3AECB 4FJYA 3N30A 3I7NA 1I7HA 3EA6A 2ON8A 4M00A 2WXGA 3AEGB 1WM3A 3ZRFA 4DWFA 5AEKB 3A4SC 4ITKA 4AQ7A 1KOTA 2K3UA 1SE3A 1QF6A 1VZ6A 2AYOB 3EFCA 1YQ3B 5DPSA 2LRUA 2BB6A 4MSMB 4FADA 1EU3A 3WANA 4XWWA 3MFGA 2Y50A 4CHKA 2IY1B 4M02A 4YTPB 2I06A 2H89B 1ZDVA 4BBNC 2KJHB 4XDDA 3TEYA 1MHXA 2WXQA 4XYCA 2XN9C 1AWDA 1TIFA 2L0TA 3L4PA 3I63C 1CZPA 1SJED 2NTSA 1JCKB 1OEYJ 3PO0A 2SAKA 2YLMA 1N5WA 3BY4B 5HKHA 1KFYB 3P4RB 2LGIA 3O65B 4KGRA 1P9DU 1ZE3D 3PV1A 2FNJB 1R4NB 1NBFC 4GSWA 1CQVA 1SBBB 5D3DA 1UELA 3FILA 1N61A 2PW9A 4Q2JA 2BB5A 3E9SA 1VCBA 4DHJB 3N32A 3I7HA 4WWPA 1WE6A 1P3QU 1TTNA 1D5ZC 3VUXA 2BKFA 3GE3C 4LNKA 3UI3A 4RGOS 4IWPA 1P7EA 1N5XA 3CMMB 4W9CA 1T0SC 3APDA 4C56C 1XO3A 4K1RB 1C79A 1RYJA 1WZ3A 2QIEB 3Q14C 2KK8A 3U52E 2GI9A 2L05A 2L52A 5E6JA 2JF5A 1V81A 2N4FA 5LXHA 3OWEB 1MG4A 4USAA 3P4PB 2W82A 3WAPA 2KDEB 1C76A 3BINA 2K25A 4ZOHC 1P7FA 2G1EA 2KVZA 1IGCA 1V7OA 4IOIE 2ZNVB 1KLUD 3L13A 5I4DA 3HUIA 1GPXA 4HJGE 4REZA 2I1JA 1ISNA 1XLOA 2V3SA 1FD6A 2LUMA 1FPYA 1ZKHA 4MT5A 4IM3A 2ZZFA 3TMPB 2KTRB 4CYEA 1E8XA 4FA6A 3AE5B 4JQWC 3UINB 4RH6A 1SB3C 3QIJA 4XX5A 4GN1A 2B5MA 2NBVB 4KGTA 3R8BA 2DENB 2B3AA 3GE8C 3H7PA 1E7PB 2RR9A 1E7UA 3APCA 1WX7A 3LB8C 1WXOA 1D5MC 2HYEA 1UUPA 2BYTA 2QILA 3ZGZA 2WXOA 2PVGC 1T6BX 1UF0A 5BYQA 4BZAA 2V0GA 5JXVA 3ZX5A 5D94A 3EHVA 1N62A 1E8ZA 3MC8A 1ZDXA 1MVKA 3EC8A 3PTFC 2VH1A 4B6WA 2DYMA 2HTHA 2LHDA 3DBLI 1XD3B 3ZYYX 1S3SG 4NAWA 3NVYA 1NEKB 4N59A 2O6VA 3MTNB 3MJ5A 2BQQA 1OQQA 2KX0A 4ICVA 4US9A 5FK9C 2DNFA 3FC4A 2L8JA 1N6ZA 4O1NA 1SF0A 3RT3B 3HIZA 2VZKB 5AUKA 3OJ4B 1FEHA 4RM9A 3W1YA 5AZFA 4PYUA 1V2YA 5EE3A 4DXAB 3OJ3A 5HFYA 3I7OA 3NS8A 2IO3B 1SE9A 4XE0A 1Q1OA 2KFKA 4PYZA 3PZ7A 1HEZE 2MCNB 1JROA 3GZNB 4GDLB 3ETRA 4ACFA 2DYOA 2J0JA 2NBUA 5IA7A 4MELA 4LNIA 2L7RA 3QAQA 5E6OA 2FIDA 4ANXA 4CI1A 1LM8B 2DAFA 3TJPA 2EELA 2CU1A 2UU7A 3ZW7A 3I5JC 4BKGA 2KWCA 1UZXB 1V8CA 3MHSD 4W9HA 1TKEA 2AL3A 3PSEB 1CJEA 3V6CB 2KWDA 1YQ4B 3ZLZA 2WWZA 1IP9A 2PPHA 3L17A 3D32A 1YX5B 4OZCA 1I4QA 3O13A 2V1YA 1JWBD 3H7PB 3H7SA 2DZJA 1NYRA 4RGNA 4NZLB 4YSZB 2MH7A 4XWTA 1F52A 4ZRPA 1WXAA 1DYQA 1PDXA 2M4NA 2YEPF 4PS3A 1GC6A 2WXFA 2C60A 3QK0A 3TBLD 4CI3A 4M0WB 2BYEA 2D3GA 1WZ0A 1KLGD 3RHUA 3B0AA 2EWJA 3BYTB 4TMAB 4XDCA 1STEA 4EEWA 1TS2A 2LGDA 2PE6B 3C0RB 1UWMA 4KZ0A 3ZJVA 2JXTA 4IM0A 3V3XA 1KH0A 1TGZB 1JQ4A 3PS6A 2MBEA 1T0RC 2O6VB 2GOWA 4JX1C 3JSVA 5CHWA 4MJSB
chains in the Genus database with same CATH topology
3AH7A 2CJOA 4RF1A 3AM9A 4DXGA 4P16A 5TSSA 1UWXA 3IT6B 1L5PA 4WAFA 2LMCA 3AEFB 1FRDA 1VZ8A 2JYTA 1Y56A 2M0AA 1YN4A 2VZKD 2WXJA 3C8YA 2I2YA 3BWUD 3RFNA 2J4XA 4US8A 2RMMA 4HEA1 3WCQA 4HRSA 1PGXA 2GRIA 2IUSA 1B1ZA 2H88B 4RGMA 3W2DA 1QILA 4KGSA 4TSSA 1BMLC 1QKZA 1RM6C 2BTEA 1ZUD2 2KACA 3SFDB 3U4EG 2N0SB 3BYYB 3AE7B 1ROEA 3BVGA 3E0CA 5BYRA 4RFBA 3MHZA 4OZBA 2R61A 3AE4B 3EI2A 1I4XA 3AE6B 1I4GA 3NRZA 2GB1A 2LEKA 3AEEB 2PKOA 5BMGA 2ZZEA 2BS3B 4EE2A 5C3JB 2INPE 1D5XC 1N63A 5G5HA 1DOYA 1UNSA 1ZOYB 1SE4A 4JE3B 4PT5A 1QOGA 5HHDG 2IPKD 3AECB 3I8EA 2J42A 1C4CA 2INNE 3I7NA 1I7HA 3J9CA 3EA6A 4ZYSA 2ON8A 2OHFA 1SEBD 1ENFA 1J7AA 4FXCA 4J3OD 3EI4A 2WXGA 1QOAA 3BK1A 4YWGG 3VQIA 2KMMA 3AEGB 1TYGB 3P63A 1YMHE 1FNWA 4ITKA 2Z8LA 3VRBB 1PGAA 4AQ7A 4A09A 1ACCA 1VJKA 5EE9A 2ZTGA 2K3UA 3T3OA 1J7BA 1SE3A 1QF6A 5BYSA 1VZ6A 1YQ3B 2I38A 2BB6A 4TQ1A 2JQRB 1NYQA 1EU3A 4A08A 4XWWA 3MFGA 4WQMA 2Y50A 1ZXHA 2RPVA 5H92C 3P4SB 4WURA 4YTPB 2I06A 1ET9A 3AE8B 2H89B 1ZDVA 4YTNB 2MJDA 4XDDA 3TEYA 3P42A 2PLPA 1MHXA 2WXQA 3W5UB 2XN9C 4ARCA 1GB4A 4A6QA 1AWDA 4AREA 4B0MA 1N60A 3L4PA 1FXAA 4RF0A 1CZPA 1SJED 1TJEA 2NTSA 1MI0A 1VR9A 2NTTA 2B5LA 2AQ3B 3IAS1 1JCKB 2KQ4X 1IBXB 3W9CB 4C80A 3PO0A 4NJCA 5FQDA 2SAKA 1KTKA 1BUIC 1N5WA 2Q5WD 1FFVA 1IBXA 2WXMA 1KFYB 3AB5A 4WIPA 2N7JA 4A0AA 1SXTA 1C4AA 3P4RB 2LGIA 1FNVA 2B76B 3SR6A 4KGRA 1FIQA 2WS3B 1QT9A 2LJIA 1GB1A 1ZE3D 5FKAC 5D7GA 4A9AA 2J52A 4XR1A 1RFKA 3NVWA 4HROA 2ZW0A 4KKJA 2N9KA 3NUHB 3FILB 1D6EC 3MC0B 2PVOD 4YT0B 4RCOA 1CQVA 1XF5L 1SBBB 4YSYB 5D3DA 3FILA 5D3IB 2QSDA 1N61A 1ZP0B 2IJ0A 4E5ZA 2M56B 2PW9A 1WSPA 4WWMA 4Q2JA 5HG2A 1XXGA 1DGJA 3SFEB 2BB5A 1E9MA 2ICIA 3E9SA 3R2IA 4R3DA 3SEBA 2Y3UA 3I7HA 1EWCA 5GXGB 1C78A 2JU6X 4JPSA 1D5ZC 1C4PA 2JWUA 3GS2A 2X38A 4A55A 2BW2A 3UI3A 2E3TA 4RGOS 2FUG1 3NZ3A 3AE3B 1NVID 1P7EA 4MM3B 1N5XA 3AE1B 1HQRD 2EKIA 1F0ZA 3CIRB 1PFDA 1SJHD 4C56C 3BIID 1XLPA 4WH4A 3VRAB 1XO3A 1LO5D 4CI2A 4HKQA 1C79A 2JSVX 1KRHA 1RYJA 2QIEB 4GDKB 4L1BA 3Q8AA 2Y3AA 1B9RA 2LFIA 3U52E 2GI9A 3TSSA 3I89A 2AQ1B 2L52A 5E6JA 1L4ZB 4D2KA 1DOXA 1FO4A 4XR2A 1JWAD 1V1OA 3OWEB 3Q69A 4USAA 1I4RA 3P4PB 2DLBA 2L1AA 3I7PA 1MPEA 1TKYA 2W82A 4N6EB 2IUTA 1K53A 3DWMA 2BS4B 1F2RI 1TY2A 2KN4A 2WXHA 1C76A 4YTMB 1KF6B 3ZJUA 4LTUA 1J7CA 2HTME 4ZOHC 1P7FA 2G1EA 1FRRA 5EE1A 3T3NA 1IGCA 3NVVA 1V7OA 3AEAB 1AW7A 1GAQB 1WGKA 1BXTA 3NVZA 1F2RC 3RFZB 2WDVB 4IOIE 1KLUD 1XLNA 5I4DA 1HZ5A 1CK1A 3HUIA 2WXNA 4HJGE 1GPXA 4REZA 1ZPSA 2W54A 3KEWA 2D5GA 4A0BA 3I57A 1XLOA 2DWQA 2ACZB 3BVZA 1FD6A 1AYFA 2LUMA 1YNTE 3HRDD 4MT5A 1EM7A 1WYGA 3U2SC 4KKIA 2ZZFA 2LHEA 2OEDA 3I9V1 1HA5A 2WXIA 3AE5B 1JWUD 4LLGM 4RH6A 1SB3C 4UDUC 3I7KA 3BVMA 2B5MA 3W1SA 2XNAC 3VR9B 1R7SA 4KGTA 3R8BA 2BT6A 3B2FA 3IT4B 4AR9A 2K5PA 2E6XA 3EGRA 1E7PB 2QEJC 1OFFA 2WDQB 4XR3A 2PTLA 3LB8C 1K52A 1WXOA 2V3PA 2V3NA 3I8CA 1D5MC 2HYEA 1UUPA 2FBWB 2MJ3A 4TQ0A 2BYTA 1FFUA 2QILA 2ZW1A 5BMIA 3ZGZA 2WXOA 2PVGC 1T6BX 4MH8A 4HKZE 5BYQA 4N58A 2V0GA 1OQRA 5JXVA 1JWSD 3Q8EA 1ECRA 1TS5A 1N62A 1K50A 1JRPA 1ZDXA 1E6EB 4YXDB 4A90A 4ZRQA 2JX5A 1MVKA 1XLQA 4LK0M 1TKGA 4OZAA 2WXKA 3AE9B 3AV8A 2WXPA 3AEBB 1IUEA 5BMHA 4NAWB 2DYMA 2N9LA 1FNUA 4IDIA 1TS4A 3P4QB 2KDMA 2JYEA 5MPOA 2LHDA 3ZYYX 2WQYB 3KLSX 3V05A 3TEXA 3NVYA 1A70A 1K51A 1NENB 1NEKB 3IXSA 4E54A 3BZDB 4N59A 1UGJA 2W3RA 1TS3A 2WU2B 3MJ5A 1OQQA 2Y5PA 3IAM1 4H2AA 4AR1A 3ABVB 1QQRA 1VRAB 5H8YE 2G9HD 5G5GA 4ZHOA 4US9A 5FK9C 3FC4A 4O1NA 3KQ4A 1SF0A 2W3SA 4C7YA 2K9XA 4A11A 1JALA 1V1PB 2AQ2B 2VZKB 1WNUA 5AUKA 2J53A 1F77A 1FEHA 1L0VB 2CJNA 1V97A 3PZ8A 1V1PA 1FCLA 1I4PA 1AN8A 2WDRB 4ARFA 2QMTA 5EE3A 3EI1A 1PGBA 1YJIA 3HVZA 5HFYA 3I7OA 2IUUA 1I4HA 1C77A 4XR0A 4XE0A 1FXIA 1QOFA 3P1MA 4JWUC 3CWIA 4TZ4A 3H8HA 1DOIA 3ZJTA 2ZZGA 3EI3A 1VZ7A 3PZ7A 1HEZE 1YN5A 1JROA 2YEPB 2IGDA 4YSXB 3GB1A 4GDLB 1GOZA 1EWYC 3ETRA 2DYOA 4IKGA 2SEBD 1YJJA 1V4PA 3RPFC 1ET6A 2MEKA 4JWSC 4CI1A 1Q10A 2RDGA 1JWMD 2EELA 3VR8B 2WXRA 2TSSA 3Q8CA 3FAHA 2IGHA 2PIAA 2KAJA 2E1BA 4L23A 1SSNA 3AE2B 4ARIA 1WRIA 1L4DB 1YN3A 1NI3A 2CU3A 1QLBB 1V8CA 1C9FA 1D4BA 1XCTL 2QJLA 4GLSC 2L32A 1TKEA 2JZPA 4AR8A 1XEEA 4L2YA 2WP9B 3Q8BA 1CJEA 5C2TB 3TUOA 2KWDA 2L83A 3W5VB 4RNAA 1YQ4B 3B2GA 2WXLA 3Q8FA 1WXQA 4P6VF 1T5XD 2RDHA 2IGGA 2W55A 4B0EA 3TEZA 4OZCA 5T8IA 1I4QA 2HDEA 4MACA 5AUIA 3O13A 1JWBD 1RWSA 1QOBA 1FMAD 3KWVA 2FE8A 1NYRA 4RGNA 1L6UA 4NZLB 4NAMA 4YSZB 2MH7A 4XWTA 4ZHPA 2WLBA 2Y6IA 2K0PA 3ZQ4A 1L0YB 3BK2A 1EU4A 3HVDA 1ZXIA 4AS1A 3URYA 3TEWA 1IGDA 4ZRPA 3GP7A 1DYQA 1PDXA 2YEPF 4A8XC 1HZ6A 1FM0D 2V4IB 2WXFA 4CI3A 3U7ZA 4DXFA 4KX6B 1SE2A 5LNK1 1WWTA 3I7LA 1KLGD 3MP9A 1T3QA 3RHUA 5FR3A 4M0WA 3KWLA 2EWJA 3AN1A 1TY0A 1SIJA 2NMQA 3BYTB 1TZOA 3R2TA 4CQNA 4TMAB 1FCCC 3EUB2 4XDCA 1STEA 2ONQA 2MJEA 3AEDB 3N9YC 1TS2A 4DQOC 2K22A 2PMVA 4OVZA 4OHJA 1XCQL 2DBYA 3B9JA 1JMLA 1UWMA 5EE0A 1ESFA 5HI1A 3ZJVA 3LYYA 1JW9D 4OW0A 2JXTA 3AMZA 1E0ZA 1M4VA 2Y5CA 2IDYA 1KH0A 1PYWD 4RGTA 3V3XA 1PUTA 1E10A 1L6VA 1L0XB 2AX5A 1JQ4A 1MHHE 2M19A 3E56A 4JX1C 3WQZA 1HXYD 3LXFA 2BBCA 2BS2B 3DWGC 3NS1A 2I05A 2WNMA 4C7ZA 1VDVA 2WU5B 1VLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AH7 A;  1FFV A;  2CJO A;  3CWI A;  1DOI A;  3AM9 A;  1XLO A;  2DWQ A;  2ACZ B;  1KFY B;  3AB5 A;  2ZZG A;  1AYF A;  1L5P A;  3HRD D;  3AEF B;  3P4R B;  1FRD A;  1JRO A;  5EE3 A;  4YSX B;  1WYG A;  2B76 B;  3SR6 A;  1EWY C;  3ETR A;  2ZZF A;  1FIQ A;  2WS3 B;  1QT9 A;  3RFN A;  1YJJ A;  1V4P A;  3AE5 B;  4US8 A;  4A9A A;  3WCQ A;  1RFK A;  3NVW A;  4HRO A;  4HRS A;  3RPF C;  1SB3 C;  2H88 B;  2PVO D;  4YT0 B;  4YSY B;  4JWS C;  3VR8 B;  1R7S A;  3VR9 B;  1RM6 C;  1N61 A;  1ZP0 B;  1ZUD 2;  3FAH A;  2BT6 A;  3B2F A;  2N0S B;  2M56 B;  2PIA A;  1ROE A;  2KAJ A;  2K5P A;  3AE7 B;  4WWM A;  2E1B A;  1DGJ A;  3SFE B;  1E9M A;  3AE2 B;  1E7P B;  1WRI A;  2CU3 A;  1NI3 A;  1QLB B;  1OFF A;  1V8C A;  2WDQ B;  3AE4 B;  5GXG B;  2QJL A;  3AE6 B;  3LB8 C;  1WXO A;  1TKE A;  2WP9 B;  3NRZ A;  2LEK A;  3AEE B;  2PKO A;  2ZZE A;  1CJE A;  2FBW B;  5C2T B;  2BS3 B;  2MJ3 A;  2L83 A;  3W5V B;  5C3J B;  1FFU A;  5G5H A;  1N63 A;  1DOY A;  1ZOY B;  1YQ4 B;  1QOG A;  2PVG C;  2E3T A;  3B2G A;  1WXQ A;  3AEC B;  4N58 A;  4P6V F;  1OQR A;  1I7H A;  2W55 A;  3AE3 B;  5AUI A;  1NVI D;  2OHF A;  1N62 A;  1JWB D;  1RWS A;  1J7A A;  4FXC A;  1QOB A;  1FMA D;  1N5X A;  1JRP A;  1QOA A;  3AE1 B;  1NYR A;  1E6E B;  1L6U A;  2KMM A;  2W54 A;  2EKI A;  2JX5 A;  3AEG B;  1XLQ A;  4YSZ B;  2MH7 A;  4YXD B;  1TYG B;  1F0Z A;  3CIR B;  3P63 A;  4ZHP A;  1PFD A;  2WLB A;  3BII D;  1XLP A;  3VRA B;  1XO3 A;  4ITK A;  3VRB B;  1TKG A;  3AE9 B;  1ZXI A;  3AV8 A;  1VJK A;  5EE9 A;  2ZTG A;  3AEB B;  1IUE A;  1KRH A;  1RYJ A;  2QIE B;  1J7B A;  1PDX A;  4IDI A;  3P4Q B;  1QF6 A;  5MPO A;  1FM0 D;  1YQ3 B;  1B9R A;  3ZYY X;  2WQY B;  2JQR B;  1NYQ A;  4KX6 B;  3NVY A;  1A70 A;  1WWT A;  1NEN B;  2L52 A;  1NEK B;  4WQM A;  1DOX A;  4N59 A;  1T3Q A;  1FO4 A;  3RHU A;  2W3R A;  3KWL A;  3SFD B;  5H92 C;  3P4S B;  3AN1 A;  1JWA D;  1SIJ A;  2WU2 B;  1OQQ A;  4YTP B;  3ABV B;  5H8Y E;  4USA A;  3P4P B;  3AE8 B;  2H89 B;  5G5G A;  3P1M A;  4US9 A;  4YTN B;  4ZHO A;  1TKY A;  1VDV A;  2MJD A;  3FC4 A;  4N6E B;  3EUB 2;  3AED B;  2MJE A;  1SF0 A;  3DWM A;  2BS4 B;  2K22 A;  2W3S A;  4C7Y A;  2K9X A;  4YTM B;  2DBY A;  1JAL A;  1KF6 B;  3B9J A;  3W5U B;  1UWM A;  5EE0 A;  4LTU A;  1AWD A;  1WNU A;  5AUK A;  1J7C A;  1JW9 D;  3AMZ A;  1E0Z A;  1L0V B;  2HTM E;  1V97 A;  2CJN A;  1FRR A;  2G1E A;  2Y5C A;  4ZOH C;  1PUT A;  5EE1 A;  1L6V A;  1E10 A;  1N60 A;  2AX5 A;  2WDR B;  3L4P A;  3NVV A;  1JQ4 A;  1V7O A;  3AEA B;  2M19 A;  1GAQ B;  1FXA A;  4JX1 C;  1WGK A;  1CZP A;  1TJE A;  1YJI A;  3HVZ A;  3LXF A;  3NVZ A;  3WQZ A;  2WDV B;  2BS2 B;  3DWG C;  3NS1 A;  3W9C B;  4C80 A;  3PO0 A;  1XLN A;  4C7Z A;  3HUI A;  3KEW A;  1GPX A;  1FXI A;  1QOF A;  2WU5 B;  1VLB A;  1N5W A;  2Q5W D;  4JWU C; 
#chains in the Genus database with same CATH topology
 3LDZ E;  4WAF A;  2LMC A;  1FRD A;  1YN4 A;  3PVL A;  2I2Y A;  3BWU D;  3U8Z A;  2RMM A;  4HEA 1;  3WCQ A;  4HRS A;  1Z5S B;  2IUS A;  2GBK A;  4AUQ C;  1RM6 C;  2KKC A;  2KAC A;  3SFD B;  3ZTW A;  5BYR A;  3PRE A;  4BAX A;  3AE4 B;  3AE6 B;  2LEK A;  4EZK A;  2PKO A;  5BMG A;  2ZZE A;  3ZXV A;  1PQS A;  4EE2 A;  5C3J B;  5EDS A;  2INP E;  1N63 A;  2J0K A;  1ZOY B;  1SE4 A;  4PT5 A;  3DPD A;  1QOG A;  5HHD G;  2J42 A;  3IG3 A;  3R3M A;  3VH4 B;  4HLE A;  1SEB D;  1ENF A;  1QOA A;  3V62 A;  3VQI A;  2KMM A;  3QQ8 B;  4ZDV A;  1TYG B;  1YMH E;  4W9D A;  3RN9 C;  3X0W A;  3K9O B;  2Y5B B;  4DHZ E;  1VJK A;  1A5R A;  2ZTG A;  5IN7 A;  2XEW A;  4TKN A;  2I38 A;  2OJR A;  2C9W B;  3U7D A;  3RNF C;  4HDQ A;  4C4V A;  4WQM A;  1LXD A;  1J0G A;  2RPV A;  1L7Y A;  1J19 A;  1UBQ A;  3AE8 B;  2C7N B;  1OQY A;  1M94 A;  3IFW B;  2WGS A;  3W5U B;  3QA8 A;  4A6Q A;  2KD0 A;  2G4S A;  3VTW A;  4ARE A;  4BVU C;  1N60 A;  3PPA A;  4RF0 A;  1TJE A;  1VR9 A;  2NTT A;  4GXB A;  2KQ7 A;  1S1Q B;  4NJC A;  1MFW A;  1BUI C;  2Q5W D;  4BKT A;  1L2N A;  3H1U A;  2LRW A;  4ICU A;  1GNU A;  2WXM A;  4FLH A;  2N7J A;  3DHI C;  1FNV A;  3R7Q A;  4K7W A;  3SR6 A;  2M17 A;  4F7Z A;  5C1Z A;  4WQO B;  1LGR A;  4FBJ B;  3KYC D;  2BWE S;  5D7G A;  1MG8 A;  2J52 A;  4MGI E;  2N9K A;  3NUH B;  2FCQ A;  3MC0 B;  4YT0 B;  2G4D B;  4E74 A;  1XF5 L;  4YSY B;  5LLI A;  1G6J A;  2M8S A;  5D3I B;  1ZP0 B;  3WIM A;  3HHM A;  1WSP A;  5HG2 A;  1XXG A;  2ICI A;  2Y3U A;  1EWC A;  2XK5 A;  3ZW3 A;  2MSE D;  4ASW C;  4EUT A;  4NJ7 A;  2KLG A;  2ZVN A;  2BW2 A;  2KOX A;  3DQV A;  4WAA A;  4K7S A;  1P98 A;  2KT7 A;  4BOZ B;  1WJU A;  3Q3O C;  2MBQ A;  3VAW A;  2FCN A;  1HQR D;  4EZJ A;  3H9D A;  3VRA B;  3DVN U;  3QHT A;  1ZW7 A;  4M01 A;  4CI2 A;  4GDK B;  1C1Y B;  2KZR A;  2LFI A;  3TSS A;  3I89 A;  3ZTC A;  3KUZ A;  4D2K A;  1DOX A;  4XR2 A;  4EFO A;  1V1O A;  2MRP A;  3Q69 A;  2L1A A;  2KNB A;  1MPE A;  5DPR A;  3X23 A;  1F2R I;  1HTO A;  2KO3 A;  2KN4 A;  2WXH A;  1KF6 B;  1J7C A;  3UQA A;  2HTM E;  5EE1 A;  4C4V B;  4FHK A;  4P1C C;  3NVV A;  3AEA B;  2ZOS A;  1GAQ B;  1BXT A;  2FUH B;  3NVZ A;  1XLN A;  1CK1 A;  4F1S A;  2DHZ A;  2A4Z A;  3WAO A;  5JH5 C;  3KEW A;  2W54 A;  2D5G A;  3ZUN A;  1NDD A;  4A0B A;  3I57 A;  2ACZ B;  1HTQ A;  3LJ3 A;  1AYF A;  3P2B A;  2MP2 A;  1EM7 A;  2BGF A;  2LHE A;  2G3Q B;  2KYW A;  2WXI A;  2LI5 A;  1JWU D;  3ZNZ B;  2KTR A;  2KVR A;  4LNO A;  4XZ4 A;  2XNA C;  3VR9 B;  1R7S A;  3QJZ A;  1HE8 A;  3B2F A;  3EFU A;  2HE7 A;  3AI5 A;  4XR3 A;  2PTL A;  1K52 A;  2KTF A;  2LGX A;  2MJ3 A;  2ZW1 A;  1TBE A;  1E5W A;  4S0R A;  1OQR A;  3A4R A;  1JWS D;  2BYV E;  4NJ6 A;  2XK5 B;  2N7D A;  1E6E B;  1UD7 A;  4A90 A;  4DHJ D;  4ZRQ A;  2JX5 A;  2L76 A;  4LK0 M;  2K8H A;  3NOB A;  1TKG A;  4OZA A;  4S17 A;  4BFR A;  3ZVV A;  4ZYN A;  2CHW A;  2O2V B;  2BF8 B;  3OLM D;  3A1Q A;  4IDI A;  3UIO B;  3PT2 B;  5MPO A;  3TEX A;  2MLB A;  1K51 A;  4RM8 A;  2HJ8 A;  2AL6 A;  2MBO A;  1UGJ A;  1TS3 A;  1I42 A;  4WWN A;  3IAM 1;  1VRA B;  5H8Y E;  2MQJ A;  5G5G A;  3VVW B;  2N1W A;  1OTR B;  4C7Y A;  2K9X A;  1V1P B;  2AQ2 B;  3Q3F A;  1WNU A;  2J53 A;  1L0V B;  4LNF A;  2CJN A;  3RNE C;  1FCL A;  3FKY A;  1XT9 B;  2QMT A;  2D3B A;  1YJI A;  3HVZ A;  3APF A;  1E7V A;  1FXI A;  1QOF A;  3CWI A;  1YOV B;  2C7H A;  2IZV B;  3EI3 A;  1YN5 A;  2YEP B;  3GB1 A;  1GOZ A;  4IKG A;  4GDL A;  2KN5 A;  3ZWD A;  2MEK A;  4M8M A;  4TV3 A;  1Q10 A;  2ZJD A;  3VR8 B;  4NPN A;  2WXR A;  2FIF A;  2TSS A;  2IGH A;  2KAJ A;  5JHB A;  2E1B A;  2MP2 B;  1SSN A;  4ARI A;  1WRI A;  1L4D B;  1NI3 A;  3M95 A;  2DAJ A;  2NBW B;  4NQL B;  3DBH I;  3Q8B A;  1T0Y A;  5C2T B;  2N9X A;  3QC8 B;  1TZ1 A;  3ONS A;  3OG5 A;  1GUA B;  2WXL A;  3RNG C;  5L83 A;  1WXQ A;  3KYD D;  4KSL C;  4LNN A;  3V6E B;  4DDI D;  3ZU6 A;  3TEZ A;  2HDE A;  5AUI A;  2CHX A;  1RWS A;  1FMA D;  3VFK A;  1L6U A;  4KDL B;  4NAM A;  3RUL A;  4PS7 A;  2K0P A;  3ZQ4 A;  3HVD A;  1TT5 B;  3URY A;  3TEW A;  4GB9 A;  1IGD A;  3PRP B;  4WJP A;  3NY5 A;  1FM0 D;  3B08 A;  4JLC A;  3U7Z A;  4GIV A;  1SE2 A;  5LNK 1;  1WWT A;  3I7L A;  2MWS B;  3MP9 A;  5FR3 A;  4M0W A;  3KWL A;  5C23 A;  1WH3 A;  4IWQ A;  3R2T A;  1Z2M A;  3N1Z C;  4JIO U;  5GMV A;  3EUB 2;  3RNA C;  3AED B;  2MJE A;  3N9Y C;  4OVZ A;  2PMV A;  1JRU A;  1ZGU B;  4OHJ A;  1XCQ L;  3A1Q B;  4G11 A;  1JML A;  1ESF A;  3ML8 A;  3AMZ A;  2Y5C A;  2IDY A;  4RGT A;  3DBR I;  1L6V A;  2ASQ A;  2M19 A;  3E56 A;  3RUI B;  3LXF A;  4II2 B;  4FUL A;  2BS2 B;  2I05 A;  2LGY A;  4C7Z A;  4YL8 A;  1VLB A;  5IO9 A;  2CJO A;  4MJS A;  4P7I A;  4DXG A;  1SGH A;  1YX6 B;  5J2R A;  4KSK C;  1L5P A;  1EF5 A;  1KM7 A;  2JYT A;  1Y56 A;  2VZK D;  2LJ5 A;  1GJZ A;  2J4X A;  4US8 A;  4IC7 B;  4WWO A;  2MBH A;  5CTR C;  2IO2 B;  2H88 B;  1U4A A;  3W2D A;  4KGS A;  3Q6B A;  2BTE A;  1WJ4 A;  3U4E G;  3BYY B;  1ROE A;  2A5U A;  1V5T A;  1WR1 A;  4E71 A;  4OZB A;  1V80 A;  3EI2 A;  3L54 A;  1MJD A;  3NRZ A;  2I1K A;  3CF6 E;  2LUE A;  4BKS A;  2CHZ A;  3OAW A;  2WYQ A;  4ZYS A;  2BYF A;  2OHF A;  3M62 B;  4FXC A;  4J3O D;  1WXV A;  3RCZ A;  4J6I A;  1WXS A;  2ZPY A;  1FNW A;  1VD2 A;  2EMS A;  2Z8L A;  3Q2A C;  3RZW C;  1PGA A;  4A09 A;  1ACC A;  3Q3M C;  1WYW B;  3T3O A;  1J7B A;  4A08 A;  3DCG A;  3DVG X;  3S2A A;  4II3 B;  1WGR A;  5H92 C;  4F8C B;  4WUR A;  2KDI A;  1ET9 A;  3B1L X;  5J17 A;  2PLP A;  3ZWK A;  2DYB A;  3QAR A;  4ARC A;  2GBN A;  1FXA A;  1MI0 A;  2AQ3 B;  3IAS 1;  2KQ4 X;  1IBX B;  3W9C B;  4C80 A;  2YVC A;  2M1M A;  1KTK A;  4XC2 A;  2N7E A;  1FFV A;  1C4A A;  3KUC B;  1FIQ A;  2WS3 B;  2LJI A;  3L0W B;  3SHQ A;  1GB1 A;  4A9A A;  1RFK A;  3NVW A;  4HRO A;  2ZW0 A;  4IUM B;  2O6V D;  5D2M B;  5KHQ A;  1D6E C;  2PVO D;  2CS4 A;  2IJ0 A;  4IWO A;  2NR2 A;  3SFE B;  2BWF A;  3SEB A;  5GXG B;  1C78 A;  3PHX B;  2JU6 X;  4JPS A;  2KX3 A;  3N1X C;  4X57 B;  2JWU A;  3A9J A;  3JVZ X;  3GS2 A;  4A55 A;  2MX2 A;  4HK2 A;  2FUG 1;  3NZ3 A;  3AE3 B;  1NVI D;  4MM3 B;  2GMI C;  2N9E B;  1F0Z A;  3CIR B;  1SJH D;  4G50 A;  3JW0 X;  1XLP A;  3VTV A;  1BT0 A;  4I6P A;  4HKQ A;  2LVO A;  2JSV X;  4BKS D;  4JGH B;  3Q8A A;  2Y3A A;  2D3A A;  2M0X A;  3Q3J A;  1H4R A;  4GDK A;  5IKC M;  4HWI B;  2AQ1 B;  2HJ1 A;  1L4Z B;  2D11 A;  2QHO A;  2RSU A;  4MGY E;  2ZZP B;  4LDT B;  2DZI A;  3NZS A;  1I4R A;  3RNC C;  1R4M I;  1TKY A;  4AP4 C;  1CMX B;  3R66 C;  4RMA A;  5E6P A;  1K53 A;  2R2Q A;  3DWM A;  4TUU A;  1TY2 A;  4M8N A;  4LTU A;  4FN2 A;  1WZC A;  4MEM A;  1FRR A;  3L16 A;  3T3N A;  3WAL A;  1AW7 A;  2BVC A;  4G0N B;  2WDV B;  3ZDM C;  3T8M A;  2KQS A;  1HZ5 A;  5JHA A;  5DPW A;  2DX5 B;  4DBG A;  3U30 A;  4HVB A;  3U2S C;  4KKI A;  2IO1 B;  2D07 B;  2KWV B;  2OED A;  1HA5 A;  5LXI B;  1H8C A;  2KAN A;  1KLV A;  5FR6 A;  1FXT B;  2DZK A;  1E90 A;  4AR9 A;  4ANU A;  2E6X A;  3PGE A;  4FJV B;  3ZX4 A;  3EGR A;  2JZZ A;  3ZTD A;  3VDZ A;  4BOS C;  4GMV A;  4TQ0 A;  1FFU A;  5BMI A;  2VRR B;  2WDT B;  3RI7 C;  4HKZ E;  5D6J B;  2INC C;  3Q8E A;  3ZDT A;  3ZNG C;  1XVI A;  2DZM A;  1JRP A;  5DPT A;  3VUY A;  4YXD B;  1XLQ A;  4PK1 A;  3NHE B;  5DCN A;  3RZF A;  3VH3 B;  3A9J B;  2RGF A;  4W9J A;  1J8C A;  2WXP A;  3ENE A;  3DHG C;  4AJW A;  1FNU A;  4ZRI A;  3P4Q B;  2KDM A;  3GOE A;  1WGH A;  2N9P C;  2O2V A;  1R4N I;  2WQY B;  3KLS X;  3V05 A;  1A70 A;  4URK A;  4E54 A;  3BZD B;  4QAY A;  2GBJ A;  2Z0D B;  4K7U A;  4WJQ A;  3M3J A;  5AZH A;  3ML9 A;  2KJR A;  2WU2 B;  4W9F A;  3ABV B;  5E6N A;  2G9H D;  1T0Q C;  5IP4 D;  2FCS A;  4MDK E;  2KC1 A;  3KQ4 A;  2W3S A;  4GU2 A;  3RMK C;  2D10 A;  1JAL A;  4P1B C;  3AU4 A;  3PZ8 A;  1V1P A;  1RFA A;  4FJZ A;  1AN8 A;  4ARF A;  2W9N A;  4KZC A;  3EI1 A;  1PGB A;  1UBI A;  2MBB B;  3UQB A;  2IUU A;  3N1Y C;  1I4H A;  1C77 A;  1V5O A;  1WMH B;  4TZ4 A;  2LXC A;  1DOI A;  1IPG A;  3ZJT A;  2ZZG A;  2N1V A;  1VZ7 A;  4YSX B;  2VH2 A;  5IAA C;  4ANW A;  2WX1 A;  3RYT A;  2KC2 A;  4KIK A;  1WJN A;  4HJK A;  1V4P A;  4W9I A;  1X1M A;  2IND C;  4DK5 A;  1QZE A;  1WF9 A;  3Q8C A;  3FAH A;  3DVG Y;  4L23 A;  3AE2 B;  1C9F A;  1YN3 A;  3A33 B;  2KXJ A;  4GLS C;  2JZP A;  4EKU A;  4E3C A;  2L00 B;  3WA0 A;  5J18 A;  1WXM A;  2CKH B;  3Q8F A;  2EMT A;  2OJW A;  1T5X D;  2RDH A;  3N20 C;  2IGG A;  2W55 A;  5T8I A;  4MAC A;  1XQQ A;  2QDF A;  2IY0 B;  3KWV A;  4EOY A;  1V86 A;  4ZHP A;  2WLB A;  3DHH C;  4NNJ B;  1OGW A;  4IG7 B;  3ZNI D;  4B95 A;  3GP7 A;  4A8X C;  4ANV A;  4AJY B;  1HZ6 A;  4A3O A;  2V4I B;  1WIA A;  4DXF A;  1WFY A;  1YQB A;  1KJT A;  4BBN F;  3ZXR A;  2V4L A;  2HD5 B;  1F9J A;  3W1S C;  3MJW A;  2ONQ A;  1Y8R C;  4DQO C;  1WX9 A;  5EE0 A;  2KFJ A;  1WX8 A;  2ZEQ A;  5HI1 A;  4OW0 A;  1E0Z A;  3ZO5 B;  1M4V A;  1PYW D;  1PUT A;  1L0X B;  2RDB C;  1MHH E;  3IBE A;  4GOC A;  1HXY D;  2BBC A;  3DWG C;  3NS1 A;  2WNM A;  2LXA A;  3BVM A;  2WU5 B;  1F1H A;  3AH7 A;  3AM9 A;  2KWU B;  2MA9 B;  3MC9 A;  4P16 A;  5TSS A;  1UWX A;  3IT6 B;  4MGK E;  3AEF B;  1VZ8 A;  2IYD B;  3DBS A;  3T9L A;  2WXJ A;  2LWP A;  3KW5 B;  1PGX A;  1B1Z A;  3H6N A;  1QIL A;  1BML C;  1QKZ A;  3HK0 A;  2J0M A;  3AE7 B;  3BVG A;  4MGZ E;  1YD8 U;  1YJ1 A;  4HPP A;  3MHZ A;  2R61 A;  1OEY A;  4KIK B;  3RNB C;  3AEE B;  2RD0 A;  3TCA A;  1E8Y A;  1D5X C;  5G5H A;  2JY6 A;  1UNS A;  2FAZ A;  4JE3 B;  3I8E A;  1C4C A;  2INN E;  2AEH A;  4DDG D;  3J9C A;  3KH0 A;  1UH6 A;  1J7A A;  3EI4 A;  2UWQ A;  3BK1 A;  4YWG G;  2K8C A;  2KMA A;  3P63 A;  3GZN I;  4K3B A;  3VRB B;  2L0F A;  5EE9 A;  2KDF B;  5BYS A;  4TQ1 A;  2JQR B;  1WGG A;  1NYQ A;  2G45 B;  1ZXH A;  3P4S B;  4OVU A;  3VTU A;  4YTN B;  2MJD A;  3P42 A;  5AZG A;  4GGQ A;  1GB4 A;  1RAX A;  4B0M A;  2B5L A;  5FQD A;  4FHJ A;  3C19 A;  1IBX A;  1AAR A;  3AB5 A;  4WIP A;  4A0A A;  1SXT A;  4LJO B;  2B76 B;  2K6D B;  1QT9 A;  3NJT A;  3TL5 A;  1YIW A;  5FKA C;  3UGB B;  2JZ3 B;  4XR1 A;  4KKJ A;  3FIL B;  4CO7 A;  4ZRJ A;  4RCO A;  3SDL C;  4PS8 A;  3QCA A;  2KJ6 A;  2QSD A;  4E5Z A;  2M56 B;  4WWM A;  4JL9 A;  3AUL A;  1DGJ A;  2K8B A;  2OOB B;  1E9M A;  1K8R B;  3R2I A;  4R3D A;  2ZVO A;  3IVF A;  1RRB A;  1V6E A;  4HXD A;  4MSQ B;  2LVQ A;  2AWT A;  3EEC A;  4K81 A;  1C4P A;  3KVF B;  2JT4 B;  2RPQ A;  2X38 A;  2E3T A;  3QX1 A;  2LAS A;  4NY0 A;  3ZIM A;  2K39 A;  3I3T B;  3AE1 B;  4A20 A;  1WJ6 A;  4KV2 A;  2EKI A;  4MM3 A;  1PFD A;  1WM2 A;  3BII D;  4WH4 A;  4DHZ B;  1LO5 D;  4XGA B;  5L95 C;  2LZ6 A;  2L3Z A;  1KRH A;  3ZKJ C;  4L1B A;  1SIF A;  1WRD B;  2MHJ A;  1B9R A;  2XBB C;  2IBI B;  1FO4 A;  1GC7 A;  1JWA D;  3ECI A;  2DLB A;  3I7P A;  2QC8 A;  5JZE B;  4N6E B;  5CHV C;  2IUT A;  1WGY A;  2BS4 B;  4HCP B;  3JYU A;  3DDC B;  1LFD A;  3DOW A;  4YTM B;  1V9J A;  3CST A;  3DBH B;  3ZJU A;  1D3Z A;  3ALB A;  3ZUP A;  1C3T A;  3PLU A;  1WGK A;  1F2R C;  3RFZ B;  4G3X B;  5KHO A;  2WXN A;  1ZPS A;  1NI2 A;  2KHW B;  2GBR A;  4KVG B;  3L10 B;  2DWQ A;  3BVZ A;  2WHI A;  1YNT E;  3HM6 X;  3HRD D;  1WE7 A;  1WYG A;  3I9V 1;  2V9H A;  2WX0 A;  4HDO A;  5CHF A;  5IOI A;  4LLG M;  3I7K A;  4UDU C;  2BPS A;  1P1A A;  4KDI C;  2LGS A;  3UF8 A;  5BO4 B;  4OVV A;  3W1S A;  2BT6 A;  3IT4 B;  2K5P A;  2MW5 A;  2QEJ C;  1OFF A;  2WDQ B;  2ZNV C;  3RD2 A;  1I35 A;  2V3P A;  2V3N A;  3I8C A;  4B9K A;  2FBW B;  3DBR B;  3DBL B;  2K6Q A;  4MH8 A;  3L08 A;  4N58 A;  1ECR A;  1TS5 A;  1WI0 A;  1K50 A;  3M63 B;  1EF1 A;  3PRM B;  3A9K A;  4MH0 E;  4IM2 A;  4HPM B;  4W9K A;  1RLF A;  2PE9 A;  2WXK A;  3AE9 B;  3AV8 A;  4A3P A;  3DVN V;  1IUE A;  3AEB B;  4NAW B;  5BMH A;  2KDB A;  2N9L A;  1TS4 A;  2R2O A;  2JYE A;  3CSF A;  3VUW A;  5G55 A;  4W9L A;  1NEN B;  3IXS A;  4ZRK A;  2W3R A;  4AOF A;  2Y5P A;  4H2A A;  4AR1 A;  1QQR A;  4ZHO A;  2LVP A;  4LJP B;  2NPT A;  3PHW B;  4A11 A;  3N3K B;  4LCD E;  1WGD A;  1F77 A;  1V97 A;  1I4P A;  2WDR B;  4EZL A;  2IO0 B;  1GG3 A;  4XR0 A;  2CR5 A;  4LDT D;  3P1M A;  2KFK B;  4JWU C;  3H8H A;  1WMH A;  2ZCB A;  2K1F A;  2IGD A;  1EWY C;  4HCN B;  2JRH A;  2JXX A;  2SEB D;  1YJJ A;  1Q0W B;  2NCN A;  2C7M B;  3RPF C;  4W9E A;  4N9F 4;  1ET6 A;  4JWS C;  4IW0 A;  2RDG A;  1JWM D;  3ZRC A;  3VHT C;  2Z59 B;  3ZTY A;  2PIA A;  2CU3 A;  3WAM A;  1QLB B;  1D4B A;  2QCZ A;  1XCT L;  2GLS A;  2QJL A;  2L32 A;  4AR8 A;  2REX A;  1XEE A;  4L2Y A;  2BKR B;  2WP9 B;  3TUO A;  2L83 A;  3W5V B;  2LD9 A;  4RNA A;  3B2G A;  3QWZ B;  5TR5 A;  1UGM A;  4P6V F;  3SU8 X;  3PLV A;  4B0E A;  2X8X X;  3PRZ A;  4C00 A;  1QOB A;  2FE8 A;  3KUD B;  2D2Q A;  2Y6I A;  2FCM A;  1L0Y B;  3BK2 A;  1EU4 A;  4WJN A;  1ZXI A;  4AS1 A;  3UIP B;  3PZD A;  2JUO A;  2D3C A;  4I6L B;  4KX6 B;  3AXC A;  3Q3N C;  1T3Q A;  2EKE C;  3VXW A;  3AN1 A;  1TY0 A;  1SIJ A;  2NMQ A;  3A9K B;  1TZO A;  4CQN A;  1FCC C;  1EUV B;  2K22 A;  2DBY A;  3B9J A;  5G2N A;  2Z0E B;  3ZNH B;  2JPH A;  3LYY A;  1JW9 D;  3JSV B;  1V49 A;  1E10 A;  2JRI B;  4HPL B;  2C5L C;  2AX5 A;  1Q5W B;  4I6N B;  3WQZ A;  1LQB A;  2KLC A;  1IYF A;  2J7Q B;  3NZU A;  2ZPN A;  1VDV A;  1P0R A;  2NS5 A;  4RF1 A;  3IHP C;  3AU5 A;  2NPT B;  3R7R A;  2JVC A;  2JWZ A;  3NG0 A;  2M0A A;  3C8Y A;  3SD5 A;  3RFN A;  2KMC A;  3V60 A;  4W9G A;  4K3C A;  3V61 A;  2GRI A;  4RGM A;  2ZCC A;  2NVU I;  4TSS A;  5CX3 A;  1WR6 E;  3K9P B;  1ZUD 2;  1EO6 A;  2N0S B;  1WY8 A;  3E0C A;  4AWJ A;  3HM3 A;  1R4M B;  4RFB A;  1I4X A;  2PEA A;  1I4G A;  2UYZ B;  2GB1 A;  3TIX A;  2BS3 B;  2PJH A;  1E8W A;  4WJO A;  1DOY A;  2GBM A;  4NQK E;  2IPK D;  3AEC B;  4FJY A;  3N30 A;  3I7N A;  1I7H A;  3EA6 A;  2ON8 A;  4M00 A;  2WXG A;  3AEG B;  1WM3 A;  3ZRF A;  4DWF A;  5AEK B;  3A4S C;  4ITK A;  4AQ7 A;  1KOT A;  2K3U A;  1SE3 A;  1QF6 A;  1VZ6 A;  2AYO B;  3EFC A;  1YQ3 B;  5DPS A;  2LRU A;  2BB6 A;  4MSM B;  4FAD A;  1EU3 A;  3WAN A;  4XWW A;  3MFG A;  2Y50 A;  4CHK A;  2IY1 B;  4M02 A;  4YTP B;  2I06 A;  2H89 B;  1ZDV A;  4BBN C;  2KJH B;  4XDD A;  3TEY A;  1MHX A;  2WXQ A;  4XYC A;  2XN9 C;  1AWD A;  1TIF A;  2L0T A;  3L4P A;  3I63 C;  1CZP A;  1SJE D;  2NTS A;  1JCK B;  1OEY J;  3PO0 A;  2SAK A;  2YLM A;  1N5W A;  3BY4 B;  5HKH A;  1KFY B;  3P4R B;  2LGI A;  3O65 B;  4KGR A;  1P9D U;  1ZE3 D;  3PV1 A;  2FNJ B;  1R4N B;  1NBF C;  4GSW A;  1CQV A;  1SBB B;  5D3D A;  1UEL A;  3FIL A;  1N61 A;  2PW9 A;  4Q2J A;  2BB5 A;  3E9S A;  1VCB A;  4DHJ B;  3N32 A;  3I7H A;  4WWP A;  1WE6 A;  1P3Q U;  1TTN A;  1D5Z C;  3VUX A;  2BKF A;  3GE3 C;  4LNK A;  3UI3 A;  4RGO S;  4IWP A;  1P7E A;  1N5X A;  3CMM B;  4W9C A;  1T0S C;  3APD A;  4C56 C;  1XO3 A;  4K1R B;  1C79 A;  1RYJ A;  1WZ3 A;  2QIE B;  3Q14 C;  2KK8 A;  3U52 E;  2GI9 A;  2L05 A;  2L52 A;  5E6J A;  2JF5 A;  1V81 A;  2N4F A;  5LXH A;  3OWE B;  1MG4 A;  4USA A;  3P4P B;  2W82 A;  3WAP A;  2KDE B;  1C76 A;  3BIN A;  2K25 A;  4ZOH C;  1P7F A;  2G1E A;  2KVZ A;  1IGC A;  1V7O A;  4IOI E;  2ZNV B;  1KLU D;  3L13 A;  5I4D A;  3HUI A;  1GPX A;  4HJG E;  4REZ A;  2I1J A;  1ISN A;  1XLO A;  2V3S A;  1FD6 A;  2LUM A;  1FPY A;  1ZKH A;  4MT5 A;  4IM3 A;  2ZZF A;  3TMP B;  2KTR B;  4CYE A;  1E8X A;  4FA6 A;  3AE5 B;  4JQW C;  3UIN B;  4RH6 A;  1SB3 C;  3QIJ A;  4XX5 A;  4GN1 A;  2B5M A;  2NBV B;  4KGT A;  3R8B A;  2DEN B;  2B3A A;  3GE8 C;  3H7P A;  1E7P B;  2RR9 A;  1E7U A;  3APC A;  1WX7 A;  3LB8 C;  1WXO A;  1D5M C;  2HYE A;  1UUP A;  2BYT A;  2QIL A;  3ZGZ A;  2WXO A;  2PVG C;  1T6B X;  1UF0 A;  5BYQ A;  4BZA A;  2V0G A;  5JXV A;  3ZX5 A;  5D94 A;  3EHV A;  1N62 A;  1E8Z A;  3MC8 A;  1ZDX A;  1MVK A;  3EC8 A;  3PTF C;  2VH1 A;  4B6W A;  2DYM A;  2HTH A;  2LHD A;  3DBL I;  1XD3 B;  3ZYY X;  1S3S G;  4NAW A;  3NVY A;  1NEK B;  4N59 A;  2O6V A;  3MTN B;  3MJ5 A;  2BQQ A;  1OQQ A;  2KX0 A;  4ICV A;  4US9 A;  5FK9 C;  2DNF A;  3FC4 A;  2L8J A;  1N6Z A;  4O1N A;  1SF0 A;  3RT3 B;  3HIZ A;  2VZK B;  5AUK A;  3OJ4 B;  1FEH A;  4RM9 A;  3W1Y A;  5AZF A;  4PYU A;  1V2Y A;  5EE3 A;  4DXA B;  3OJ3 A;  5HFY A;  3I7O A;  3NS8 A;  2IO3 B;  1SE9 A;  4XE0 A;  1Q1O A;  2KFK A;  4PYZ A;  3PZ7 A;  1HEZ E;  2MCN B;  1JRO A;  3GZN B;  4GDL B;  3ETR A;  4ACF A;  2DYO A;  2J0J A;  2NBU A;  5IA7 A;  4MEL A;  4LNI A;  2L7R A;  3QAQ A;  5E6O A;  2FID A;  4ANX A;  4CI1 A;  1LM8 B;  2DAF A;  3TJP A;  2EEL A;  2CU1 A;  2UU7 A;  3ZW7 A;  3I5J C;  4BKG A;  2KWC A;  1UZX B;  1V8C A;  3MHS D;  4W9H A;  1TKE A;  2AL3 A;  3PSE B;  1CJE A;  3V6C B;  2KWD A;  1YQ4 B;  3ZLZ A;  2WWZ A;  1IP9 A;  2PPH A;  3L17 A;  3D32 A;  1YX5 B;  4OZC A;  1I4Q A;  3O13 A;  2V1Y A;  1JWB D;  3H7P B;  3H7S A;  2DZJ A;  1NYR A;  4RGN A;  4NZL B;  4YSZ B;  2MH7 A;  4XWT A;  1F52 A;  4ZRP A;  1WXA A;  1DYQ A;  1PDX A;  2M4N A;  2YEP F;  4PS3 A;  1GC6 A;  2WXF A;  2C60 A;  3QK0 A;  3TBL D;  4CI3 A;  4M0W B;  2BYE A;  2D3G A;  1WZ0 A;  1KLG D;  3RHU A;  3B0A A;  2EWJ A;  3BYT B;  4TMA B;  4XDC A;  1STE A;  4EEW A;  1TS2 A;  2LGD A;  2PE6 B;  3C0R B;  1UWM A;  4KZ0 A;  3ZJV A;  2JXT A;  4IM0 A;  3V3X A;  1KH0 A;  1TGZ B;  1JQ4 A;  3PS6 A;  2MBE A;  1T0R C;  2O6V B;  2GOW A;  4JX1 C;  3JSV A;  5CHW A;  4MJS B; 
#chains in the Genus database with same CATH homology
 3AH7 A;  2CJO A;  4RF1 A;  3AM9 A;  4DXG A;  4P16 A;  5TSS A;  1UWX A;  3IT6 B;  1L5P A;  4WAF A;  2LMC A;  3AEF B;  1FRD A;  1VZ8 A;  2JYT A;  1Y56 A;  2M0A A;  1YN4 A;  2VZK D;  2WXJ A;  3C8Y A;  2I2Y A;  3BWU D;  3RFN A;  2J4X A;  4US8 A;  2RMM A;  4HEA 1;  3WCQ A;  4HRS A;  1PGX A;  2GRI A;  2IUS A;  1B1Z A;  2H88 B;  4RGM A;  3W2D A;  1QIL A;  4KGS A;  4TSS A;  1BML C;  1QKZ A;  1RM6 C;  2BTE A;  1ZUD 2;  2KAC A;  3SFD B;  3U4E G;  2N0S B;  3BYY B;  3AE7 B;  1ROE A;  3BVG A;  3E0C A;  5BYR A;  4RFB A;  3MHZ A;  4OZB A;  2R61 A;  3AE4 B;  3EI2 A;  1I4X A;  3AE6 B;  1I4G A;  3NRZ A;  2GB1 A;  2LEK A;  3AEE B;  2PKO A;  5BMG A;  2ZZE A;  2BS3 B;  4EE2 A;  5C3J B;  2INP E;  1D5X C;  1N63 A;  5G5H A;  1DOY A;  1UNS A;  1ZOY B;  1SE4 A;  4JE3 B;  4PT5 A;  1QOG A;  5HHD G;  2IPK D;  3AEC B;  3I8E A;  2J42 A;  1C4C A;  2INN E;  3I7N A;  1I7H A;  3J9C A;  3EA6 A;  4ZYS A;  2ON8 A;  2OHF A;  1SEB D;  1ENF A;  1J7A A;  4FXC A;  4J3O D;  3EI4 A;  2WXG A;  1QOA A;  3BK1 A;  4YWG G;  3VQI A;  2KMM A;  3AEG B;  1TYG B;  3P63 A;  1YMH E;  1FNW A;  4ITK A;  2Z8L A;  3VRB B;  1PGA A;  4AQ7 A;  4A09 A;  1ACC A;  1VJK A;  5EE9 A;  2ZTG A;  2K3U A;  3T3O A;  1J7B A;  1SE3 A;  1QF6 A;  5BYS A;  1VZ6 A;  1YQ3 B;  2I38 A;  2BB6 A;  4TQ1 A;  2JQR B;  1NYQ A;  1EU3 A;  4A08 A;  4XWW A;  3MFG A;  4WQM A;  2Y50 A;  1ZXH A;  2RPV A;  5H92 C;  3P4S B;  4WUR A;  4YTP B;  2I06 A;  1ET9 A;  3AE8 B;  2H89 B;  1ZDV A;  4YTN B;  2MJD A;  4XDD A;  3TEY A;  3P42 A;  2PLP A;  1MHX A;  2WXQ A;  3W5U B;  2XN9 C;  4ARC A;  1GB4 A;  4A6Q A;  1AWD A;  4ARE A;  4B0M A;  1N60 A;  3L4P A;  1FXA A;  4RF0 A;  1CZP A;  1SJE D;  1TJE A;  2NTS A;  1MI0 A;  1VR9 A;  2NTT A;  2B5L A;  2AQ3 B;  3IAS 1;  1JCK B;  2KQ4 X;  1IBX B;  3W9C B;  4C80 A;  3PO0 A;  4NJC A;  5FQD A;  2SAK A;  1KTK A;  1BUI C;  1N5W A;  2Q5W D;  1FFV A;  1IBX A;  2WXM A;  1KFY B;  3AB5 A;  4WIP A;  2N7J A;  4A0A A;  1SXT A;  1C4A A;  3P4R B;  2LGI A;  1FNV A;  2B76 B;  3SR6 A;  4KGR A;  1FIQ A;  2WS3 B;  1QT9 A;  2LJI A;  1GB1 A;  1ZE3 D;  5FKA C;  5D7G A;  4A9A A;  2J52 A;  4XR1 A;  1RFK A;  3NVW A;  4HRO A;  2ZW0 A;  4KKJ A;  2N9K A;  3NUH B;  3FIL B;  1D6E C;  3MC0 B;  2PVO D;  4YT0 B;  4RCO A;  1CQV A;  1XF5 L;  1SBB B;  4YSY B;  5D3D A;  3FIL A;  5D3I B;  2QSD A;  1N61 A;  1ZP0 B;  2IJ0 A;  4E5Z A;  2M56 B;  2PW9 A;  1WSP A;  4WWM A;  4Q2J A;  5HG2 A;  1XXG A;  1DGJ A;  3SFE B;  2BB5 A;  1E9M A;  2ICI A;  3E9S A;  3R2I A;  4R3D A;  3SEB A;  2Y3U A;  3I7H A;  1EWC A;  5GXG B;  1C78 A;  2JU6 X;  4JPS A;  1D5Z C;  1C4P A;  2JWU A;  3GS2 A;  2X38 A;  4A55 A;  2BW2 A;  3UI3 A;  2E3T A;  4RGO S;  2FUG 1;  3NZ3 A;  3AE3 B;  1NVI D;  1P7E A;  4MM3 B;  1N5X A;  3AE1 B;  1HQR D;  2EKI A;  1F0Z A;  3CIR B;  1PFD A;  1SJH D;  4C56 C;  3BII D;  1XLP A;  4WH4 A;  3VRA B;  1XO3 A;  1LO5 D;  4CI2 A;  4HKQ A;  1C79 A;  2JSV X;  1KRH A;  1RYJ A;  2QIE B;  4GDK B;  4L1B A;  3Q8A A;  2Y3A A;  1B9R A;  2LFI A;  3U52 E;  2GI9 A;  3TSS A;  3I89 A;  2AQ1 B;  2L52 A;  5E6J A;  1L4Z B;  4D2K A;  1DOX A;  1FO4 A;  4XR2 A;  1JWA D;  1V1O A;  3OWE B;  3Q69 A;  4USA A;  1I4R A;  3P4P B;  2DLB A;  2L1A A;  3I7P A;  1MPE A;  1TKY A;  2W82 A;  4N6E B;  2IUT A;  1K53 A;  3DWM A;  2BS4 B;  1F2R I;  1TY2 A;  2KN4 A;  2WXH A;  1C76 A;  4YTM B;  1KF6 B;  3ZJU A;  4LTU A;  1J7C A;  2HTM E;  4ZOH C;  1P7F A;  2G1E A;  1FRR A;  5EE1 A;  3T3N A;  1IGC A;  3NVV A;  1V7O A;  3AEA B;  1AW7 A;  1GAQ B;  1WGK A;  1BXT A;  3NVZ A;  1F2R C;  3RFZ B;  2WDV B;  4IOI E;  1KLU D;  1XLN A;  5I4D A;  1HZ5 A;  1CK1 A;  3HUI A;  2WXN A;  4HJG E;  1GPX A;  4REZ A;  1ZPS A;  2W54 A;  3KEW A;  2D5G A;  4A0B A;  3I57 A;  1XLO A;  2DWQ A;  2ACZ B;  3BVZ A;  1FD6 A;  1AYF A;  2LUM A;  1YNT E;  3HRD D;  4MT5 A;  1EM7 A;  1WYG A;  3U2S C;  4KKI A;  2ZZF A;  2LHE A;  2OED A;  3I9V 1;  1HA5 A;  2WXI A;  3AE5 B;  1JWU D;  4LLG M;  4RH6 A;  1SB3 C;  4UDU C;  3I7K A;  3BVM A;  2B5M A;  3W1S A;  2XNA C;  3VR9 B;  1R7S A;  4KGT A;  3R8B A;  2BT6 A;  3B2F A;  3IT4 B;  4AR9 A;  2K5P A;  2E6X A;  3EGR A;  1E7P B;  2QEJ C;  1OFF A;  2WDQ B;  4XR3 A;  2PTL A;  3LB8 C;  1K52 A;  1WXO A;  2V3P A;  2V3N A;  3I8C A;  1D5M C;  2HYE A;  1UUP A;  2FBW B;  2MJ3 A;  4TQ0 A;  2BYT A;  1FFU A;  2QIL A;  2ZW1 A;  5BMI A;  3ZGZ A;  2WXO A;  2PVG C;  1T6B X;  4MH8 A;  4HKZ E;  5BYQ A;  4N58 A;  2V0G A;  1OQR A;  5JXV A;  1JWS D;  3Q8E A;  1ECR A;  1TS5 A;  1N62 A;  1K50 A;  1JRP A;  1ZDX A;  1E6E B;  4YXD B;  4A90 A;  4ZRQ A;  2JX5 A;  1MVK A;  1XLQ A;  4LK0 M;  1TKG A;  4OZA A;  2WXK A;  3AE9 B;  3AV8 A;  2WXP A;  3AEB B;  1IUE A;  5BMH A;  4NAW B;  2DYM A;  2N9L A;  1FNU A;  4IDI A;  1TS4 A;  3P4Q B;  2KDM A;  2JYE A;  5MPO A;  2LHD A;  3ZYY X;  2WQY B;  3KLS X;  3V05 A;  3TEX A;  3NVY A;  1A70 A;  1K51 A;  1NEN B;  1NEK B;  3IXS A;  4E54 A;  3BZD B;  4N59 A;  1UGJ A;  2W3R A;  1TS3 A;  2WU2 B;  3MJ5 A;  1OQQ A;  2Y5P A;  3IAM 1;  4H2A A;  4AR1 A;  3ABV B;  1QQR A;  1VRA B;  5H8Y E;  2G9H D;  5G5G A;  4ZHO A;  4US9 A;  5FK9 C;  3FC4 A;  4O1N A;  3KQ4 A;  1SF0 A;  2W3S A;  4C7Y A;  2K9X A;  4A11 A;  1JAL A;  1V1P B;  2AQ2 B;  2VZK B;  1WNU A;  5AUK A;  2J53 A;  1F77 A;  1FEH A;  1L0V B;  2CJN A;  1V97 A;  3PZ8 A;  1V1P A;  1FCL A;  1I4P A;  1AN8 A;  2WDR B;  4ARF A;  2QMT A;  5EE3 A;  3EI1 A;  1PGB A;  1YJI A;  3HVZ A;  5HFY A;  3I7O A;  2IUU A;  1I4H A;  1C77 A;  4XR0 A;  4XE0 A;  1FXI A;  1QOF A;  3P1M A;  4JWU C;  3CWI A;  4TZ4 A;  3H8H A;  1DOI A;  3ZJT A;  2ZZG A;  3EI3 A;  1VZ7 A;  3PZ7 A;  1HEZ E;  1YN5 A;  1JRO A;  2YEP B;  2IGD A;  4YSX B;  3GB1 A;  4GDL B;  1GOZ A;  1EWY C;  3ETR A;  2DYO A;  4IKG A;  2SEB D;  1YJJ A;  1V4P A;  3RPF C;  1ET6 A;  2MEK A;  4JWS C;  4CI1 A;  1Q10 A;  2RDG A;  1JWM D;  2EEL A;  3VR8 B;  2WXR A;  2TSS A;  3Q8C A;  3FAH A;  2IGH A;  2PIA A;  2KAJ A;  2E1B A;  4L23 A;  1SSN A;  3AE2 B;  4ARI A;  1WRI A;  1L4D B;  1YN3 A;  1NI3 A;  2CU3 A;  1QLB B;  1V8C A;  1C9F A;  1D4B A;  1XCT L;  2QJL A;  4GLS C;  2L32 A;  1TKE A;  2JZP A;  4AR8 A;  1XEE A;  4L2Y A;  2WP9 B;  3Q8B A;  1CJE A;  5C2T B;  3TUO A;  2KWD A;  2L83 A;  3W5V B;  4RNA A;  1YQ4 B;  3B2G A;  2WXL A;  3Q8F A;  1WXQ A;  4P6V F;  1T5X D;  2RDH A;  2IGG A;  2W55 A;  4B0E A;  3TEZ A;  4OZC A;  5T8I A;  1I4Q A;  2HDE A;  4MAC A;  5AUI A;  3O13 A;  1JWB D;  1RWS A;  1QOB A;  1FMA D;  3KWV A;  2FE8 A;  1NYR A;  4RGN A;  1L6U A;  4NZL B;  4NAM A;  4YSZ B;  2MH7 A;  4XWT A;  4ZHP A;  2WLB A;  2Y6I A;  2K0P A;  3ZQ4 A;  1L0Y B;  3BK2 A;  1EU4 A;  3HVD A;  1ZXI A;  4AS1 A;  3URY A;  3TEW A;  1IGD A;  4ZRP A;  3GP7 A;  1DYQ A;  1PDX A;  2YEP F;  4A8X C;  1HZ6 A;  1FM0 D;  2V4I B;  2WXF A;  4CI3 A;  3U7Z A;  4DXF A;  4KX6 B;  1SE2 A;  5LNK 1;  1WWT A;  3I7L A;  1KLG D;  3MP9 A;  1T3Q A;  3RHU A;  5FR3 A;  4M0W A;  3KWL A;  2EWJ A;  3AN1 A;  1TY0 A;  1SIJ A;  2NMQ A;  3BYT B;  1TZO A;  3R2T A;  4CQN A;  4TMA B;  1FCC C;  3EUB 2;  4XDC A;  1STE A;  2ONQ A;  2MJE A;  3AED B;  3N9Y C;  1TS2 A;  4DQO C;  2K22 A;  2PMV A;  4OVZ A;  4OHJ A;  1XCQ L;  2DBY A;  3B9J A;  1JML A;  1UWM A;  5EE0 A;  1ESF A;  5HI1 A;  3ZJV A;  3LYY A;  1JW9 D;  4OW0 A;  2JXT A;  3AMZ A;  1E0Z A;  1M4V A;  2Y5C A;  2IDY A;  1KH0 A;  1PYW D;  4RGT A;  3V3X A;  1PUT A;  1E10 A;  1L6V A;  1L0X B;  2AX5 A;  1JQ4 A;  1MHH E;  2M19 A;  3E56 A;  4JX1 C;  3WQZ A;  1HXY D;  3LXF A;  2BBC A;  2BS2 B;  3DWG C;  3NS1 A;  2I05 A;  2WNM A;  4C7Z A;  1VDV A;  2WU5 B;  1VLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...