1TJEA

Crystal structure of the editing domain of threonyl-trna synthetase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Threonyl-tRNA synthetase
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tjeA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tjeA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tjeA02
1N61A 4JWUC 2KMMA 2N0SB 3P1MA 1RFKA 4YTPB 1JW9D 2DBYA 3AEGB 1DOIA 4USAA 4YSZB 1J7BA 1KFYB 1V7OA 1L6VA 3RHUA 3AE2B 2WP9B 3KWLA 3P4RB 1FXAA 4YT0B 3SR6A 2DWQA 1V4PA 2MJEA 4YXDB 1WXQA 2CU3A 1E6EB 4YSYB 1CJEA 3RFNA 2EKIA 2QIEB 3HRDD 3AM9A 1OFFA 2BS4B 1L5PA 1AWDA 2FBWB 1EWYC 2WLBA 3VRBB 5C2TB 1T3QA 3CIRB 1JQ4A 3NVYA 4JX1C 3W5VB 1TKEA 3AN1A 1FFUA 2W54A 4HRSA 1NENB 1JRPA 1L6UA 1WGKA 3AE5B 3LB8C 1V8CA 3VRAB 1NVID 4N6EB 1PFDA 3AEEB 3VR9B 1N5XA 3AEAB 1A70A 1FMAD 1VDVA 5EE9A 2BS2B 3RPFC 1TKGA 2OHFA 3PO0A 2K9XA 1WYGA 2H88B 3BIID 4C7YA 1DOXA 3LXFA 1NEKB 1XLQA 1SB3C 3B9JA 2W3RA 2ZZGA 2B76B 3SFEB 1KRHA 1QOFA 2H89B 2JX5A 2M56B 3NRZA 1QOGA 3AE9B 2HTME 2WQYB 3AE7B 3B2FA 1WWTA 1VJKA 1JALA 1E9MA 1OQRA 4JWSC 1XO3A 2W55A 4P6VF 3AE8B 3HUIA 2WDQB 3KEWA 1ZXIA 1JWBD 1RWSA 5EE3A 5G5GA 4C80A 1R7SA 2WU5B 2AX5A 2E1BA 1FO4A 1N63A 2PVGC 3AEFB 1AYFA 1VLBA 2JQRB 1PUTA 3L4PA 3NVVA 3W5UB 1L0VB 1TKYA 4WQMA 5EE0A 5G5HA 1E0ZA 4US8A 2ZZEA 2L83A 1QLBB 1J7AA 1JWAD 2CJNA 2MJDA 3AB5A 4US9A 1I7HA 4ZHOA 4ZHPA 2MJ3A 3HVZA 5H92C 3P4QB 1XLOA 1N60A 3AV8A 3SFDB 1ZOYB 1JROA 3AE4B 2WDVB 2W3SA 3AEBB 3NVZA 2LEKA 2PKOA 1ZUD2 1WNUA 1J7CA 1IUEA 2CJOA 2G1EA 5AUKA 3AEDB 1N62A 1NYRA 1ZP0B 2WS3B 1FXIA 4YTNB 2Q5WD 3ETRA 4HROA 1N5WA 1FFVA 2KAJA 3AE6B 2BT6A 2PVOD 1E7PB 4KX6B 1E10A 2BS3B 3FAHA 3FC4A 1XLNA 1TJEA 1RM6C 2L52A 3AMZA 4IDIA 1CZPA 1GAQB 3VR8B 1ROEA 3P4PB 4YTMB 2PIAA 1YQ4B 3AECB 1QT9A 3ABVB 5C3JB 1RYJA 4ZOHC 2Y5CA 1DOYA 1V97A 1QOBA 1SF0A 3B2GA 1WXOA 1F0ZA 1YJIA 2WDRB 2ZZFA 1DGJA 3P4SB 3DWGC 2K22A 2WU2B 2MH7A 3CWIA 2ACZB 1UWMA 3AH7A 3EUB2 2K5PA 4YSXB 3DWMA 4C7ZA 1FIQA 1B9RA 1QOAA 1TYGB 1NYQA 3NVWA 1YQ3B 3WQZA 3NS1A 3ZYYX 5MPOA 1PDXA 3AE3B 1GPXA 1OQQA 5AUIA 5EE1A 1KF6B 4N59A 5H8YE 1XLPA 1FRDA 2ZTGA 4ITKA 5GXGB 1SIJA 4A9AA 4FXCA 3WCQA 1WRIA 1FM0D 4N58A 1YJJA 3P63A 4WWMA 2QJLA 3AE1B 1FRRA 2M19A 4LTUA 1QF6A 2E3TA 1NI3A 3W9CB
chains in the Genus database with same CATH superfamily
1JW9D 3Q3MC 3EI2A 4EZJA 1YJ1A 4ANVA 2K8BA 3Q8FA 1OGWA 1WMHA 1L4DB 4P1CC 3RNEC 3MJWA 4BKSA 3ZWKA 1FCCC 1TKEA 2LRUA 3KH0A 1E7UA 1WGGA 3T3OA 3Q2AC 1UELA 4WJPA 1GC6A 3RPFC 3BIID 1RFAA 1QQRA 3W1SA 1KRHA 2JX5A 2KYWA 2MBEA 2L0TA 2C60A 1HZ6A 3GS2A 1MG8A 1OQRA 2J53A 1IYFA 2WDQB 1RRBA 4H2AA 1JWBD 3GP7A 5DPSA 1KLVA 3RMKC 3SD5A 1FO4A 4WIPA 4LNNA 1V5TA 2I1JA 2GLSA 2CU1A 4HPLB 1IP9A 2WXFA 4DK5A 2MQJA 1LGRA 2REXA 3ETRA 2WX1A 5E6PA 4YWGG 1K53A 4HROA 3WAPA 2INNE 2N1WA 5FR6A 3MJ5A 2LXAA 4K81A 3R8BA 5DCNA 1LFDA 1UF0A 2VZKD 2YEPF 4W9EA 4IM2A 1C1YB 1D5XC 2UU7A 3I7KA 1QT9A 4GU2A 4E74A 4FJYA 2EMSA 1DGJA 3RD2A 1GB1A 2BQQA 2D11A 2ACZB 3TMPB 2FUHB 4WAFA 2MBBB 3GE3C 2ZCCA 1Q1OA 3NOBA 4LJPB 4URKA 3ZW7A 1R4NI 2RDHA 1YN5A 4JWUC 1V86A 3AEGB 1IPGA 3ZWDA 1KFYB 1JWSD 4RNAA 2BYVE 4KGTA 1WYWB 4C00A 2JYTA 1WXQA 2KQ4X 2KWCA 4DXFA 2WXLA 2FBWB 5FR3A 4TV3A 4KIKA 3T9LA 1Q5WB 3LB8C 1RAXA 4N6EB 3AEAB 3PZDA 3ZTWA 3H1UA 3R7RA 2N7DA 3ALBA 4C7YA 2DZJA 2BYEA 4L23A 3AE9B 5D6JB 1E90A 4DHZE 1WFYA 3B0AA 1V80A 3I3TB 3CF6E 1F52A 4IOIE 3L4PA 1PUTA 2XN9C 2KVZA 4KKIA 2Z0EB 3PV1A 3AB5A 4GLSC 2KWUB 4IWOA 4TUUA 4C4VA 2G4DB 3AEBB 4PT5A 4KGRA 3L13A 1J7CA 2QC8A 1P1AA 3DCGA 2FUG1 4YTNB 4A90A 1SJED 1C79A 3IG3A 1WRDB 1FFVA 4JLCA 2X38A 3VFKA 3TSSA 4F1SA 3PZ8A 1TJEA 5D7GA 4YTMB 1KTKA 2PIAA 3MC0B 4MGKE 1N6ZA 2NVUI 1DOYA 3TJPA 4OVUA 1SF0A 4NZLB 1HE8A 4P1BC 3N20C 1TZOA 3CWIA 4MJSA 1XF5L 3DWMA 5FQDA 1FIQA 1LO5D 2FCNA 2QEJC 2FCMA 5MPOA 3MHSD 1MFWA 3L17A 5BO4B 3U4EG 2MWSB 3WCQA 4A55A 4LLGM 4RGOS 1P3QU 5LXIB 4W9HA 3BVGA 5EDSA 2WP9B 4BAXA 2JWZA 1FXAA 2QSDA 2V3SA 2KDEB 3SR6A 3AU4A 4BOSC 2XNAC 4NJCA 2I05A 3HRDD 3PVLA 1X1MA 3VRBB 5L83A 3BYYB 4RM9A 3NVYA 1L6UA 2LUEA 1VDVA 4C56C 2VZKB 3EFUA 2ON8A 1UNSA 4A0AA 1PGBA 3VDZA 4LNFA 4RCOA 1E9MA 3VTWA 2RDBC 1XO3A 3CSFA 2PMVA 2K0PA 4RM8A 4E54A 3MC9A 3TIXA 4FJVB 4E5ZA 4ANXA 4A3PA 4MM3A 3PPAA 5AZHA 1ACCA 2WU5B 2IY0B 1KLUD 1VLBA 2AEHA 4W9DA 1VCBA 2UYZB 3NUHB 3N32A 1UWXA 1J7AA 2MJDA 1WI0A 4ICVA 4ZYNA 1XEEA 2MA9B 1P98A 3AV8A 3JSVB 3BVMA 3ZJUA 3NVZA 5D3DA 4XGAB 2J52A 3MHZA 3DPDA 2X8XX 2O6VD 1TGZB 1ECRA 4LNIA 2NR2A 1V6EA 2WXMA 2ZZPB 2KT7A 4II2B 2FAZA 4ANUA 1K51A 1EM7A 3AI5A 2FNJB 1D4BA 2IUUA 2BYTA 2IJ0A 4G50A 3ZUNA 4KZCA 1WXSA 2MSED 3UF8A 2Y50A 4XWWA 4LJOB 3NS1A 2L32A 2RPVA 4OZBA 2JSVX 3GOEA 5H8YE 4ITKA 2FIDA 2PW9A 4FXCA 3UQAA 3W1SC 2EKEC 2JXXA 4IG7B 2LGIA 2KJHB 4II3B 3KWLA 2KWVB 4IUMB 2Z59B 2ZOSA 3I7NA 2C5LC 1BXTA 1E8WA 1UGJA 2KZRA 4FULA 3T8MA 1WZ3A 4WAAA 2DZMA 4P7IA 1WZCA 1FFUA 1IBXA 1NVID 1I42A 2WXKA 2NMQA 3VXWA 5IOIA 5EE9A 1EUVB 2JVCA 1DOXA 2KLGA 2HE7A 3M3JA 3V62A 1C77A 2Z0DB 1SXTA 4KVGB 3PT2B 2KTFA 1UD7A 3PRPB 3IVFA 3RULA 3KEWA 3E0CA 2KTRA 1H4RA 2BGFA 2MW5A 2CKHB 1R4MB 2GRIA 2MBHA 4LNKA 1TS4A 1N63A 1I4XA 3SU8X 2BWES 2JUOA 3BWUD 4ASWC 2C7HA 4GGQA 3NJTA 1JWAD 3I7HA 4ZHOA 1I7HA 3PGEA 2W9NA 2W3SA 3UQBA 4ZDVA 3OWEB 3N1YC 1YD8U 1PGAA 1MI0A 1IUEA 2KDBA 2VH1A 4XR1A 3PSEB 4KZ0A 3QA8A 3I7PA 1WJ4A 2AL3A 3VHTC 2DYOA 4HJKA 3FILA 1V2YA 3H6NA 1WXMA 2BBCA 3A1QA 2INCC 2VH2A 1HTQA 3ZUPA 1WZ0A 4KV2A 4CQNA 2BTEA 5BMIA 4DDGD 4G11A 4A09A 4XC2A 5JHBA 5AEKB 2INPE 4PS8A 4MGZE 3V6CB 2RSUA 4NJ6A 2AYOB 3PHXB 2K39A 3P42A 2GBRA 4N59A 2ZTGA 3V3XA 2L7RA 1WRIA 1FRRA 2M19A 3DVNU 1QF6A 1T0QC 1P7EA 3W9CB 4EKUA 3A9JA 4AJWA 5E6NA 2DBYA 5I4DA 1OEYJ 4LDTD 1J0GA 1ZPSA 3PLUA 2WXHA 1GB4A 4HKZE 2LVOA 4GSWA 2AQ2B 2Y3AA 3DHGC 3IAM1 4TKNA 1L5PA 4HEA1 3ZRCA 3NZ3A 1CQVA 2O6VB 2ZW1A 1ENFA 2AL6A 2D3AA 1N5XA 4EE2A 1TKGA 2K9XA 2LGDA 2GBMA 2W3RA 2ZZGA 4DQOC 3QAQA 2WQYB 1IGDA 1EF5A 3ZGZA 1VZ7A 2JZZA 4GOCA 2WXRA 2PVGC 4MSMB 1AYFA 1UBIA 3QQ8B 1C3TA 4US9A 2V0GA 4DBGA 2SEBD 5H92C 5DPTA 5BYSA 3AE4B 2I06A 2D3CA 1I35A 1SSNA 1PYWD 2KDFB 2QHOA 3SEBA 1CK1A 2ZW0A 2V1YA 2MLBA 2GB1A 1XT9B 2L0FA 3RNAC 2PVOD 2XEWA 2BS3B 2BW2A 1GAQB 3X0WA 3LJ3A 2PTLA 3EHVA 2R61A 2UWQA 1LM8B 3H8HA 3BZDB 1HZ5A 1L7YA 4M0WB 2GI9A 2XBBC 1GOZA 4C7ZA 1V5OA 1YQ3B 1PDXA 3APFA 2K6QA 2LI5A 2LVPA 3R7QA 2YLMA 3VAWA 1XCTL 4XX5A 2QJLA 4KSKC 4GB9A 1TTNA 3P1MA 3ZXVA 4OZAA 2A4ZA 1FEHA 1RLFA 4ARFA 3UGBB 1C4AA 2QIEB 1UZXB 2ONQA 2WXPA 3DHHC 2KFKB 2PE9A 3HM3A 1A70A 2BS2B 3ZNID 3DBRB 3ZW3A 1XLQA 2Y5PA 3EI3A 3BYTB 3VR8B 2BVCA 2G45B 3BK2A 3VUYA 2HJ8A 1YN4A 3DVGX 3GB1A 4LK0M 2V3PA 2MCNB 3RNBC 4CHKA 1STEA 4OVZA 4AJYB 4GN1A 3O13A 3QCAA 1E5WA 4BZAA 1QLBB 2PE6B 1N60A 3DVGY 5G55A 3M62B 4FBJB 4LDTB 2G1EA 3A33B 2O2VB 3ZDMC 3ONSA 5CTRC 2MP2A 3VH4B 3AE6B 2M17A 4KX6B 1XD3B 4BKSD 1MVKA 3AMZA 1CZPA 5D3IB 2QCZA 2KNBA 3H7SA 2JYEA 1R4MI 4ZOHC 1L2NA 1C76A 4HCPB 3S2AA 1A5RA 3A9JB 2LVQA 2BPSA 3BVZA 5LNK1 2SAKA 1ZKHA 3ZQ4A 1B9RA 4M8MA 3B1LX 3ZLZA 5KHQA 1KM7A 3VH3B 2KN5A 1YJJA 2G4SA 2V9HA 2B5MA 4FHKA 3WALA 3A4SC 4GDKA 4USAA 1DOIA 4M00A 2W82A 1V1PA 4R3DA 4M8NA 2MEKA 3QWZB 1L0XB 2HDEA 4EEWA 4M02A 4ZRKA 2WLBA 1WGHA 3RZFA 3AN1A 3VRAB 2Z8LA 1KOTA 2AQ3B 2M0AA 5BMHA 4MH8A 4W9CA 1WE6A 1WYGA 2H88B 1P7FA 2IPKD 3A9KA 1WM3A 3I9V1 3PREA 1S3SG 2D5GA 3KWVA 4AUQC 4C80A 3PTFC 1E7VA 2JQRB 1FPYA 2J7QB 3AEFB 3ECIA 2KXJA 4US8A 3ML8A 2NPTB 4HCNB 4A08A 4RMAA 1SE2A 1K52A 2XK5A 2N9LA 1WNUA 2L00B 2HJ1A 4J6IA 1ZP0B 3APCA 4TZ4A 3M63B 1OTRB 4PYZA 2NBWB 5JH5C 4S0RA 1OEYA 3WIMA 2EWJA 2KQ7A 3H7PA 3TBLD 3N9YC 2RMMA 2A5UA 1TS3A 4LNOA 4P16A 4TMAB 3KUDB 1WXOA 2ZZFA 2LJIA 3Q3FA 2KACA 5HFYA 1WIAA 4HVBA 1T6BX 2K25A 2KO3A 4BBNC 1E8ZA 1FNWA 1Y56A 3W1YA 1D6EC 5D2MB 2IGHA 4ZRIA 4RF1A 1FM0D 4OZCA 2B3AA 3RFNA 2N0SB 4DXAB 2WXGA 1JMLA 1L6VA 4JPSA 1C78A 1GUAB 3BY4B 3TUOA 1V49A 2G3QB 3OJ3A 1C4PA 3RYTA 4JX1C 1NENB 3AE5B 1WMHB 2L05A 4A11A 1PFDA 3ZNHB 1T0YA 4QAYA 4YL8A 3Q3JA 3KVFB 1ZGUB 3HVDA 2DENB 5BYRA 4FN2A 5IAAC 2M1MA 4S17A 1GJZA 5G5GA 2BB5A 3C19A 3WA0A 1PQSA 4ANWA 4AR9A 1YNTE 1L4ZB 1VRAB 2LFIA 4WQMA 3V05A 1BUIC 2CJNA 4E3CA 3NHEB 3HVZA 3P4QB 3WANA 4HPMB 4EFOA 1GC7A 2CJOA 3QX1A 1VZ6A 3U7DA 5AUKA 3DBRI 5HG2A 3BINA 2KD0A 3N1XC 1NI2A 1YIWA 2D3BA 3ZU6A 1WJUA 1S1QB 4KDIC 4WJOA 2LHEA 4CYEA 1TY0A 3R66C 2KX0A 5C1ZA 2Y5CA 3KQ4A 2BF8B 5E6JA 5TSSA 1Q10A 3DWGC 3AH7A 4RF0A 1QOAA 2IO3B 3H9DA 3PZ7A 1YOVB 3NVWA 4IWPA 1NBFC 2JRIB 1OQQA 4NAWA 1KF6B 1FNUA 1FRDA 3P2BA 1B1ZA 3TCAA 4MDKE 2K6DB 4CI3A 3UI3A 1MG4A 1FD6A 2KMMA 1D5ZC 2C7NB 3D32A 1YQBA 4YSYB 4BBNF 2KOXA 2VRRB 1WF9A 3JYUA 3IT4B 2N7JA 4WJQA 3RZWC 3W5VB 2W54A 4KKJA 4K1RB 1JWUD 1JCKB 1D5MC 3AXCA 3B08A 1ZDXA 4WQOB 4KIKB 1HEZE 2WGSA 1SB3C 1T0RC 3DBSA 2CS4A 2WYQA 4HLEA 5DPRA 2IGGA 5D94A 2GBJA 1K8RB 4A6QA 5TR5A 3OJ4B 4AR8A 3HIZA 3ZRFA 2RGFA 1E0ZA 4CI1A 3U30A 4ZHPA 5JHAA 2V4LA 1WJNA 1WGYA 3SFDB 4F8CB 2J4XA 3DBHB 1QILA 1SE3A 4C4VB 4AS1A 2WDTB 2IO1B 2KAJA 3KYDD 3ZX5A 1XLNA 2KQSA 4EUTA 3JW0X 3AECB 4W9LA 2L1AA 1RYJA 4RH6A 4AP4C 3BK1A 4XWTA 3QJZA 3K9PB 4JGHB 4FADA 4RGMA 2MH7A 4ICUA 1P0RA 1GG3A 3DVNV 3EC8A 3TEYA 3PRMB 5AUIA 1VZ8A 4MJSB 1KLGD 2V3NA 4XYCA 3MC8A 2E3TA 1NI3A 1N61A 4YSZB 1TS2A 4NQLB 3RHUA 3AE2B 3Q8CA 3RUIB 3I63C 1V4PA 4YXDB 2MBOA 1ZE3D 4TSSA 3I8EA 3KYCD 4RGTA 3AM9A 3CMMB 3ZO5B 1EWYC 2KDMA 1YN3A 4HRSA 4FJZA 4N9F4 1DYQA 2NTSA 4JQWC 3AEEB 4J3OD 1I4GA 4HJGE 3U2SC 1IGCA 1NEKB 3VTVA 2N9XA 3DOWA 4NQKE 1QOFA 1TT5B 2WXJA 4GMVA 2CHWA 4XDCA 4OW0A 1J19A 2L76A 2LD9A 2K1FA 3U52E 1Z5SB 2KWDA 1WX9A 3N1ZC 3MP9A 4BOZB 2D3GA 4OHJA 4HKQA 4MM3B 3IT6B 3GZNB 2JXTA 3WAOA 2M4NA 1WSPA 3FKYA 1ZOYB 2M0XA 4IC7B 2WXQA 1TIFA 3U8ZA 1SE9A 5G2NA 1N62A 1P9DU 4MH0E 2DYBA 5IKCM 5JXVA 1XVIA 1SE4A 4DWFA 2JRHA 4NAWB 2KANA 2KX3A 1QOBA 5CHFA 2WDRB 4A3OA 2OJRA 2WNMA 1TY2A 4WWNA 4YSXB 5BMGA 3AU5A 3WQZA 2LGYA 3EI1A 2LXCA 1T0SC 4PYUA 2JZPA 2K3UA 2KMCA 1BT0A 3PRZA 2LASA 3ZNZB 2LRWA 4N58A 3DHIC 4WWMA 2I38A 5IA7A 2ZVOA 1Z2MA 4MEMA 2FIFA 1SEBD 1V1OA 2M8SA 3NS8A 4HK2A 1E6EB 2N7EA 3HM6X 2ZPNA 5C2TB 1T3QA 4NY0A 1WJ6A 1UH6A 1M94A 5C23A 3ZTDA 1WGKA 3IXSA 4DHJD 4KGSA 4MACA 3KUZA 1IBXB 1I4HA 2N9KA 2PPHA 2LZ6A 2M56B 5JZEB 1QOGA 4PK1A 2HTME 3AE7B 5J17A 3LDZE 2J42A 4I6NB 4GDLA 4HDQA 2MRPA 4I6PA 1WX8A 3ZTCA 1ET6A 4Q2JA 3RFZB 1R7SA 2BKFA 1L0VB 2KTRB 1EU3A 2L83A 3L16A 1YX5B 4ZRPA 4AR1A 1ZW7A 5IO9A 3IFWB 3L54A 3Q8AA 2I2YA 4A20A 1ZUD2 1XCQL 3APDA 4AQ7A 3Q3NC 2C9WB 4XR3A 5LLIA 4L1BA 1VD2A 2KC1A 2DNFA 2DYMA 4IDIA 4O1NA 3P4PB 4ZRJA 3VTUA 1XQQA 3FILB 3TEZA 1WR6E 3A1QB 4PS7A 5HI1A 1FCLA 4W9KA 1YJIA 4MGYE 1HQRD 3P4SB 5FKAC 3ZTYA 5GMVA 4FA6A 1NYQA 2NBVB 2ZEQA 2D2QA 1MJDA 1F1HA 3PHWB 1WE7A 3DBHI 4BFRA 5LXHA 2OJWA 4M01A 1WM2A 1NDDA 4DHZB 2DAJA 1EWCA 1CJEA 2V4IB 3CIRB 3O65B 1WXVA 4W9FA 3TL5A 3ZVVA 4XR0A 3VR9B 4GIVA 4BKGA 2ASQA 5KHOA 3WAMA 2H89B 2J0MA 2E1BA 3I7LA 3B2FA 1WWTA 2NBUA 4AOFA 4JWSC 4P6VF 3AE8B 4WJNA 5EE3A 4IM3A 4MGIE 3L10B 3Q14C 4OVVA 2IZVB 3JSVA 2EELA 2ZZEA 1WX7A 2JY6A 2MJ3A 4AREA 1E8YA 4IWQA 3R2IA 1JROA 4HXDA 2JPHA 1AN8A 1J8CA 1ZDVA 2IBIB 1LXDA 2WS3B 3ML9A 1AW7A 3EI4A 1N5WA 2N4FA 4E71A 1E10A 3FC4A 2LMCA 4HPPA 4B9KA 4DXGA 4EZKA 3L0WB 5J2RA 4K3BA 1I4PA 1SIFA 3M95A 1E8XA 4DHJB 4NJ7A 2D10A 2K22A 2BKRB 3NZSA 3GZNI 5BYQA 2IGDA 2BYFA 2N1VA 4TQ0A 2IUSA 4NAMA 4XDDA 5GXGB 4CO7A 2FCQA 3VVWB 3P63A 4ZYSA 4LTUA 2K5PA 3AULA 1FNVA 2DHZA 1J7BA 3J9CA 3TEWA 2LWPA 1JRUA 1K50A 1TZ1A 3DQVA 1YMHE 3OAWA 2IYDB 3DDCB 1C9FA 2ZJDA 2EKIA 4I6LB 1I4RA 4RFBA 3RCZA 4GDLB 2N9EB 1AARA 4UDUC 2HD5B 1QZEA 4W9JA 3ZKJC 3N3KB 2HTHA 2CHXA 2NTTA 3B9JA 1UBQA 3SFEB 2FCSA 4L2YA 2NS5A 1WGDA 3V60A 3RNCC 4JL9A 2AX5A 4XE0A 1WGRA 3DBLB 3EA6A 3SHQA 2JWUA 2RDGA 4WURA 1XLOA 5CHWA 3V6EB 1XXGA 2DZIA 3JVZX 1FXIA 2MX2A 3HHMA 1T5XD 2RD0A 2L8JA 2BT6A 1E7PB 2LHDA 3OG5A 3RI7C 3C0RB 2KLCA 2MP2B 1C4CA 2BWFA 2PLPA 2Y3UA 2R2OA 4IW0A 2KMAA 3R2TA 5CX3A 2WWZA 2ZNVB 2KHWB 4MT5A 3I5JC 1GNUA 2Y6IA 3OLMD 1L0YB 3V61A 1ET9A 3QHTA 4B95A 2JU6X 1V81A 3GE8C 3QK0A 5EE1A 1XLPA 1SIJA 3KW5B 4A9AA 4REZA 3QC8B 2IO0B 5HHDG 1SJHD 3VUWA 2D07B 1ESFA 4YT0B 4G3XB 2KJ6A 2DWQA 2CU3A 4GDKB 3I89A 2O6VA 3T3NA 2DLBA 3E56A 1V1PB 1MHXA 1JQ4A 2IY1B 1Q0WB 2NCNA 1V8CA 3RN9C 3ZJTA 2OHFA 3PO0A 3I7OA 5E6OA 2MBQA 2HYEA 2B5LA 4WH4A 3NRZA 1VJKA 1VR9A 4GXBA 3UIPB 3A9KB 2LGSA 3PS6A 3EECA 2ZVNA 4EOYA 2RR9A 5IP4D 3W2DA 1ZXHA 1KJTA 1OQYA 3I57A 1WXAA 5AZFA 2LEKA 4DDID 3L08A 1MHHE 2WXOA 1CMXB 2K8HA 3URYA 2Q5WD 2XK5B 3X23A 2ZNVC 2G9HD 1EU4A 3IBEA 3FAHA 5IN7A 1BMLC 1ROEA 1YQ4B 4M0WA 4FHJA 2KJRA 3KUCB 1LQBA 1F0ZA 3H7PB 4ARIA 3ZNGC 4TQ1A 2WU2B 3EUB2 1HTOA 2WXIA 1F2RC 2FE8A 3PLVA 2KFJA 1F77A 3AE3B 2BB6A 2EMTA 2DZKA 4K3CA 1JWMD 3ZDTA 4PS3A 4KDLB 5HKHA 4B0EA 2L3ZA 4YTPB 4RGNA 3IHPC 4B6WA 2IUTA 3P4RB 2KN4A 3MFGA 1QKZA 2OEDA 4K7SA 1SBBB 3QIJA 2JF5A 3ZIMA 4XZ4A 2KFKA 4W9GA 2GMIC 2J0JA 2Y5BB 4ARCA 3NY5A 1H8CA 1JRPA 4MELA 4K7UA 5AZGA 2E6XA 1FMAD 3Q8BA 2IO2B 3KLSX 2RPQA 3QARA 2C7MB 3LXFA 4G0NB 2KDIA 1ISNA 2LGXA 2B76B 2QILA 1UUPA 1JALA 2W55A 3ENEA 2WHIA 3MTNB 2K8CA 3NVVA 3W5UB 5DPWA 1TKYA 5EE0A 3VUXA 5G5HA 4AWJA 2IDYA 2OOBB 4K7WA 1TBEA 2LJ5A 2TSSA 2O2VA 3SDLC 4X57B 3R3MA 5FK9C 2PKOA 4BVUC 2GOWA 1R4NB 1KH0A 3AEDB 1NYRA 3K9OB 3N30A 4W9IA 2J0KA 2YEPB 1U4AA 2AQ1B 3RNGC 2YVCA 4KSLC 2JT4B 2PEAA 1RM6C 3RNFC 3CSTA 3E9SA 3ABVB 1WY8A 2CHZA 3LYYA 3Q6BA 1V97A 2GBKA 2ZCBA 1Y8RC 4NNJB 3DBLI 1UWMA 2JZ3B 1D3ZA 4JE3B 2QDFA 1TYGB 1MPEA 1GPXA 2N9PC 2AWTA 1HXYD 3TEXA 4WWPA 2KC2A 2ICIA 2KVRA 3AE1B 3NZUA 4FLHA 1PGXA 1RFKA 4BKTA 5T8IA 1G6JA 4D2KA 4HWIB 4A8XC 2LUMA 2MJEA 2DAFA 1I4QA 4IKGA 4ZRQA 1F9JA 3ZXRA 1OFFA 1YX6B 2BS4B 1AWDA 1UGMA 1EF1A 3ZJVA 2INDC 2PJHA 1WH3A 3C8YA 1SGHA 4F7ZA 4LCDE 1V7OA 2CR5A 3UIOB 1TS5A 1F2RI 3HUIA 4XR2A 1ZXIA 3UINB 2GBNA 5L95C 1RWSA 2NPTA 2DX5B 2I1KA 2QMTA 4ACFA 1EO6A 4NPNA 1WR1A 4HDOA 2WDVB 4MSQB 3Q3OC 4A0BA 4EZLA 1V9JA 1M4VA 2MHJA 3EGRA 3A4RA 3EFCA 3RT3B 2R2QA 2L52A 3U7ZA 3IAS1 5CHVC 3VQIA 5C3JB 4IM0A 3B2GA 2ZPYA 4WWOA 3HK0A 3ZX4A 4B0MA 3I8CA 3ZYYX 2KKCA 2WX0A 3Q69A 3Q8EA 2WXNA 3NG0A 4CI2A 5J18A 1FXTB 4JIOU 2KK8A 1HA5A
chains in the Genus database with same CATH topology
2KMMA 1D5ZC 5I4DA 1JW9D 1FNVA 2DBYA 1J7BA 3J9CA 3TEWA 3EI2A 1ZPSA 2WXHA 1K50A 1GB4A 4HKZE 1YMHE 2AQ2B 3Q8FA 4YSYB 2Y3AA 1C9FA 2EKIA 3IAM1 1L4DB 1I4RA 1L5PA 4HEA1 4RFBA 4GDLB 3IT4B 2N7JA 3NZ3A 1CQVA 1FCCC 3W5VB 1TKEA 2W54A 2ZW1A 4KKJA 4UDUC 1ENFA 3T3OA 1JWUD 1N5XA 1JCKB 4EE2A 1D5MC 3RPFC 1TKGA 1ZDXA 2K9XA 3BIID 1HEZE 1QQRA 1SB3C 2NTTA 3B9JA 3W1SA 2W3RA 2ZZGA 3SFEB 4DQOC 1KRHA 2JX5A 2WQYB 1IGDA 4L2YA 1HZ6A 3GS2A 1OQRA 2IGGA 2J53A 3ZGZA 2WDQB 4H2AA 1JWBD 1VZ7A 3GP7A 4A6QA 2AX5A 1FO4A 2WXRA 2PVGC 1AYFA 4XE0A 4AR8A 4WIPA 1E0ZA 4CI1A 3EA6A 2JWUA 4US9A 4ZHPA 2RDGA 4WURA 2V0GA 2SEBD 5H92C 1XLOA 2WXFA 5BYSA 3SFDB 3AE4B 2I06A 2J4XA 1XXGA 1SSNA 1PYWD 1QILA 3SEBA 1CK1A 1SE3A 1FXIA 2ZW0A 3ETRA 4AS1A 2GB1A 4YWGG 1K53A 4HROA 2INNE 1T5XD 2KAJA 3MJ5A 2BT6A 2PVOD 1E7PB 2LHDA 3R8BA 2BS3B 2BW2A 1XLNA 2VZKD 2YEPF 1C4CA 1GAQB 2Y3UA 2PLPA 3I7KA 1D5XC 2PTLA 3AECB 1QT9A 2R61A 2L1AA 3R2TA 1RYJA 4RH6A 3H8HA 3BK1A 3BZDB 4MT5A 4XWTA 1DGJA 4RGMA 1HZ5A 2MH7A 1GB1A 2ACZB 2Y6IA 2GI9A 1GOZA 4WAFA 4C7ZA 1L0YB 1ET9A 3TEYA 1YQ3B 2JU6X 1PDXA 5AUIA 1VZ8A 1KLGD 5EE1A 1XLPA 1SIJA 4A9AA 2V3NA 1XCTL 2QJLA 4REZA 2E3TA 1NI3A 2RDHA 5HHDG 1N61A 1YN5A 4JWUC 3P1MA 1SJHD 4YSZB 3AEGB 4OZAA 1TS2A 1KFYB 3RHUA 3AE2B 3Q8CA 1ESFA 1JWSD 4RNAA 4YT0B 1FEHA 4KGTA 2DWQA 1V4PA 4YXDB 4ARFA 2JYTA 1WXQA 2CU3A 4GDKB 1ZE3D 2KQ4X 4TSSA 1C4AA 3I8EA 3T3NA 3I89A 4DXFA 2WXLA 2DLBA 2QIEB 4RGTA 3AM9A 3E56A 1V1PB 1MHXA 2FBWB 1EWYC 5FR3A 1JQ4A 2KDMA 1YN3A 2ONQA 4HRSA 1DYQA 2NTSA 3LB8C 1V8CA 2WXPA 4N6EB 3AEEB 4J3OD 1I4GA 3AEAB 4HJGE 1A70A 2BS2B 3ZJTA 2OHFA 3PO0A 3I7OA 2HYEA 3U2SC 4C7YA 1IGCA 1NEKB 1XLQA 2Y5PA 2B5LA 3EI3A 3BYTB 1QOFA 3VR8B 4L23A 4WH4A 3NRZA 3AE9B 2WXJA 1VJKA 1VR9A 3BK2A 1YN4A 4XDCA 4OW0A 3GB1A 4LK0M 2V3PA 3U52E 2KWDA 1STEA 3MP9A 4IOIE 3L4PA 1PUTA 4OVZA 3O13A 2XN9C 4KKIA 4OHJA 3W2DA 4HKQA 1ZXHA 4MM3B 1QLBB 3AB5A 4GLSC 3IT6B 3I57A 2JXTA 1WSPA 1N60A 1ZOYB 2WXQA 3AEBB 4PT5A 2LEKA 4KGRA 1J7CA 1MHHE 2WXOA 2G1EA 3URYA 1N62A 2FUG1 4YTNB 4A90A 1SJED 1C79A 2Q5WD 1FFVA 2G9HD 3AE6B 2X38A 4KX6B 5JXVA 1EU4A 3TSSA 1SE4A 3FAHA 1MVKA 1BMLC 3PZ8A 1TJEA 5D7GA 3AMZA 1CZPA 1ROEA 4YTMB 4NAWB 1KTKA 5D3IB 2PIAA 1YQ4B 3MC0B 2JYEA 4M0WA 4ZOHC 1DOYA 1QOBA 1SF0A 4NZLB 1F0ZA 2WDRB 4ARIA 1C76A 4TQ1A 2WNMA 2WU2B 3BVZA 1TY2A 1TZOA 3CWIA 4YSXB 1XF5L 3EUB2 5LNK1 5BMGA 2SAKA 3DWMA 5FQDA 1FIQA 3ZQ4A 1B9RA 2WXIA 1F2RC 1LO5D 3WQZA 2QEJC 2FE8A 5MPOA 3AE3B 1F77A 3EI1A 2BB6A 2JZPA 2K3UA 3U4EG 3WCQA 4N58A 1YJJA 4WWMA 2I38A 4A55A 1JWMD 4LLGM 4RGOS 2B5MA 4B0EA 4YTPB 4USAA 4RGNA 1DOIA 3BVGA 2IUTA 3P4RB 2WP9B 1FXAA 2QSDA 1SEBD 2W82A 2KN4A 3MFGA 3SR6A 1QKZA 1V1OA 1V1PA 2OEDA 4R3DA 1SBBB 1E6EB 2MEKA 1L0XB 2XNAC 4NJCA 2HDEA 2I05A 3HRDD 2WLBA 3VRBB 3BYYB 1T3QA 5C2TB 3NVYA 3AN1A 4ARCA 3VRAB 1JRPA 1L6UA 1WGKA 2Z8LA 3IXSA 2AQ3B 2M0AA 5BMHA 2E6XA 4MH8A 1VDVA 1FMAD 3Q8BA 4KGSA 4C56C 2VZKB 3KLSX 4MACA 1WYGA 2H88B 1UNSA 2ON8A 3LXFA 4A0AA 1P7FA 1IBXB 1I4HA 1PGBA 2IPKD 2B76B 2N9KA 2M56B 1QOGA 2HTME 3AE7B 2QILA 3I9V1 1UUPA 1JALA 2J42A 1E9MA 4RCOA 1XO3A 2W55A 2PMVA 2D5GA 2K0PA 3KWVA 4E54A 4E5ZA 1ET6A 4Q2JA 4C80A 3RFZB 1R7SA 1ACCA 2WU5B 1KLUD 3AEFB 1VLBA 2JQRB 3NVVA 3W5UB 1L0VB 1TKYA 5EE0A 5G5HA 3NUHB 1EU3A 2L83A 2IDYA 1UWXA 4US8A 4ZRPA 1J7AA 2MJDA 4A08A 4AR1A 1SE2A 1XEEA 2TSSA 3AV8A 1K52A 3BVMA 2N9LA 3Q8AA 3ZJUA 3NVZA 5FK9C 2I2YA 2PKOA 1ZUD2 1XCQL 1WNUA 5D3DA 2J52A 4AQ7A 1KH0A 3MHZA 3AEDB 1NYRA 1ZP0B 4XR3A 4L1BA 4TZ4A 2YEPB 1ECRA 2AQ1B 2WXMA 2DYMA 2EWJA 1RM6C 4IDIA 4O1NA 3P4PB 3E9SA 3N9YC 2RMMA 3ABVB 1K51A 1TS3A 1EM7A 3FILB 3LYYA 4P16A 4TMAB 3TEZA 1D4BA 1V97A 2IUUA 5HI1A 1WXOA 1FCLA 1YJIA 2BYTA 2ZZFA 1HQRD 3P4SB 2LJIA 2IJ0A 5FKAC 1UWMA 2KACA 5HFYA 4JE3B 1TYGB 1NYQA 2Y50A 4XWWA 3NS1A 2L32A 1MPEA 2RPVA 1T6BX 4OZBA 1GPXA 2JSVX 1FNWA 1Y56A 5H8YE 1HXYD 4ITKA 1D6EC 3TEXA 2PW9A 2IGHA 4FXCA 4RF1A 1FM0D 2ICIA 4OZCA 3AE1B 3RFNA 2LGIA 2N0SB 1PGXA 1RFKA 2WXGA 5T8IA 1JMLA 1L6VA 3KWLA 4JPSA 1C78A 4D2KA 4A8XC 2LUMA 2MJEA 3I7NA 1BXTA 1EWCA 1I4QA 3TUOA 1CJEA 1UGJA 4IKGA 4ZRQA 1OFFA 2BS4B 1C4PA 1AWDA 2V4IB 3CIRB 4JX1C 1FFUA 1NENB 3AE5B 1IBXA 1NVID 2WXKA 4XR0A 2NMQA 4A11A 1PFDA 3ZJVA 3VR9B 5EE9A 3C8YA 1DOXA 1C77A 1V7OA 2H89B 3HVDA 2E1BA 3I7LA 1SXTA 3B2FA 1WWTA 5BYRA 4JWSC 1TS5A 4P6VF 1F2RI 3AE8B 3HUIA 4XR2A 3KEWA 3E0CA 1ZXIA 1RWSA 2GRIA 5EE3A 2BB5A 5G5GA 1TS4A 1N63A 1I4XA 4AR9A 1YNTE 1L4ZB 1VRAB 2LFIA 4WQMA 3BWUD 2QMTA 3V05A 2EELA 2ZZEA 1BUIC 2CJNA 1JWAD 3I7HA 4ZHOA 1I7HA 2MJ3A 3HVZA 4AREA 3P4QB 3R2IA 1JROA 2WDVB 4A0BA 2W3SA 1AN8A 3OWEB 1PGAA 1MI0A 1IUEA 1ZDVA 2CJOA 1VZ6A 4XR1A 5AUKA 2WS3B 5HG2A 1AW7A 3EI4A 1N5WA 3I7PA 2DYOA 1M4VA 3FILA 3EGRA 1E10A 2BBCA 3FC4A 2LMCA 4DXGA 2L52A 3U7ZA 3IAS1 3VQIA 4CQNA 2LHEA 2BTEA 1TY0A 1I4PA 5C3JB 5BMIA 2Y5CA 3KQ4A 4A09A 3B2GA 5E6JA 5TSSA 1Q10A 2INPE 2K22A 3DWGC 3AH7A 4RF0A 4B0MA 1QOAA 5BYQA 2IGDA 3PZ7A 3NVWA 3I8CA 3ZYYX 1OQQA 3P42A 4TQ0A 2IUSA 1KF6B 1FNUA 4N59A 4NAMA 2ZTGA 1FRDA 3Q69A 1B1ZA 4XDDA 5GXGB 3V3XA 3Q8EA 2WXNA 1WRIA 4CI2A 3P63A 4ZYSA 1FRRA 2M19A 4CI3A 4LTUA 1QF6A 1HA5A 3UI3A 1P7EA 2K5PA 3W9CB 1FD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N61 A;  4JWU C;  2KMM A;  2N0S B;  3P1M A;  1RFK A;  4YTP B;  1JW9 D;  2DBY A;  3AEG B;  1DOI A;  4USA A;  4YSZ B;  1J7B A;  1KFY B;  1V7O A;  1L6V A;  3RHU A;  3AE2 B;  2WP9 B;  3KWL A;  3P4R B;  1FXA A;  4YT0 B;  3SR6 A;  2DWQ A;  1V4P A;  2MJE A;  4YXD B;  1WXQ A;  2CU3 A;  1E6E B;  4YSY B;  1CJE A;  3RFN A;  2EKI A;  2QIE B;  3HRD D;  3AM9 A;  1OFF A;  2BS4 B;  1L5P A;  1AWD A;  2FBW B;  1EWY C;  2WLB A;  3VRB B;  5C2T B;  1T3Q A;  3CIR B;  1JQ4 A;  3NVY A;  4JX1 C;  3W5V B;  1TKE A;  3AN1 A;  1FFU A;  2W54 A;  4HRS A;  1NEN B;  1JRP A;  1L6U A;  1WGK A;  3AE5 B;  3LB8 C;  1V8C A;  3VRA B;  1NVI D;  4N6E B;  1PFD A;  3AEE B;  3VR9 B;  1N5X A;  3AEA B;  1A70 A;  1FMA D;  1VDV A;  5EE9 A;  2BS2 B;  3RPF C;  1TKG A;  2OHF A;  3PO0 A;  2K9X A;  1WYG A;  2H88 B;  3BII D;  4C7Y A;  1DOX A;  3LXF A;  1NEK B;  1XLQ A;  1SB3 C;  3B9J A;  2W3R A;  2ZZG A;  2B76 B;  3SFE B;  1KRH A;  1QOF A;  2H89 B;  2JX5 A;  2M56 B;  3NRZ A;  1QOG A;  3AE9 B;  2HTM E;  2WQY B;  3AE7 B;  3B2F A;  1WWT A;  1VJK A;  1JAL A;  1E9M A;  1OQR A;  4JWS C;  1XO3 A;  2W55 A;  4P6V F;  3AE8 B;  3HUI A;  2WDQ B;  3KEW A;  1ZXI A;  1JWB D;  1RWS A;  5EE3 A;  5G5G A;  4C80 A;  1R7S A;  2WU5 B;  2AX5 A;  2E1B A;  1FO4 A;  1N63 A;  2PVG C;  3AEF B;  1AYF A;  1VLB A;  2JQR B;  1PUT A;  3L4P A;  3NVV A;  3W5U B;  1L0V B;  1TKY A;  4WQM A;  5EE0 A;  5G5H A;  1E0Z A;  4US8 A;  2ZZE A;  2L83 A;  1QLB B;  1J7A A;  1JWA D;  2CJN A;  2MJD A;  3AB5 A;  4US9 A;  1I7H A;  4ZHO A;  4ZHP A;  2MJ3 A;  3HVZ A;  5H92 C;  3P4Q B;  1XLO A;  1N60 A;  3AV8 A;  3SFD B;  1ZOY B;  1JRO A;  3AE4 B;  2WDV B;  2W3S A;  3AEB B;  3NVZ A;  2LEK A;  2PKO A;  1ZUD 2;  1WNU A;  1J7C A;  1IUE A;  2CJO A;  2G1E A;  5AUK A;  3AED B;  1N62 A;  1NYR A;  1ZP0 B;  2WS3 B;  1FXI A;  4YTN B;  2Q5W D;  3ETR A;  4HRO A;  1N5W A;  1FFV A;  2KAJ A;  3AE6 B;  2BT6 A;  2PVO D;  1E7P B;  4KX6 B;  1E10 A;  2BS3 B;  3FAH A;  3FC4 A;  1XLN A;  1TJE A;  1RM6 C;  2L52 A;  3AMZ A;  4IDI A;  1CZP A;  1GAQ B;  3VR8 B;  1ROE A;  3P4P B;  4YTM B;  2PIA A;  1YQ4 B;  3AEC B;  1QT9 A;  3ABV B;  5C3J B;  1RYJ A;  4ZOH C;  2Y5C A;  1DOY A;  1V97 A;  1QOB A;  1SF0 A;  3B2G A;  1WXO A;  1F0Z A;  1YJI A;  2WDR B;  2ZZF A;  1DGJ A;  3P4S B;  3DWG C;  2K22 A;  2WU2 B;  2MH7 A;  3CWI A;  2ACZ B;  1UWM A;  3AH7 A;  3EUB 2;  2K5P A;  4YSX B;  3DWM A;  4C7Z A;  1FIQ A;  1B9R A;  1QOA A;  1TYG B;  1NYQ A;  3NVW A;  1YQ3 B;  3WQZ A;  3NS1 A;  3ZYY X;  5MPO A;  1PDX A;  3AE3 B;  1GPX A;  1OQQ A;  5AUI A;  5EE1 A;  1KF6 B;  4N59 A;  5H8Y E;  1XLP A;  1FRD A;  2ZTG A;  4ITK A;  5GXG B;  1SIJ A;  4A9A A;  4FXC A;  3WCQ A;  1WRI A;  1FM0 D;  4N58 A;  1YJJ A;  3P63 A;  4WWM A;  2QJL A;  3AE1 B;  1FRR A;  2M19 A;  4LTU A;  1QF6 A;  2E3T A;  1NI3 A;  3W9C B; 
#chains in the Genus database with same CATH topology
 1JW9 D;  3Q3M C;  3EI2 A;  4EZJ A;  1YJ1 A;  4ANV A;  2K8B A;  3Q8F A;  1OGW A;  1WMH A;  1L4D B;  4P1C C;  3RNE C;  3MJW A;  4BKS A;  3ZWK A;  1FCC C;  1TKE A;  2LRU A;  3KH0 A;  1E7U A;  1WGG A;  3T3O A;  3Q2A C;  1UEL A;  4WJP A;  1GC6 A;  3RPF C;  3BII D;  1RFA A;  1QQR A;  3W1S A;  1KRH A;  2JX5 A;  2KYW A;  2MBE A;  2L0T A;  2C60 A;  1HZ6 A;  3GS2 A;  1MG8 A;  1OQR A;  2J53 A;  1IYF A;  2WDQ B;  1RRB A;  4H2A A;  1JWB D;  3GP7 A;  5DPS A;  1KLV A;  3RMK C;  3SD5 A;  1FO4 A;  4WIP A;  4LNN A;  1V5T A;  2I1J A;  2GLS A;  2CU1 A;  4HPL B;  1IP9 A;  2WXF A;  4DK5 A;  2MQJ A;  1LGR A;  2REX A;  3ETR A;  2WX1 A;  5E6P A;  4YWG G;  1K53 A;  4HRO A;  3WAP A;  2INN E;  2N1W A;  5FR6 A;  3MJ5 A;  2LXA A;  4K81 A;  3R8B A;  5DCN A;  1LFD A;  1UF0 A;  2VZK D;  2YEP F;  4W9E A;  4IM2 A;  1C1Y B;  1D5X C;  2UU7 A;  3I7K A;  1QT9 A;  4GU2 A;  4E74 A;  4FJY A;  2EMS A;  1DGJ A;  3RD2 A;  1GB1 A;  2BQQ A;  2D11 A;  2ACZ B;  3TMP B;  2FUH B;  4WAF A;  2MBB B;  3GE3 C;  2ZCC A;  1Q1O A;  3NOB A;  4LJP B;  4URK A;  3ZW7 A;  1R4N I;  2RDH A;  1YN5 A;  4JWU C;  1V86 A;  3AEG B;  1IPG A;  3ZWD A;  1KFY B;  1JWS D;  4RNA A;  2BYV E;  4KGT A;  1WYW B;  4C00 A;  2JYT A;  1WXQ A;  2KQ4 X;  2KWC A;  4DXF A;  2WXL A;  2FBW B;  5FR3 A;  4TV3 A;  4KIK A;  3T9L A;  1Q5W B;  3LB8 C;  1RAX A;  4N6E B;  3AEA B;  3PZD A;  3ZTW A;  3H1U A;  3R7R A;  2N7D A;  3ALB A;  4C7Y A;  2DZJ A;  2BYE A;  4L23 A;  3AE9 B;  5D6J B;  1E90 A;  4DHZ E;  1WFY A;  3B0A A;  1V80 A;  3I3T B;  3CF6 E;  1F52 A;  4IOI E;  3L4P A;  1PUT A;  2XN9 C;  2KVZ A;  4KKI A;  2Z0E B;  3PV1 A;  3AB5 A;  4GLS C;  2KWU B;  4IWO A;  4TUU A;  4C4V A;  2G4D B;  3AEB B;  4PT5 A;  4KGR A;  3L13 A;  1J7C A;  2QC8 A;  1P1A A;  3DCG A;  2FUG 1;  4YTN B;  4A90 A;  1SJE D;  1C79 A;  3IG3 A;  1WRD B;  1FFV A;  4JLC A;  2X38 A;  3VFK A;  3TSS A;  4F1S A;  3PZ8 A;  1TJE A;  5D7G A;  4YTM B;  1KTK A;  2PIA A;  3MC0 B;  4MGK E;  1N6Z A;  2NVU I;  1DOY A;  3TJP A;  4OVU A;  1SF0 A;  4NZL B;  1HE8 A;  4P1B C;  3N20 C;  1TZO A;  3CWI A;  4MJS A;  1XF5 L;  3DWM A;  5FQD A;  1FIQ A;  1LO5 D;  2FCN A;  2QEJ C;  2FCM A;  5MPO A;  3MHS D;  1MFW A;  3L17 A;  5BO4 B;  3U4E G;  2MWS B;  3WCQ A;  4A55 A;  4LLG M;  4RGO S;  1P3Q U;  5LXI B;  4W9H A;  3BVG A;  5EDS A;  2WP9 B;  4BAX A;  2JWZ A;  1FXA A;  2QSD A;  2V3S A;  2KDE B;  3SR6 A;  3AU4 A;  4BOS C;  2XNA C;  4NJC A;  2I05 A;  3HRD D;  3PVL A;  1X1M A;  3VRB B;  5L83 A;  3BYY B;  4RM9 A;  3NVY A;  1L6U A;  2LUE A;  1VDV A;  4C56 C;  2VZK B;  3EFU A;  2ON8 A;  1UNS A;  4A0A A;  1PGB A;  3VDZ A;  4LNF A;  4RCO A;  1E9M A;  3VTW A;  2RDB C;  1XO3 A;  3CSF A;  2PMV A;  2K0P A;  4RM8 A;  4E54 A;  3MC9 A;  3TIX A;  4FJV B;  4E5Z A;  4ANX A;  4A3P A;  4MM3 A;  3PPA A;  5AZH A;  1ACC A;  2WU5 B;  2IY0 B;  1KLU D;  1VLB A;  2AEH A;  4W9D A;  1VCB A;  2UYZ B;  3NUH B;  3N32 A;  1UWX A;  1J7A A;  2MJD A;  1WI0 A;  4ICV A;  4ZYN A;  1XEE A;  2MA9 B;  1P98 A;  3AV8 A;  3JSV B;  3BVM A;  3ZJU A;  3NVZ A;  5D3D A;  4XGA B;  2J52 A;  3MHZ A;  3DPD A;  2X8X X;  2O6V D;  1TGZ B;  1ECR A;  4LNI A;  2NR2 A;  1V6E A;  2WXM A;  2ZZP B;  2KT7 A;  4II2 B;  2FAZ A;  4ANU A;  1K51 A;  1EM7 A;  3AI5 A;  2FNJ B;  1D4B A;  2IUU A;  2BYT A;  2IJ0 A;  4G50 A;  3ZUN A;  4KZC A;  1WXS A;  2MSE D;  3UF8 A;  2Y50 A;  4XWW A;  4LJO B;  3NS1 A;  2L32 A;  2RPV A;  4OZB A;  2JSV X;  3GOE A;  5H8Y E;  4ITK A;  2FID A;  2PW9 A;  4FXC A;  3UQA A;  3W1S C;  2EKE C;  2JXX A;  4IG7 B;  2LGI A;  2KJH B;  4II3 B;  3KWL A;  2KWV B;  4IUM B;  2Z59 B;  2ZOS A;  3I7N A;  2C5L C;  1BXT A;  1E8W A;  1UGJ A;  2KZR A;  4FUL A;  3T8M A;  1WZ3 A;  4WAA A;  2DZM A;  4P7I A;  1WZC A;  1FFU A;  1IBX A;  1NVI D;  1I42 A;  2WXK A;  2NMQ A;  3VXW A;  5IOI A;  5EE9 A;  1EUV B;  2JVC A;  1DOX A;  2KLG A;  2HE7 A;  3M3J A;  3V62 A;  1C77 A;  2Z0D B;  1SXT A;  4KVG B;  3PT2 B;  2KTF A;  1UD7 A;  3PRP B;  3IVF A;  3RUL A;  3KEW A;  3E0C A;  2KTR A;  1H4R A;  2BGF A;  2MW5 A;  2CKH B;  1R4M B;  2GRI A;  2MBH A;  4LNK A;  1TS4 A;  1N63 A;  1I4X A;  3SU8 X;  2BWE S;  2JUO A;  3BWU D;  4ASW C;  2C7H A;  4GGQ A;  3NJT A;  1JWA D;  3I7H A;  4ZHO A;  1I7H A;  3PGE A;  2W9N A;  2W3S A;  3UQB A;  4ZDV A;  3OWE B;  3N1Y C;  1YD8 U;  1PGA A;  1MI0 A;  1IUE A;  2KDB A;  2VH1 A;  4XR1 A;  3PSE B;  4KZ0 A;  3QA8 A;  3I7P A;  1WJ4 A;  2AL3 A;  3VHT C;  2DYO A;  4HJK A;  3FIL A;  1V2Y A;  3H6N A;  1WXM A;  2BBC A;  3A1Q A;  2INC C;  2VH2 A;  1HTQ A;  3ZUP A;  1WZ0 A;  4KV2 A;  4CQN A;  2BTE A;  5BMI A;  4DDG D;  4G11 A;  4A09 A;  4XC2 A;  5JHB A;  5AEK B;  2INP E;  4PS8 A;  4MGZ E;  3V6C B;  2RSU A;  4NJ6 A;  2AYO B;  3PHX B;  2K39 A;  3P42 A;  2GBR A;  4N59 A;  2ZTG A;  3V3X A;  2L7R A;  1WRI A;  1FRR A;  2M19 A;  3DVN U;  1QF6 A;  1T0Q C;  1P7E A;  3W9C B;  4EKU A;  3A9J A;  4AJW A;  5E6N A;  2DBY A;  5I4D A;  1OEY J;  4LDT D;  1J0G A;  1ZPS A;  3PLU A;  2WXH A;  1GB4 A;  4HKZ E;  2LVO A;  4GSW A;  2AQ2 B;  2Y3A A;  3DHG C;  3IAM 1;  4TKN A;  1L5P A;  4HEA 1;  3ZRC A;  3NZ3 A;  1CQV A;  2O6V B;  2ZW1 A;  1ENF A;  2AL6 A;  2D3A A;  1N5X A;  4EE2 A;  1TKG A;  2K9X A;  2LGD A;  2GBM A;  2W3R A;  2ZZG A;  4DQO C;  3QAQ A;  2WQY B;  1IGD A;  1EF5 A;  3ZGZ A;  1VZ7 A;  2JZZ A;  4GOC A;  2WXR A;  2PVG C;  4MSM B;  1AYF A;  1UBI A;  3QQ8 B;  1C3T A;  4US9 A;  2V0G A;  4DBG A;  2SEB D;  5H92 C;  5DPT A;  5BYS A;  3AE4 B;  2I06 A;  2D3C A;  1I35 A;  1SSN A;  1PYW D;  2KDF B;  2QHO A;  3SEB A;  1CK1 A;  2ZW0 A;  2V1Y A;  2MLB A;  2GB1 A;  1XT9 B;  2L0F A;  3RNA C;  2PVO D;  2XEW A;  2BS3 B;  2BW2 A;  1GAQ B;  3X0W A;  3LJ3 A;  2PTL A;  3EHV A;  2R61 A;  2UWQ A;  1LM8 B;  3H8H A;  3BZD B;  1HZ5 A;  1L7Y A;  4M0W B;  2GI9 A;  2XBB C;  1GOZ A;  4C7Z A;  1V5O A;  1YQ3 B;  1PDX A;  3APF A;  2K6Q A;  2LI5 A;  2LVP A;  3R7Q A;  2YLM A;  3VAW A;  1XCT L;  4XX5 A;  2QJL A;  4KSK C;  4GB9 A;  1TTN A;  3P1M A;  3ZXV A;  4OZA A;  2A4Z A;  1FEH A;  1RLF A;  4ARF A;  3UGB B;  1C4A A;  2QIE B;  1UZX B;  2ONQ A;  2WXP A;  3DHH C;  2KFK B;  2PE9 A;  3HM3 A;  1A70 A;  2BS2 B;  3ZNI D;  3DBR B;  3ZW3 A;  1XLQ A;  2Y5P A;  3EI3 A;  3BYT B;  3VR8 B;  2BVC A;  2G45 B;  3BK2 A;  3VUY A;  2HJ8 A;  1YN4 A;  3DVG X;  3GB1 A;  4LK0 M;  2V3P A;  2MCN B;  3RNB C;  4CHK A;  1STE A;  4OVZ A;  4AJY B;  4GN1 A;  3O13 A;  3QCA A;  1E5W A;  4BZA A;  1QLB B;  2PE6 B;  1N60 A;  3DVG Y;  5G55 A;  3M62 B;  4FBJ B;  4LDT B;  2G1E A;  3A33 B;  2O2V B;  3ZDM C;  3ONS A;  5CTR C;  2MP2 A;  3VH4 B;  3AE6 B;  2M17 A;  4KX6 B;  1XD3 B;  4BKS D;  1MVK A;  3AMZ A;  1CZP A;  5D3I B;  2QCZ A;  2KNB A;  3H7S A;  2JYE A;  1R4M I;  4ZOH C;  1L2N A;  1C76 A;  4HCP B;  3S2A A;  1A5R A;  3A9J B;  2LVQ A;  2BPS A;  3BVZ A;  5LNK 1;  2SAK A;  1ZKH A;  3ZQ4 A;  1B9R A;  4M8M A;  3B1L X;  3ZLZ A;  5KHQ A;  1KM7 A;  3VH3 B;  2KN5 A;  1YJJ A;  2G4S A;  2V9H A;  2B5M A;  4FHK A;  3WAL A;  3A4S C;  4GDK A;  4USA A;  1DOI A;  4M00 A;  2W82 A;  1V1P A;  4R3D A;  4M8N A;  2MEK A;  3QWZ B;  1L0X B;  2HDE A;  4EEW A;  4M02 A;  4ZRK A;  2WLB A;  1WGH A;  3RZF A;  3AN1 A;  3VRA B;  2Z8L A;  1KOT A;  2AQ3 B;  2M0A A;  5BMH A;  4MH8 A;  4W9C A;  1WE6 A;  1WYG A;  2H88 B;  1P7F A;  2IPK D;  3A9K A;  1WM3 A;  3I9V 1;  3PRE A;  1S3S G;  2D5G A;  3KWV A;  4AUQ C;  4C80 A;  3PTF C;  1E7V A;  2JQR B;  1FPY A;  2J7Q B;  3AEF B;  3ECI A;  2KXJ A;  4US8 A;  3ML8 A;  2NPT B;  4HCN B;  4A08 A;  4RMA A;  1SE2 A;  1K52 A;  2XK5 A;  2N9L A;  1WNU A;  2L00 B;  2HJ1 A;  4J6I A;  1ZP0 B;  3APC A;  4TZ4 A;  3M63 B;  1OTR B;  4PYZ A;  2NBW B;  5JH5 C;  4S0R A;  1OEY A;  3WIM A;  2EWJ A;  2KQ7 A;  3H7P A;  3TBL D;  3N9Y C;  2RMM A;  2A5U A;  1TS3 A;  4LNO A;  4P16 A;  4TMA B;  3KUD B;  1WXO A;  2ZZF A;  2LJI A;  3Q3F A;  2KAC A;  5HFY A;  1WIA A;  4HVB A;  1T6B X;  2K25 A;  2KO3 A;  4BBN C;  1E8Z A;  1FNW A;  1Y56 A;  3W1Y A;  1D6E C;  5D2M B;  2IGH A;  4ZRI A;  4RF1 A;  1FM0 D;  4OZC A;  2B3A A;  3RFN A;  2N0S B;  4DXA B;  2WXG A;  1JML A;  1L6V A;  4JPS A;  1C78 A;  1GUA B;  3BY4 B;  3TUO A;  1V49 A;  2G3Q B;  3OJ3 A;  1C4P A;  3RYT A;  4JX1 C;  1NEN B;  3AE5 B;  1WMH B;  2L05 A;  4A11 A;  1PFD A;  3ZNH B;  1T0Y A;  4QAY A;  4YL8 A;  3Q3J A;  3KVF B;  1ZGU B;  3HVD A;  2DEN B;  5BYR A;  4FN2 A;  5IAA C;  2M1M A;  4S17 A;  1GJZ A;  5G5G A;  2BB5 A;  3C19 A;  3WA0 A;  1PQS A;  4ANW A;  4AR9 A;  1YNT E;  1L4Z B;  1VRA B;  2LFI A;  4WQM A;  3V05 A;  1BUI C;  2CJN A;  4E3C A;  3NHE B;  3HVZ A;  3P4Q B;  3WAN A;  4HPM B;  4EFO A;  1GC7 A;  2CJO A;  3QX1 A;  1VZ6 A;  3U7D A;  5AUK A;  3DBR I;  5HG2 A;  3BIN A;  2KD0 A;  3N1X C;  1NI2 A;  1YIW A;  2D3B A;  3ZU6 A;  1WJU A;  1S1Q B;  4KDI C;  4WJO A;  2LHE A;  4CYE A;  1TY0 A;  3R66 C;  2KX0 A;  5C1Z A;  2Y5C A;  3KQ4 A;  2BF8 B;  5E6J A;  5TSS A;  1Q10 A;  3DWG C;  3AH7 A;  4RF0 A;  1QOA A;  2IO3 B;  3H9D A;  3PZ7 A;  1YOV B;  3NVW A;  4IWP A;  1NBF C;  2JRI B;  1OQQ A;  4NAW A;  1KF6 B;  1FNU A;  1FRD A;  3P2B A;  1B1Z A;  3TCA A;  4MDK E;  2K6D B;  4CI3 A;  3UI3 A;  1MG4 A;  1FD6 A;  2KMM A;  1D5Z C;  2C7N B;  3D32 A;  1YQB A;  4YSY B;  4BBN F;  2KOX A;  2VRR B;  1WF9 A;  3JYU A;  3IT4 B;  2N7J A;  4WJQ A;  3RZW C;  3W5V B;  2W54 A;  4KKJ A;  4K1R B;  1JWU D;  1JCK B;  1D5M C;  3AXC A;  3B08 A;  1ZDX A;  4WQO B;  4KIK B;  1HEZ E;  2WGS A;  1SB3 C;  1T0R C;  3DBS A;  2CS4 A;  2WYQ A;  4HLE A;  5DPR A;  2IGG A;  5D94 A;  2GBJ A;  1K8R B;  4A6Q A;  5TR5 A;  3OJ4 B;  4AR8 A;  3HIZ A;  3ZRF A;  2RGF A;  1E0Z A;  4CI1 A;  3U30 A;  4ZHP A;  5JHA A;  2V4L A;  1WJN A;  1WGY A;  3SFD B;  4F8C B;  2J4X A;  3DBH B;  1QIL A;  1SE3 A;  4C4V B;  4AS1 A;  2WDT B;  2IO1 B;  2KAJ A;  3KYD D;  3ZX5 A;  1XLN A;  2KQS A;  4EUT A;  3JW0 X;  3AEC B;  4W9L A;  2L1A A;  1RYJ A;  4RH6 A;  4AP4 C;  3BK1 A;  4XWT A;  3QJZ A;  3K9P B;  4JGH B;  4FAD A;  4RGM A;  2MH7 A;  4ICU A;  1P0R A;  1GG3 A;  3DVN V;  3EC8 A;  3TEY A;  3PRM B;  5AUI A;  1VZ8 A;  4MJS B;  1KLG D;  2V3N A;  4XYC A;  3MC8 A;  2E3T A;  1NI3 A;  1N61 A;  4YSZ B;  1TS2 A;  4NQL B;  3RHU A;  3AE2 B;  3Q8C A;  3RUI B;  3I63 C;  1V4P A;  4YXD B;  2MBO A;  1ZE3 D;  4TSS A;  3I8E A;  3KYC D;  4RGT A;  3AM9 A;  3CMM B;  3ZO5 B;  1EWY C;  2KDM A;  1YN3 A;  4HRS A;  4FJZ A;  4N9F 4;  1DYQ A;  2NTS A;  4JQW C;  3AEE B;  4J3O D;  1I4G A;  4HJG E;  3U2S C;  1IGC A;  1NEK B;  3VTV A;  2N9X A;  3DOW A;  4NQK E;  1QOF A;  1TT5 B;  2WXJ A;  4GMV A;  2CHW A;  4XDC A;  4OW0 A;  1J19 A;  2L76 A;  2LD9 A;  2K1F A;  3U52 E;  1Z5S B;  2KWD A;  1WX9 A;  3N1Z C;  3MP9 A;  4BOZ B;  2D3G A;  4OHJ A;  4HKQ A;  4MM3 B;  3IT6 B;  3GZN B;  2JXT A;  3WAO A;  2M4N A;  1WSP A;  3FKY A;  1ZOY B;  2M0X A;  4IC7 B;  2WXQ A;  1TIF A;  3U8Z A;  1SE9 A;  5G2N A;  1N62 A;  1P9D U;  4MH0 E;  2DYB A;  5IKC M;  5JXV A;  1XVI A;  1SE4 A;  4DWF A;  2JRH A;  4NAW B;  2KAN A;  2KX3 A;  1QOB A;  5CHF A;  2WDR B;  4A3O A;  2OJR A;  2WNM A;  1TY2 A;  4WWN A;  4YSX B;  5BMG A;  3AU5 A;  3WQZ A;  2LGY A;  3EI1 A;  2LXC A;  1T0S C;  4PYU A;  2JZP A;  2K3U A;  2KMC A;  1BT0 A;  3PRZ A;  2LAS A;  3ZNZ B;  2LRW A;  4N58 A;  3DHI C;  4WWM A;  2I38 A;  5IA7 A;  2ZVO A;  1Z2M A;  4MEM A;  2FIF A;  1SEB D;  1V1O A;  2M8S A;  3NS8 A;  4HK2 A;  1E6E B;  2N7E A;  3HM6 X;  2ZPN A;  5C2T B;  1T3Q A;  4NY0 A;  1WJ6 A;  1UH6 A;  1M94 A;  5C23 A;  3ZTD A;  1WGK A;  3IXS A;  4DHJ D;  4KGS A;  4MAC A;  3KUZ A;  1IBX B;  1I4H A;  2N9K A;  2PPH A;  2LZ6 A;  2M56 B;  5JZE B;  1QOG A;  4PK1 A;  2HTM E;  3AE7 B;  5J17 A;  3LDZ E;  2J42 A;  4I6N B;  4GDL A;  4HDQ A;  2MRP A;  4I6P A;  1WX8 A;  3ZTC A;  1ET6 A;  4Q2J A;  3RFZ B;  1R7S A;  2BKF A;  1L0V B;  2KTR B;  1EU3 A;  2L83 A;  3L16 A;  1YX5 B;  4ZRP A;  4AR1 A;  1ZW7 A;  5IO9 A;  3IFW B;  3L54 A;  3Q8A A;  2I2Y A;  4A20 A;  1ZUD 2;  1XCQ L;  3APD A;  4AQ7 A;  3Q3N C;  2C9W B;  4XR3 A;  5LLI A;  4L1B A;  1VD2 A;  2KC1 A;  2DNF A;  2DYM A;  4IDI A;  4O1N A;  3P4P B;  4ZRJ A;  3VTU A;  1XQQ A;  3FIL B;  3TEZ A;  1WR6 E;  3A1Q B;  4PS7 A;  5HI1 A;  1FCL A;  4W9K A;  1YJI A;  4MGY E;  1HQR D;  3P4S B;  5FKA C;  3ZTY A;  5GMV A;  4FA6 A;  1NYQ A;  2NBV B;  2ZEQ A;  2D2Q A;  1MJD A;  1F1H A;  3PHW B;  1WE7 A;  3DBH I;  4BFR A;  5LXH A;  2OJW A;  4M01 A;  1WM2 A;  1NDD A;  4DHZ B;  2DAJ A;  1EWC A;  1CJE A;  2V4I B;  3CIR B;  3O65 B;  1WXV A;  4W9F A;  3TL5 A;  3ZVV A;  4XR0 A;  3VR9 B;  4GIV A;  4BKG A;  2ASQ A;  5KHO A;  3WAM A;  2H89 B;  2J0M A;  2E1B A;  3I7L A;  3B2F A;  1WWT A;  2NBU A;  4AOF A;  4JWS C;  4P6V F;  3AE8 B;  4WJN A;  5EE3 A;  4IM3 A;  4MGI E;  3L10 B;  3Q14 C;  4OVV A;  2IZV B;  3JSV A;  2EEL A;  2ZZE A;  1WX7 A;  2JY6 A;  2MJ3 A;  4ARE A;  1E8Y A;  4IWQ A;  3R2I A;  1JRO A;  4HXD A;  2JPH A;  1AN8 A;  1J8C A;  1ZDV A;  2IBI B;  1LXD A;  2WS3 B;  3ML9 A;  1AW7 A;  3EI4 A;  1N5W A;  2N4F A;  4E71 A;  1E10 A;  3FC4 A;  2LMC A;  4HPP A;  4B9K A;  4DXG A;  4EZK A;  3L0W B;  5J2R A;  4K3B A;  1I4P A;  1SIF A;  3M95 A;  1E8X A;  4DHJ B;  4NJ7 A;  2D10 A;  2K22 A;  2BKR B;  3NZS A;  3GZN I;  5BYQ A;  2IGD A;  2BYF A;  2N1V A;  4TQ0 A;  2IUS A;  4NAM A;  4XDD A;  5GXG B;  4CO7 A;  2FCQ A;  3VVW B;  3P63 A;  4ZYS A;  4LTU A;  2K5P A;  3AUL A;  1FNV A;  2DHZ A;  1J7B A;  3J9C A;  3TEW A;  2LWP A;  1JRU A;  1K50 A;  1TZ1 A;  3DQV A;  1YMH E;  3OAW A;  2IYD B;  3DDC B;  1C9F A;  2ZJD A;  2EKI A;  4I6L B;  1I4R A;  4RFB A;  3RCZ A;  4GDL B;  2N9E B;  1AAR A;  4UDU C;  2HD5 B;  1QZE A;  4W9J A;  3ZKJ C;  3N3K B;  2HTH A;  2CHX A;  2NTT A;  3B9J A;  1UBQ A;  3SFE B;  2FCS A;  4L2Y A;  2NS5 A;  1WGD A;  3V60 A;  3RNC C;  4JL9 A;  2AX5 A;  4XE0 A;  1WGR A;  3DBL B;  3EA6 A;  3SHQ A;  2JWU A;  2RDG A;  4WUR A;  1XLO A;  5CHW A;  3V6E B;  1XXG A;  2DZI A;  3JVZ X;  1FXI A;  2MX2 A;  3HHM A;  1T5X D;  2RD0 A;  2L8J A;  2BT6 A;  1E7P B;  2LHD A;  3OG5 A;  3RI7 C;  3C0R B;  2KLC A;  2MP2 B;  1C4C A;  2BWF A;  2PLP A;  2Y3U A;  2R2O A;  4IW0 A;  2KMA A;  3R2T A;  5CX3 A;  2WWZ A;  2ZNV B;  2KHW B;  4MT5 A;  3I5J C;  1GNU A;  2Y6I A;  3OLM D;  1L0Y B;  3V61 A;  1ET9 A;  3QHT A;  4B95 A;  2JU6 X;  1V81 A;  3GE8 C;  3QK0 A;  5EE1 A;  1XLP A;  1SIJ A;  3KW5 B;  4A9A A;  4REZ A;  3QC8 B;  2IO0 B;  5HHD G;  1SJH D;  3VUW A;  2D07 B;  1ESF A;  4YT0 B;  4G3X B;  2KJ6 A;  2DWQ A;  2CU3 A;  4GDK B;  3I89 A;  2O6V A;  3T3N A;  2DLB A;  3E56 A;  1V1P B;  1MHX A;  1JQ4 A;  2IY1 B;  1Q0W B;  2NCN A;  1V8C A;  3RN9 C;  3ZJT A;  2OHF A;  3PO0 A;  3I7O A;  5E6O A;  2MBQ A;  2HYE A;  2B5L A;  4WH4 A;  3NRZ A;  1VJK A;  1VR9 A;  4GXB A;  3UIP B;  3A9K B;  2LGS A;  3PS6 A;  3EEC A;  2ZVN A;  4EOY A;  2RR9 A;  5IP4 D;  3W2D A;  1ZXH A;  1KJT A;  1OQY A;  3I57 A;  1WXA A;  5AZF A;  2LEK A;  4DDI D;  3L08 A;  1MHH E;  2WXO A;  1CMX B;  2K8H A;  3URY A;  2Q5W D;  2XK5 B;  3X23 A;  2ZNV C;  2G9H D;  1EU4 A;  3IBE A;  3FAH A;  5IN7 A;  1BML C;  1ROE A;  1YQ4 B;  4M0W A;  4FHJ A;  2KJR A;  3KUC B;  1LQB A;  1F0Z A;  3H7P B;  4ARI A;  3ZNG C;  4TQ1 A;  2WU2 B;  3EUB 2;  1HTO A;  2WXI A;  1F2R C;  2FE8 A;  3PLV A;  2KFJ A;  1F77 A;  3AE3 B;  2BB6 A;  2EMT A;  2DZK A;  4K3C A;  1JWM D;  3ZDT A;  4PS3 A;  4KDL B;  5HKH A;  4B0E A;  2L3Z A;  4YTP B;  4RGN A;  3IHP C;  4B6W A;  2IUT A;  3P4R B;  2KN4 A;  3MFG A;  1QKZ A;  2OED A;  4K7S A;  1SBB B;  3QIJ A;  2JF5 A;  3ZIM A;  4XZ4 A;  2KFK A;  4W9G A;  2GMI C;  2J0J A;  2Y5B B;  4ARC A;  3NY5 A;  1H8C A;  1JRP A;  4MEL A;  4K7U A;  5AZG A;  2E6X A;  1FMA D;  3Q8B A;  2IO2 B;  3KLS X;  2RPQ A;  3QAR A;  2C7M B;  3LXF A;  4G0N B;  2KDI A;  1ISN A;  2LGX A;  2B76 B;  2QIL A;  1UUP A;  1JAL A;  2W55 A;  3ENE A;  2WHI A;  3MTN B;  2K8C A;  3NVV A;  3W5U B;  5DPW A;  1TKY A;  5EE0 A;  3VUX A;  5G5H A;  4AWJ A;  2IDY A;  2OOB B;  4K7W A;  1TBE A;  2LJ5 A;  2TSS A;  2O2V A;  3SDL C;  4X57 B;  3R3M A;  5FK9 C;  2PKO A;  4BVU C;  2GOW A;  1R4N B;  1KH0 A;  3AED B;  1NYR A;  3K9O B;  3N30 A;  4W9I A;  2J0K A;  2YEP B;  1U4A A;  2AQ1 B;  3RNG C;  2YVC A;  4KSL C;  2JT4 B;  2PEA A;  1RM6 C;  3RNF C;  3CST A;  3E9S A;  3ABV B;  1WY8 A;  2CHZ A;  3LYY A;  3Q6B A;  1V97 A;  2GBK A;  2ZCB A;  1Y8R C;  4NNJ B;  3DBL I;  1UWM A;  2JZ3 B;  1D3Z A;  4JE3 B;  2QDF A;  1TYG B;  1MPE A;  1GPX A;  2N9P C;  2AWT A;  1HXY D;  3TEX A;  4WWP A;  2KC2 A;  2ICI A;  2KVR A;  3AE1 B;  3NZU A;  4FLH A;  1PGX A;  1RFK A;  4BKT A;  5T8I A;  1G6J A;  4D2K A;  4HWI B;  4A8X C;  2LUM A;  2MJE A;  2DAF A;  1I4Q A;  4IKG A;  4ZRQ A;  1F9J A;  3ZXR A;  1OFF A;  1YX6 B;  2BS4 B;  1AWD A;  1UGM A;  1EF1 A;  3ZJV A;  2IND C;  2PJH A;  1WH3 A;  3C8Y A;  1SGH A;  4F7Z A;  4LCD E;  1V7O A;  2CR5 A;  3UIO B;  1TS5 A;  1F2R I;  3HUI A;  4XR2 A;  1ZXI A;  3UIN B;  2GBN A;  5L95 C;  1RWS A;  2NPT A;  2DX5 B;  2I1K A;  2QMT A;  4ACF A;  1EO6 A;  4NPN A;  1WR1 A;  4HDO A;  2WDV B;  4MSQ B;  3Q3O C;  4A0B A;  4EZL A;  1V9J A;  1M4V A;  2MHJ A;  3EGR A;  3A4R A;  3EFC A;  3RT3 B;  2R2Q A;  2L52 A;  3U7Z A;  3IAS 1;  5CHV C;  3VQI A;  5C3J B;  4IM0 A;  3B2G A;  2ZPY A;  4WWO A;  3HK0 A;  3ZX4 A;  4B0M A;  3I8C A;  3ZYY X;  2KKC A;  2WX0 A;  3Q69 A;  3Q8E A;  2WXN A;  3NG0 A;  4CI2 A;  5J18 A;  1FXT B;  4JIO U;  2KK8 A;  1HA5 A; 
#chains in the Genus database with same CATH homology
 2KMM A;  1D5Z C;  5I4D A;  1JW9 D;  1FNV A;  2DBY A;  1J7B A;  3J9C A;  3TEW A;  3EI2 A;  1ZPS A;  2WXH A;  1K50 A;  1GB4 A;  4HKZ E;  1YMH E;  2AQ2 B;  3Q8F A;  4YSY B;  2Y3A A;  1C9F A;  2EKI A;  3IAM 1;  1L4D B;  1I4R A;  1L5P A;  4HEA 1;  4RFB A;  4GDL B;  3IT4 B;  2N7J A;  3NZ3 A;  1CQV A;  1FCC C;  3W5V B;  1TKE A;  2W54 A;  2ZW1 A;  4KKJ A;  4UDU C;  1ENF A;  3T3O A;  1JWU D;  1N5X A;  1JCK B;  4EE2 A;  1D5M C;  3RPF C;  1TKG A;  1ZDX A;  2K9X A;  3BII D;  1HEZ E;  1QQR A;  1SB3 C;  2NTT A;  3B9J A;  3W1S A;  2W3R A;  2ZZG A;  3SFE B;  4DQO C;  1KRH A;  2JX5 A;  2WQY B;  1IGD A;  4L2Y A;  1HZ6 A;  3GS2 A;  1OQR A;  2IGG A;  2J53 A;  3ZGZ A;  2WDQ B;  4H2A A;  1JWB D;  1VZ7 A;  3GP7 A;  4A6Q A;  2AX5 A;  1FO4 A;  2WXR A;  2PVG C;  1AYF A;  4XE0 A;  4AR8 A;  4WIP A;  1E0Z A;  4CI1 A;  3EA6 A;  2JWU A;  4US9 A;  4ZHP A;  2RDG A;  4WUR A;  2V0G A;  2SEB D;  5H92 C;  1XLO A;  2WXF A;  5BYS A;  3SFD B;  3AE4 B;  2I06 A;  2J4X A;  1XXG A;  1SSN A;  1PYW D;  1QIL A;  3SEB A;  1CK1 A;  1SE3 A;  1FXI A;  2ZW0 A;  3ETR A;  4AS1 A;  2GB1 A;  4YWG G;  1K53 A;  4HRO A;  2INN E;  1T5X D;  2KAJ A;  3MJ5 A;  2BT6 A;  2PVO D;  1E7P B;  2LHD A;  3R8B A;  2BS3 B;  2BW2 A;  1XLN A;  2VZK D;  2YEP F;  1C4C A;  1GAQ B;  2Y3U A;  2PLP A;  3I7K A;  1D5X C;  2PTL A;  3AEC B;  1QT9 A;  2R61 A;  2L1A A;  3R2T A;  1RYJ A;  4RH6 A;  3H8H A;  3BK1 A;  3BZD B;  4MT5 A;  4XWT A;  1DGJ A;  4RGM A;  1HZ5 A;  2MH7 A;  1GB1 A;  2ACZ B;  2Y6I A;  2GI9 A;  1GOZ A;  4WAF A;  4C7Z A;  1L0Y B;  1ET9 A;  3TEY A;  1YQ3 B;  2JU6 X;  1PDX A;  5AUI A;  1VZ8 A;  1KLG D;  5EE1 A;  1XLP A;  1SIJ A;  4A9A A;  2V3N A;  1XCT L;  2QJL A;  4REZ A;  2E3T A;  1NI3 A;  2RDH A;  5HHD G;  1N61 A;  1YN5 A;  4JWU C;  3P1M A;  1SJH D;  4YSZ B;  3AEG B;  4OZA A;  1TS2 A;  1KFY B;  3RHU A;  3AE2 B;  3Q8C A;  1ESF A;  1JWS D;  4RNA A;  4YT0 B;  1FEH A;  4KGT A;  2DWQ A;  1V4P A;  4YXD B;  4ARF A;  2JYT A;  1WXQ A;  2CU3 A;  4GDK B;  1ZE3 D;  2KQ4 X;  4TSS A;  1C4A A;  3I8E A;  3T3N A;  3I89 A;  4DXF A;  2WXL A;  2DLB A;  2QIE B;  4RGT A;  3AM9 A;  3E56 A;  1V1P B;  1MHX A;  2FBW B;  1EWY C;  5FR3 A;  1JQ4 A;  2KDM A;  1YN3 A;  2ONQ A;  4HRS A;  1DYQ A;  2NTS A;  3LB8 C;  1V8C A;  2WXP A;  4N6E B;  3AEE B;  4J3O D;  1I4G A;  3AEA B;  4HJG E;  1A70 A;  2BS2 B;  3ZJT A;  2OHF A;  3PO0 A;  3I7O A;  2HYE A;  3U2S C;  4C7Y A;  1IGC A;  1NEK B;  1XLQ A;  2Y5P A;  2B5L A;  3EI3 A;  3BYT B;  1QOF A;  3VR8 B;  4L23 A;  4WH4 A;  3NRZ A;  3AE9 B;  2WXJ A;  1VJK A;  1VR9 A;  3BK2 A;  1YN4 A;  4XDC A;  4OW0 A;  3GB1 A;  4LK0 M;  2V3P A;  3U52 E;  2KWD A;  1STE A;  3MP9 A;  4IOI E;  3L4P A;  1PUT A;  4OVZ A;  3O13 A;  2XN9 C;  4KKI A;  4OHJ A;  3W2D A;  4HKQ A;  1ZXH A;  4MM3 B;  1QLB B;  3AB5 A;  4GLS C;  3IT6 B;  3I57 A;  2JXT A;  1WSP A;  1N60 A;  1ZOY B;  2WXQ A;  3AEB B;  4PT5 A;  2LEK A;  4KGR A;  1J7C A;  1MHH E;  2WXO A;  2G1E A;  3URY A;  1N62 A;  2FUG 1;  4YTN B;  4A90 A;  1SJE D;  1C79 A;  2Q5W D;  1FFV A;  2G9H D;  3AE6 B;  2X38 A;  4KX6 B;  5JXV A;  1EU4 A;  3TSS A;  1SE4 A;  3FAH A;  1MVK A;  1BML C;  3PZ8 A;  1TJE A;  5D7G A;  3AMZ A;  1CZP A;  1ROE A;  4YTM B;  4NAW B;  1KTK A;  5D3I B;  2PIA A;  1YQ4 B;  3MC0 B;  2JYE A;  4M0W A;  4ZOH C;  1DOY A;  1QOB A;  1SF0 A;  4NZL B;  1F0Z A;  2WDR B;  4ARI A;  1C76 A;  4TQ1 A;  2WNM A;  2WU2 B;  3BVZ A;  1TY2 A;  1TZO A;  3CWI A;  4YSX B;  1XF5 L;  3EUB 2;  5LNK 1;  5BMG A;  2SAK A;  3DWM A;  5FQD A;  1FIQ A;  3ZQ4 A;  1B9R A;  2WXI A;  1F2R C;  1LO5 D;  3WQZ A;  2QEJ C;  2FE8 A;  5MPO A;  3AE3 B;  1F77 A;  3EI1 A;  2BB6 A;  2JZP A;  2K3U A;  3U4E G;  3WCQ A;  4N58 A;  1YJJ A;  4WWM A;  2I38 A;  4A55 A;  1JWM D;  4LLG M;  4RGO S;  2B5M A;  4B0E A;  4YTP B;  4USA A;  4RGN A;  1DOI A;  3BVG A;  2IUT A;  3P4R B;  2WP9 B;  1FXA A;  2QSD A;  1SEB D;  2W82 A;  2KN4 A;  3MFG A;  3SR6 A;  1QKZ A;  1V1O A;  1V1P A;  2OED A;  4R3D A;  1SBB B;  1E6E B;  2MEK A;  1L0X B;  2XNA C;  4NJC A;  2HDE A;  2I05 A;  3HRD D;  2WLB A;  3VRB B;  3BYY B;  1T3Q A;  5C2T B;  3NVY A;  3AN1 A;  4ARC A;  3VRA B;  1JRP A;  1L6U A;  1WGK A;  2Z8L A;  3IXS A;  2AQ3 B;  2M0A A;  5BMH A;  2E6X A;  4MH8 A;  1VDV A;  1FMA D;  3Q8B A;  4KGS A;  4C56 C;  2VZK B;  3KLS X;  4MAC A;  1WYG A;  2H88 B;  1UNS A;  2ON8 A;  3LXF A;  4A0A A;  1P7F A;  1IBX B;  1I4H A;  1PGB A;  2IPK D;  2B76 B;  2N9K A;  2M56 B;  1QOG A;  2HTM E;  3AE7 B;  2QIL A;  3I9V 1;  1UUP A;  1JAL A;  2J42 A;  1E9M A;  4RCO A;  1XO3 A;  2W55 A;  2PMV A;  2D5G A;  2K0P A;  3KWV A;  4E54 A;  4E5Z A;  1ET6 A;  4Q2J A;  4C80 A;  3RFZ B;  1R7S A;  1ACC A;  2WU5 B;  1KLU D;  3AEF B;  1VLB A;  2JQR B;  3NVV A;  3W5U B;  1L0V B;  1TKY A;  5EE0 A;  5G5H A;  3NUH B;  1EU3 A;  2L83 A;  2IDY A;  1UWX A;  4US8 A;  4ZRP A;  1J7A A;  2MJD A;  4A08 A;  4AR1 A;  1SE2 A;  1XEE A;  2TSS A;  3AV8 A;  1K52 A;  3BVM A;  2N9L A;  3Q8A A;  3ZJU A;  3NVZ A;  5FK9 C;  2I2Y A;  2PKO A;  1ZUD 2;  1XCQ L;  1WNU A;  5D3D A;  2J52 A;  4AQ7 A;  1KH0 A;  3MHZ A;  3AED B;  1NYR A;  1ZP0 B;  4XR3 A;  4L1B A;  4TZ4 A;  2YEP B;  1ECR A;  2AQ1 B;  2WXM A;  2DYM A;  2EWJ A;  1RM6 C;  4IDI A;  4O1N A;  3P4P B;  3E9S A;  3N9Y C;  2RMM A;  3ABV B;  1K51 A;  1TS3 A;  1EM7 A;  3FIL B;  3LYY A;  4P16 A;  4TMA B;  3TEZ A;  1D4B A;  1V97 A;  2IUU A;  5HI1 A;  1WXO A;  1FCL A;  1YJI A;  2BYT A;  2ZZF A;  1HQR D;  3P4S B;  2LJI A;  2IJ0 A;  5FKA C;  1UWM A;  2KAC A;  5HFY A;  4JE3 B;  1TYG B;  1NYQ A;  2Y50 A;  4XWW A;  3NS1 A;  2L32 A;  1MPE A;  2RPV A;  1T6B X;  4OZB A;  1GPX A;  2JSV X;  1FNW A;  1Y56 A;  5H8Y E;  1HXY D;  4ITK A;  1D6E C;  3TEX A;  2PW9 A;  2IGH A;  4FXC A;  4RF1 A;  1FM0 D;  2ICI A;  4OZC A;  3AE1 B;  3RFN A;  2LGI A;  2N0S B;  1PGX A;  1RFK A;  2WXG A;  5T8I A;  1JML A;  1L6V A;  3KWL A;  4JPS A;  1C78 A;  4D2K A;  4A8X C;  2LUM A;  2MJE A;  3I7N A;  1BXT A;  1EWC A;  1I4Q A;  3TUO A;  1CJE A;  1UGJ A;  4IKG A;  4ZRQ A;  1OFF A;  2BS4 B;  1C4P A;  1AWD A;  2V4I B;  3CIR B;  4JX1 C;  1FFU A;  1NEN B;  3AE5 B;  1IBX A;  1NVI D;  2WXK A;  4XR0 A;  2NMQ A;  4A11 A;  1PFD A;  3ZJV A;  3VR9 B;  5EE9 A;  3C8Y A;  1DOX A;  1C77 A;  1V7O A;  2H89 B;  3HVD A;  2E1B A;  3I7L A;  1SXT A;  3B2F A;  1WWT A;  5BYR A;  4JWS C;  1TS5 A;  4P6V F;  1F2R I;  3AE8 B;  3HUI A;  4XR2 A;  3KEW A;  3E0C A;  1ZXI A;  1RWS A;  2GRI A;  5EE3 A;  2BB5 A;  5G5G A;  1TS4 A;  1N63 A;  1I4X A;  4AR9 A;  1YNT E;  1L4Z B;  1VRA B;  2LFI A;  4WQM A;  3BWU D;  2QMT A;  3V05 A;  2EEL A;  2ZZE A;  1BUI C;  2CJN A;  1JWA D;  3I7H A;  4ZHO A;  1I7H A;  2MJ3 A;  3HVZ A;  4ARE A;  3P4Q B;  3R2I A;  1JRO A;  2WDV B;  4A0B A;  2W3S A;  1AN8 A;  3OWE B;  1PGA A;  1MI0 A;  1IUE A;  1ZDV A;  2CJO A;  1VZ6 A;  4XR1 A;  5AUK A;  2WS3 B;  5HG2 A;  1AW7 A;  3EI4 A;  1N5W A;  3I7P A;  2DYO A;  1M4V A;  3FIL A;  3EGR A;  1E10 A;  2BBC A;  3FC4 A;  2LMC A;  4DXG A;  2L52 A;  3U7Z A;  3IAS 1;  3VQI A;  4CQN A;  2LHE A;  2BTE A;  1TY0 A;  1I4P A;  5C3J B;  5BMI A;  2Y5C A;  3KQ4 A;  4A09 A;  3B2G A;  5E6J A;  5TSS A;  1Q10 A;  2INP E;  2K22 A;  3DWG C;  3AH7 A;  4RF0 A;  4B0M A;  1QOA A;  5BYQ A;  2IGD A;  3PZ7 A;  3NVW A;  3I8C A;  3ZYY X;  1OQQ A;  3P42 A;  4TQ0 A;  2IUS A;  1KF6 B;  1FNU A;  4N59 A;  4NAM A;  2ZTG A;  1FRD A;  3Q69 A;  1B1Z A;  4XDD A;  5GXG B;  3V3X A;  3Q8E A;  2WXN A;  1WRI A;  4CI2 A;  3P63 A;  4ZYS A;  1FRR A;  2M19 A;  4CI3 A;  4LTU A;  1QF6 A;  1HA5 A;  3UI3 A;  1P7E A;  2K5P A;  3W9C B;  1FD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...