1TJEA

Crystal structure of the editing domain of threonyl-trna synthetase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Threonyl-tRNA synthetase
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tjeA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tjeA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tjeA02
1OFFA 1OQQA 3KEWA 4YSXB 1N60A 5AUKA 1VLBA 1FMAD 1ZOYB 1NVID 1NYRA 1N62A 1J7CA 1ZXIA 3AEEB 3SR6A 2ZTGA 1PUTA 3AMZA 2FBWB 4C80A 2PIAA 1RYJA 2HTME 5EE3A 1WNUA 3AE9B 3RPFC 1WXQA 3AEAB 3W9CB 3VR8B 1F0ZA 1L5PA 4N58A 4US8A 1NENB 1WWTA 3DWMA 1AWDA 1N63A 3P1MA 3NS1A 1E7PB 1OQRA 1KFYB 4ITKA 5EE0A 5EE9A 4YSZB 1FO4A 2WDRB 2BS4B 1A70A 4C7YA 3W5UB 2E3TA 3RFNA 3ABVB 3AEDB 1ROEA 1NYQA 1XLNA 4N6EB 1WGKA 1WXOA 2E1BA 3P4RB 3SFEB 3HRDD 2MJ3A 3PO0A 1XO3A 3AECB 3NVVA 4JWSC 2LEKA 5H92C 1QOFA 3AN1A 3B2FA 3W5VB 4YT0B 1QOBA 3P4SB 1XLOA 5MPOA 1DGJA 2BS2B 4ZOHC 4YSYB 1TKYA 1XLQA 1V97A 3NVYA 3HUIA 4FXCA 4IDIA 1QOAA 2CU3A 1CZPA 1SF0A 1JQ4A 2W55A 2W3RA 3ETRA 4HROA 3KWLA 4ZHPA 1ZUD2 2OHFA 1J7AA 2CJNA 3AE8B 2M56B 1FM0D 2MJDA 2K22A 3CIRB 3VRBB 4ZHOA 5C2TB 1FFUA 1YQ4B 3AV8A 1B9RA 1DOIA 1JWBD 2EKIA 2G1EA 3BIID 3DWGC 2QJLA 4WWMA 2WLBA 3VR9B 1FRDA 1JALA 1XLPA 2JX5A 4P6VF 1V7OA 1QOGA 1QT9A 2L52A 1E9MA 4YTNB 4YTPB 3AE4B 3LB8C 2WU5B 1I7HA 3B2GA 1DOYA 2N0SB 1R7SA 3AB5A 2M19A 5GXGB 1TKGA 3AE2B 1JW9D 1TKEA 1FIQA 2WU2B 3CWIA 1E0ZA 2K5PA 5AUIA 4C7ZA 1DOXA 2ZZGA 1JRPA 1SB3C 3WCQA 1PDXA 2Q5WD 1E6EB 2Y5CA 4LTUA 1L6UA 2DWQA 1IUEA 1NI3A 2QIEB 3AE1B 1TYGB 1FXAA 3AEFB 1KRHA 1RM6C 3LXFA 2WS3B 3EUB2 5G5GA 3ZYYX 5G5HA 3AE6B 1SIJA 1UWMA 3AEGB 1FFVA 1RWSA 1VDVA 3B9JA 3SFDB 4A9AA 4USAA 2PVOD 4YTMB 1GAQB 3AH7A 1N61A 5EE1A 2AX5A 3NRZA 1WRIA 3NVZA 1V8CA 3AE7B 2BS3B 4JX1C 4YXDB 2ACZB 1L6VA 3FC4A 4HRSA 2JQRB 1PFDA 1CJEA 1WYGA 1ZP0B 2WQYB 3L4PA 3VRAB 1EWYC 4JWUC 1RFKA 1YJIA 3AE3B 1J7BA 5H8YE 1JROA 2DBYA 1QF6A 1E10A 1GPXA 3AEBB 1V4PA 1JWAD 2L83A 2H89B 2K9XA 4KX6B 1T3QA 1QLBB 2W3SA 5C3JB 1FXIA 3NVWA 3P4QB 2KAJA 2ZZFA 3RHUA 2ZZEA 1AYFA 3WQZA 3P4PB 4US9A 1YJJA 3AM9A 1FRRA 3HVZA 3AE5B 2KMMA 2H88B 1KF6B 2B76B 2WDVB 3FAHA 2WDQB 2MJEA 2PKOA 1L0VB 1N5XA 2PVGC 4N59A 2BT6A 1NEKB 1N5WA 2W54A 2CJOA 1VJKA 3P63A 4WQMA 2MH7A 1TJEA 2WP9B 1YQ3B
chains in the Genus database with same CATH superfamily
4FHJA 4N9F4 3UI3A 1T0YA 1N62A 1WJUA 2DZMA 3DOWA 1ZPSA 1F0ZA 1K50A 3DWMA 2JF5A 4PK1A 3QARA 3T3OA 3GZNB 2BWFA 4LNOA 5H92C 3ZVVA 4KZCA 4MM3B 3HUIA 1YIWA 2WNMA 1GC7A 2J52A 2CHZA 3ZTDA 1ZW7A 4P7IA 2PE9A 4P1BC 3ZDTA 5T8IA 3SEBA 1FNWA 3VTUA 4EE2A 1SIFA 1V80A 3I7LA 2B5MA 1XLPA 1V7OA 4YTPB 1C4CA 5IAAC 2KQ7A 1V5OA 2JRHA 2V3PA 3DHHC 1DOXA 3ECIA 4TUUA 4MJSA 4LTUA 5FKAC 4K7UA 1TYGB 4G11A 5G5GA 2WXNA 4F1SA 2LD9A 1VDVA 2G9HD 2N9KA 3PHXB 3NVZA 4ZDVA 4XR0A 4M8NA 3I5JC 2BS3B 5D2MB 2QILA 2ON8A 1YN3A 1D5ZC 1KLUD 2KN4A 3SDLC 1PGXA 2LFIA 2KWDA 1MHXA 2N7DA 1KH0A 3I7HA 1FXIA 2X8XX 5IOIA 3ZJTA 1OEYA 3PLUA 3VDZA 4W9IA 1WIAA 3H7PB 3FAHA 4XWTA 1C9FA 4BKTA 2QEJC 2ZOSA 1FCCC 1HEZE 3ENEA 3QCAA 2KVRA 1I4QA 2LMCA 3AMZA 2HTME 2KTRA 2NVUI 5CHFA 3N30A 4P1CC 5L83A 2QC8A 2BYVE 2YEPF 3ZLZA 1ET6A 4B95A 1K52A 2Z59B 3EC8A 2PE6B 2WXPA 4EFOA 4XDCA 1J19A 5LLIA 1WGKA 3X23A 2JY6A 1P7EA 1T0RC 3HRDD 1M4VA 2IO1B 4HVBA 2LGXA 3B2FA 4C4VA 2ZW1A 4IDIA 4XWWA 1T0QC 2QDFA 1TGZB 1SJED 2M56B 1OQYA 3ZNID 1FFUA 1WM2A 3LYYA 1WJ4A 3H8HA 4BOSC 2L8JA 3AU4A 5D94A 3VR9B 1T0SC 4P6VF 2N1VA 2BB5A 2D07B 2MA9B 3Q8EA 3UQBA 2WXMA 3L16A 2LRWA 4XR3A 3NUHB 4HDQA 2L7RA 1G6JA 2IGGA 1AARA 1JMLA 1V81A 4CYEA 2WXFA 1ZDVA 3DCGA 4RMAA 1FXTB 1V2YA 4IOIE 3KVFB 1FXAA 1IBXA 2V3SA 5G5HA 1SIJA 3BYTB 3A9JA 3PV1A 3E0CA 3W1YA 1L4DB 1ESFA 3LDZE 1XT9B 2M17A 4DWFA 2J0KA 1L6VA 2D3GA 4YL8A 2K1FA 2WQYB 3L4PA 3VRAB 3R7RA 1RFKA 3ZJVA 3RD2A 5H8YE 1GB1A 4IKGA 5LNK1 4FULA 4KV2A 3NY5A 4NJCA 4PYZA 2ZZFA 2WXJA 4XE0A 1WZ0A 2MJEA 1TIFA 2FIDA 3OG5A 2CJOA 3Q6BA 3LJ3A 2MP2A 3RUIB 3EI1A 1FEHA 2LGYA 3TMPB 4A55A 4MT5A 2J7QB 3U7ZA 1UGMA 1WXQA 1L5PA 2WYQA 2NPTA 1N63A 3P1MA 5EE9A 4NJ6A 2MLBA 1KLGD 5DPSA 1WXOA 4GXBA 1JWUD 2MJ3A 3RNEC 3Q3JA 2KK8A 1WRDB 2MBHA 1N6ZA 4I6PA 2C5LC 1TKYA 2KX0A 1EU4A 4CQNA 4ZHPA 1PGAA 4MH0E 4A11A 3I57A 3U52E 1GUAB 2N9PC 2G1EA 3ZO5B 4EZJA 1WX8A 4WJNA 4AS1A 3RCZA 4NAMA 4KSKC 5GXGB 2C7NB 1E7UA 5AUIA 2LI5A 4IUMB 2Q5WD 4RGNA 2LHEA 1IUEA 2QIEB 2ICIA 3BK1A 4JE3B 4DHZB 5KHOA 2KN5A 4AJYB 4JX1C 2JQRB 1CJEA 4GDLB 1ZP0B 2I06A 3P2BA 1BXTA 1EO6A 5D6JB 4DXGA 3DHIC 1V4PA 1WR6E 4KX6B 5C3JB 4HWIB 2ZZEA 3L17A 3AXCA 2DAFA 2KMMA 4KKIA 5D7GA 3IG3A 2LZ6A 2LGIA 3KYCD 2K3UA 3ZXVA 2MH7A 3B0AA 4LDTD 2WWZA 3GOEA 1N60A 1QQRA 3Q14C 1J7CA 2O2VA 3IT4B 2PIAA 5EE3A 3AEAB 3JSVA 1TZOA 1C78A 2D5GA 2KC2A 5I4DA 1NENB 4ICVA 3W1SC 3N1XC 4YSZB 2IO2B 2KQSA 4K7WA 4NPNA 2KDIA 3ZU6A 3NS8A 1TS5A 2AEHA 1EUVB 3AI5A 3T8MA 3GS2A 3E56A 1FNUA 3O13A 4CO7A 2LUMA 4DBGA 1GNUA 2W3RA 4BOZB 3K9PB 3ML9A 3QIJA 3N32A 2HDEA 4LK0M 3HM6X 2ZCCA 4AR9A 2EWJA 3DHGC 4GIVA 2LJIA 3PPAA 4K7SA 3AE4B 5DPWA 1TS3A 2QMTA 3Q3FA 2L00B 4IM3A 2KLGA 1TKEA 4WQOB 1D5XC 3VUXA 5FQDA 1ENFA 4KZ0A 3CWIA 2I1JA 3HM3A 2FNJB 4HEA1 4ZYSA 1RM6C 5C1ZA 2G45B 3RFNA 1RFAA 3EFCA 3TL5A 3ZNGC 3ZGZA 4ACFA 2X38A 4WIPA 2FUG1 3IHPC 1GPXA 2L83A 1C4PA 1JRUA 2K9XA 2L76A 2DLBA 2W3SA 3PGEA 2IY0B 1SGHA 4LNFA 3HVZA 1JWMD 2M1MA 4IW0A 2PKOA 1R4MI 3MJWA 1I4RA 4XX5A 1WE7A 2REXA 2BW2A 3AEEB 4RGMA 2KFKA 4OVVA 2GB1A 1LQBA 1D3ZA 4NZLB 4OZCA 3PHWB 4LDTB 2BF8B 2WDRB 2M8SA 1YN5A 2Y3AA 3AEDB 2O6VB 4HPPA 3VFKA 4RM9A 1EWCA 1Y56A 2O6VD 2LXAA 1NI2A 4G3XB 4ZRQA 4I6LB 4YT0B 3Q8FA 3MC9A 3M95A 1SXTA 4HK2A 3H9DA 1C79A 2MCNB 2GRIA 4RCOA 4WJQA 4HJGE 3KYDD 4ZHOA 1DOIA 3A1QA 3JW0X 5IA7A 1MG8A 5TR5A 1KLVA 2INCC 2VZKB 4E3CA 2LGSA 3WCQA 4W9EA 3VUWA 1R4MB 1NI3A 4MSQB 2L1AA 3AE6B 4K3CA 2VZKD 3IAS1 4XR1A 1E8ZA 2Z8LA 2LHDA 3SHQA 1YQBA 3FC4A 2KXJA 1WFYA 1EWYC 4IWQA 2DBYA 3AEBB 2LXCA 2H89B 3CSTA 4RGOS 5DPRA 4A3OA 4XGAB 1SJHD 2RPQA 1OTRB 3KQ4A 2N7EA 2W54A 1STEA 3TEWA 1LFDA 4JLCA 5G55A 3HHMA 1ZOYB 1PYWD 3BZDB 5LXIB 1PUTA 2J0MA 1I4XA 3L10B 1WNUA 3C0RB 1R4NI 3ZQ4A 1SEBD 2XNAC 1AWDA 4Q2JA 2JT4B 4C7YA 1CK1A 2E3TA 2D2QA 3UIOB 4HKQA 2WXIA 2JSVX 2HJ8A 1OGWA 4GDKB 4A20A 1I4HA 4ANWA 2BS2B 5DCNA 1XLQA 1E90A 1SF0A 3EGRA 1Q0WB 2KVZA 3MP9A 4FHKA 3UQAA 4IWOA 2VH1A 2GBMA 4OZBA 1P9DU 5L95C 3T9LA 4GGQA 2OOBB 5E6JA 3HK0A 3BYYB 5BYSA 1QOGA 5JH5C 2NTSA 2WU5B 2D3BA 2INPE 3B2GA 3WAPA 2M19A 4CHKA 2KQ4X 4NJ7A 2Z0EB 3I7OA 4C7ZA 1TS2A 3RNFC 3UGBB 1JRPA 2Y5CA 1SE3A 1C76A 4UDUC 5BMIA 2PVOD 1JCKB 3X0WA 2AX5A 2GMIC 1WJNA 2HD5B 3NRZA 4A8XC 2JYEA 2MP2B 1UBIA 2L0TA 3FKYA 4AR1A 4I6NB 1E10A 1L0YB 2BKFA 1WGRA 3CF6E 2KAJA 2L32A 1F77A 1L0XB 3Q3NC 1X1MA 2B76B 2D3AA 3RMKC 4AREA 4EKUA 4E71A 4EZKA 2V4IB 2FCQA 4WAAA 5AUKA 2MWSB 1ISNA 3ZIMA 4W9FA 4ZRJA 1WXVA 4ARFA 3DBRB 2KZRA 2WGSA 3OJ4B 4AWJA 4HPLB 5CTRC 3QC8B 4W9CA 1K53A 2GBKA 1TY0A 3UIPB 1XF5L 2DNFA 5AZHA 1XO3A 1IYFA 4CI3A 3RZWC 2LEKA 1QOFA 1A5RA 1QOBA 1OEYJ 2DYBA 1V1OA 4WH4A 3NZUA 2ZPNA 3H1UA 1ZUD2 4MH8A 4BKSA 1XD3B 3VAWA 1YQ4B 2NR2A 2PEAA 2EKIA 5BMHA 5LXHA 1SSNA 3ZX5A 4KDIC 3APCA 2B3AA 4FJYA 4BKSD 5E6PA 3QA8A 1R7SA 3AB5A 4A6QA 1Y8RC 4KSLC 4E5ZA 4GDLA 3APFA 2WU2B 4DK5A 1TBEA 1UGJA 2MBOA 4RFBA 4HDOA 2AQ1B 1E8WA 3DBRI 3EUB2 4ARCA 4MSMB 4HKZE 4ANUA 4DHZE 3RNGC 2KHWB 2IJ0A 2DYMA 3AE7B 2ACZB 2PLPA 3TEXA 1Z2MA 2O2VB 2IUUA 4MDKE 3JSVB 3RHUA 2FE8A 1AYFA 3WA0A 1GB4A 3AM9A 3AE5B 4A90A 2WDQB 2KX3A 2ASQA 4N59A 2DX5B 1VRAB 1FNVA 4AOFA 4WQMA 1L7YA 3CSFA 4RGTA 2V9HA 1MHHE 3M63B 1IPGA 3U2SC 4A09A 3SR6A 1JWSD 5JZEB 1Q5WB 2IUTA 1WMHB 2JRIB 5EE0A 3D32A 1LXDA 3A4RA 2N9XA 3V62A 4BZAA 3AN1A 1DGJA 2MEKA 3WANA 3NVYA 2KTRB 1UBQA 1Q10A 3K9OB 2BYEA 2K39A 2BQQA 4JIOU 2IDYA 2WXOA 1UZXB 4TQ1A 3I63C 3AV8A 2Y6IA 3DBHI 2Z0DB 4BVUC 3ZW3A 4ZYNA 4YTNB 4W9GA 4GN1A 1RRBA 1I7HA 2UWQA 4C4VB 4BBNC 3ALBA 2RDGA 4BAXA 2A4ZA 1FIQA 1FPYA 3DVGY 5J17A 2QSDA 2KTFA 1ZXHA 5IKCM 3SFDB 1I4PA 1RWSA 1ZGUB 2YVCA 3AH7A 1WI0A 4JGHB 2PTLA 2INNE 1TS4A 4HRSA 2GBRA 2IGDA 3EI2A 1EF1A 3I3TB 1GC6A 2CKHB 1PQSA 1J7BA 4GB9A 2ZW0A 2FIFA 1JWAD 1L2NA 3OAWA 4NY0A 1E8XA 1IBXB 1TY2A 2MBEA 1Z5SB 3A9JB 2RPVA 3ZRCA 2K8CA 2O6VA 2WP9B 3DPDA 2ZNVB 3R3MA 2LJ5A 5GMVA 1OFFA 2ZVOA 4FADA 3VHTC 2N9EB 2V3NA 3OLMD 3IBEA 1V1PB 1TTNA 2BVCA 4US8A 3MC0B 4FBJB 4WWNA 1UELA 1E7PB 1OQRA 1KFYB 5C23A 3BVMA 2WDTB 3BINA 2E1BA 2JZPA 1UD7A 3NVVA 4PYUA 3RNCC 3KLSX 3W1SA 4B9KA 2IGHA 3IT6B 5DPTA 3TEZA 4ANXA 4IC7B 2W55A 3WALA 2NPTB 2GBNA 2KC1A 3QJZA 1SBBB 1LM8B 4WJOA 3ZJUA 3KW5B 2ZEQA 3RT3B 2KDMA 3LB8C 3ZX4A 2KFJA 2I1KA 4WWPA 3I89A 2RSUA 2C7HA 4LJPB 4FJZA 1SE2A 2AL3A 1L6UA 2R2OA 2KOXA 2QCZA 2WXRA 1JQ4A 1D5MC 1D4BA 1ECRA 3PRPB 4M00A 3MJ5A 2YLMA 2EELA 4PS3A 3EI3A 4II3B 3AULA 3WAOA 4DXFA 3Q69A 3NHEB 4WURA 4BBNF 1YX5B 3WQZA 4W9KA 4NAWB 4FJVB 3TSSA 2CHXA 1GJZA 1ET9A 1GG3A 2WHIA 3NZ3A 4YWGG 4L23A 2Y50A 4NQLB 4TSSA 3PO0A 4ICUA 3ZTYA 2BKRB 1OQQA 2ZPYA 2RDBC 1WGGA 1YD8U 4EZLA 2HJ1A 3IVFA 2JXXA 2GI9A 3N9YC 3ZTCA 1V5TA 3ZKJC 2PW9A 4LNIA 5AEKB 2NBUA 2DZIA 3TEYA 3I8CA 1MJDA 2IO0B 3PVLA 2AQ3B 4MGIE 3L0WB 3URYA 4REZA 4NNJB 1K51A 3RFZB 5J2RA 4ARIA 1YX6B 4EUTA 4M02A 3AE8B 3Q8AA 1FM0D 2EMSA 2MJDA 5J18A 4EOYA 3HVDA 5CHWA 3MHZA 1RAXA 1YNTE 2ZNVC 2WLBA 2JX5A 1WJ6A 2JYTA 2PMVA 4ZRIA 1M94A 1E9MA 2JVCA 1J0GA 1V9JA 3L54A 1V86A 1P3QU 1AW7A 3QK0A 1E0ZA 4IWPA 5JHAA 4AR8A 2J0JA 2J53A 1BMLC 2G3QB 1IGDA 2ZVNA 2N9LA 4HLEA 4M8MA 2DZKA 2JU6X 2FAZA 3LXFA 4LJOB 3U30A 3ZYYX 2AYOB 4NQKE 2BYFA 1LGRA 2BB6A 2G4DB 1I42A 4KGTA 2KJRA 4W9HA 4KIKA 2KYWA 4YXDB 3PTFC 1V6EA 3AE3B 1QF6A 3A9KA 2WXKA 4AUQC 3I7KA 1YMHE 2D3CA 4GU2A 4US9A 2LVQA 1KF6B 3DDCB 2D10A 1XVIA 2INDC 2NS5A 3GE8C 3I7NA 2EMTA 1NEKB 2OJRA 3IAM1 4C56C 2M4NA 4G0NB 1EM7A 3W5VB 4J3OD 2ZTGA 2BPSA 4C00A 4C80A 2JWZA 2KLCA 3RPFC 4A0BA 2MBQA 4MACA 4D2KA 1R4NB 1E8YA 4IM2A 3ZTWA 5BO4B 4TZ4A 2BS4B 3V60A 3W5UB 2E6XA 3APDA 2N4FA 1S3SG 3NOBA 3P4RB 3SFEB 2IUSA 4TQ0A 3AECB 2WXHA 2NCNA 5IO9A 3FILB 1WXMA 2C7MB 4FXCA 1QOAA 2CU3A 2DYOA 2LUEA 4HROA 1HQRD 4A3PA 3EA6A 1VD2A 4MJSB 4MEMA 4W9JA 4KDLB 1NBFC 1FD6A 1FRDA 2WXGA 3BK2A 2J42A 2KANA 5IP4D 2NMQA 3L08A 2HYEA 1VZ6A 2PPHA 2N0SB 1TKGA 3EI4A 1JW9D 1TZ1A 1YN4A 3M62B 2FCNA 2K8HA 3T3NA 1J8CA 2I38A 4FA6A 2ZZGA 3CMMB 1WX7A 4JPSA 1T5XD 2FCSA 3A1QB 2RR9A 2KMAA 3H7PA 1IP9A 1GAQB 4DDGD 2KMCA 1V8CA 2KO3A 2UYZB 3DBSA 1ZKHA 1P98A 2HE7A 1L4ZB 4FN2A 1WXAA 2Y5BB 4P16A 1QILA 4ZRPA 5HFYA 1WMHA 3GB1A 1FRRA 3N1ZC 2DAJA 1L0VB 1N5XA 4H2AA 4JQWC 4K81A 3P42A 1NVID 2KJHB 2IZVB 3AE9B 4MGYE 2N7JA 3VR8B 3OWEB 1SE9A 4M0WB 3V61A 2GBJA 3MFGA 3I9V1 1A70A 4URKA 1IGCA 3ABVB 3V05A 1ACCA 3UF8A 3U8ZA 3ZW7A 2R2QA 3ZXRA 4GLSC 3JYUA 5CX3A 1BUIC 1S1QB 1QKZA 5HG2A 2MRPA 3DBHB 4WAFA 3KWLA 3Q3OC 1J7AA 1EU3A 1WF9A 2WXQA 3UINB 1QT9A 4GDKA 3S2AA 1DOYA 2W82A 3C19A 3R2IA 2A5UA 2K8BA 4KGRA 3VXWA 3Q8CA 1SB3C 1UNSA 4BKGA 1PGBA 4KVGB 1E5WA 1Q1OA 2CU1A 2CHWA 4RF0A 1KRHA 4RF1A 4S17A 1P7FA 3BVZA 3KWVA 5FR6A 5EE1A 1N61A 2Y3UA 2JZZA 2HTHA 1WRIA 4GOCA 1KM7A 2EKEC 3N20C 3QQ8B 3C8YA 1I35A 2TSSA 1YJIA 4AQ7A 5E6OA 2XN9C 3PZ7A 1YJJA 5TSSA 3KUCB 1XQQA 3QAQA 3TBLD 4ASWC 3P63A 4HPMB 3ZDMC 1KTKA 1VCBA 1F2RI 3PRZA 1VLBA 1ZXIA 1NYRA 3R8BA 2XK5A 4MGZE 5IN7A 1RYJA 2RDHA 3TCAA 1WXSA 4QAYA 4E54A 4AP4C 3VUYA 2AL6A 2KWUB 2LGDA 4KKJA 2FUHB 1SE4A 3H7SA 4AJWA 2KNBA 4K3BA 1NYQA 5AZGA 3A33B 3ZNZB 4OVUA 2K0PA 2KDBA 3P4SB 5FK9C 5MPOA 1WSPA 3VTVA 4YSYB 3ZNHB 2MW5A 3H6NA 4MGKE 2WX0A 5G2NA 1H8CA 2LRUA 1P1AA 1DYQA 1BT0A 4XDDA 3BIID 3I7PA 1XEEA 3IXSA 4WWMA 1AN8A 2L52A 4XC2A 1VZ8A 1WGHA 1F52A 3VTWA 4MM3A 1HA5A 4OHJA 3TIXA 2Y5PA 3JVZX 5HI1A 4LNKA 2K5PA 2CS4A 3KUDB 1HXYD 3M3JA 5HKHA 3N1YC 2V4LA 1PDXA 3R66C 3ZUNA 4PS7A 5AZFA 1CMXB 2KKCA 2QHOA 4EEWA 2KD0A 2RGFA 1FFVA 1WY8A 3MHSD 1YOVB 2J4XA 3PZ8A 3V6CB 4LLGM 1PFDA 1WX9A 4JWUC 1WZCA 3BVGA 3W2DA 3EECA 5BMGA 4HCNB 1HZ5A 2C60A 2NTTA 4II2B 3B1LX 1MI0A 1WGYA 2WDVB 2YEPB 1N5WA 4F8CB 1VJKA 1VZ7A 1TJEA 1FMAD 2I05A 4X57B 2IO3B 2C9WB 2FBWB 1XXGA 1U4AA 4BFRA 1HZ6A 4W9LA 2MHJA 1V49A 1HTOA 2UU7A 4N58A 2V1YA 1MVKA 1WZ3A 1XLNA 3L13A 5D3IB 1TT5B 2B5LA 3QWZB 4OVZA 4IM0A 1V97A 1CZPA 3PREA 2IY1B 2GLSA 1B9RA 3R7QA 3IFWB 1F9JA 3V6EB 1F2RC 4W9DA 2BGFA 2SAKA 4ZRKA 4KIKB 3AE2B 1UUPA 3J9CA 3A9KB 1E6EB 4CI1A 3AEFB 2BWES 2VRRB 2W9NA 3PS6A 3VVWB 3ZWDA 2SEBD 3B9JA 2JZ3B 1B1ZA 3R2TA 4YTMB 4USAA 1HE8A 1H4RA 3GE3C 2KDFB 3BY4B 4XZ4A 4B6WA 2L05A 1QZEA 3DVNV 2IPKD 2KACA 3VH3B 1RLFA 2KFKB 1JROA 4DDID 2MQJA 4JL9A 3QHTA 3NVWA 3P4QB 2DZJA 2VH2A 2H88B 2D11A 1MFWA 2BT6A 2WXLA 4L1BA 1EF5A 3SD5A 4YSXB 1WM3A 3ZRFA 1CQVA 5FR3A 3FILA 3WAMA 4S0RA 3DVGX 3W9CB 3Q3MC 4OW0A 2DENB 3A4SC 1LO5D 2AWTA 3NS1A 1C77A 1FO4A 2NBVB 4LCDE 4PS8A 3PLVA 1ROEA 4N6EB 2IBIB 4G50A 4JWSC 4B0MA 2OJWA 3RYTA 1WGDA 4RM8A 2KWVB 3NZSA 2PJHA 4GSWA 1V1PA 2ZZPB 4GMVA 2LWPA 3RNAC 5HHDG 2OHFA 3MTNB 2CJNA 3CIRB 3VRBB 4RH6A 4F7ZA 4A08A 2KWCA 2ONQA 5EDSA 2JWUA 3KUZA 4KGSA 2KDEB 2BTEA 1E7VA 2G4SA 2LASA 1XCTL 5E6NA 1WYWB 3B08A 1WR1A 4J6IA 4IG7B 2DWQA 2XEWA 4ANVA 3AE1B 1C1YB 1WH3A 3AU5A 2WS3B 3DVNU 3AEGB 1P0RA 1XCQL 2BYTA 3RNBC 3PT2B 3SU8X 2V0GA 4A0AA 1WYGA 4K1RB 2K6QA 4XR2A 2LVOA 1F1HA 2K25A 1T3QA 1QLBB 3EHVA 4RNAA 3P4PB 4M0WA 3Q2AC 3DBLB 3QX1A 3PRMB 2I2YA 4E74A 1C3TA 3RI7C 2PVGC 3I8EA 3VQIA 2OEDA 3N3KB 1KJTA 2ZJDA 1YQ3B 3U4EG 4HJKA 3KEWA 2MBBB 2XBBC 3NG0A 1T6BX 3RN9C 1YJ1A 1C4AA 3TUOA 1WWTA 2BBCA 1ZE3D 4NAWA 2ZCBA 4ITKA 3U7DA 2M0XA 3NJTA 4TV3A 3ZUPA 4DHJD 3DBLI 1D6EC 1UH6A 3E9SA 4MELA 1XLOA 2KT7A 4TKNA 2KJ6A 4ZOHC 5D3DA 2K6DB 3ETRA 2JXTA 5BYQA 5JHBA 2CR5A 2RD0A 2K22A 4L2YA 1UF0A 1NDDA 3PZDA 5C2TB 1FCLA 4FLHA 3ML8A 3HIZA 1JWBD 3DQVA 4R3DA 4XYCA 3DWGC 5KHQA 2QJLA 3RZFA 3O65B 2JUOA 4B0EA 1JALA 5CHVC 2FCMA 3TJPA 4O1NA 1VR9A 3Q8BA 4WWOA 3ONSA 3EFUA 4CI2A 4DXAB 2IYDB 5BYRA 3VH4B 4WJPA 2AQ2B 4HXDA 3RULA 4TMAB 2L0FA 2M0AA 4DQOC 2LVPA 1GOZA 2DHZA 2L3ZA 3WIMA 3PSEB 4PT5A 4OZAA 2N1WA 2MX2A 2WX1A 1UWMA 4A9AA 1KOTA 2RMMA 3V3XA 3OJ3A 4M01A 1WE6A 1UWXA 4HCPB 2R61A 2XK5B 3GP7A 1MPEA 3MC8A 1MG4A 1K8RB 2JPHA 2NBWB 1HTQA 1I4GA 3GZNI 2GOWA 3KH0A 3ZWKA 4LNNA 1ZDXA 5JXVA 2MSED 4DHJB 3BWUD
chains in the Genus database with same CATH topology
1KTKA 1OFFA 3UI3A 1F2RI 1VLBA 3AEEB 1ZXIA 1NYRA 1N62A 4RGMA 3R8BA 2V3NA 1V1PB 1RYJA 2RDHA 2GB1A 4E54A 4NZLB 1ZPSA 1F0ZA 4US8A 1K50A 4OZCA 3DWMA 3MC0B 4KKJA 1E7PB 1OQRA 1KFYB 1SE4A 2WDRB 1YN5A 2Y3AA 3AEDB 3BVMA 3T3OA 1NYQA 2E1BA 2JZPA 1EWCA 1Y56A 3NVVA 4ZRQA 5H92C 2K0PA 4YT0B 3P4SB 5FK9C 3KLSX 3Q8FA 1WSPA 3W1SA 5MPOA 4YSYB 4MM3B 1SXTA 2IGHA 3HUIA 3IT6B 1C79A 3TEZA 2GRIA 2W55A 2WNMA 4RCOA 4HJGE 2J52A 1SBBB 4ZHOA 1DYQA 5T8IA 3SEBA 1FNWA 1DOIA 4XDDA 3BIID 4EE2A 3I7PA 1XEEA 3IXSA 4WWMA 1AN8A 3I7LA 3ZJUA 2B5MA 1XLPA 1V7OA 2L52A 1VZ8A 2KDMA 4YTPB 1C4CA 3LB8C 1HA5A 4OHJA 2Y5PA 3I89A 5HI1A 2V3PA 2VZKB 2K5PA 1DOXA 1HXYD 3WCQA 1PDXA 1SE2A 4LTUA 5FKAC 1L6UA 1NI3A 1TYGB 5G5GA 2WXNA 2WXRA 2L1AA 3AE6B 1JQ4A 1FFVA 1D5MC 1VDVA 2G9HD 2N9KA 2J4XA 2VZKD 3NVZA 3IAS1 1D4BA 4XR1A 4XR0A 1ECRA 3PZ8A 2Z8LA 2LHDA 2BS3B 3MJ5A 2EELA 3FC4A 4LLGM 1PFDA 2QILA 2ON8A 1YN3A 1EWYC 1D5ZC 1KLUD 2KN4A 4JWUC 3BVGA 3EI3A 3W2DA 2DBYA 1PGXA 2LFIA 2KWDA 3AEBB 1MHXA 3Q69A 5BMGA 2H89B 1KH0A 4WURA 4DXFA 4RGOS 1HZ5A 3I7HA 1FXIA 3WQZA 2NTTA 3ZJTA 1MI0A 4NAWB 1SJHD 3TSSA 2WDVB 3FAHA 1ET9A 4XWTA 1C9FA 3NZ3A 3KQ4A 2YEPB 4L23A 4YWGG 1N5WA 2W54A 2Y50A 1STEA 1VJKA 4TSSA 3TEWA 3PO0A 1VZ7A 1TJEA 2QEJC 1FCCC 1HEZE 1OQQA 1FMAD 1ZOYB 2I05A 1PYWD 2LMCA 1I4QA 3BZDB 1PUTA 3AMZA 2FBWB 1I4XA 1XXGA 2HTME 1WNUA 2GI9A 1HZ6A 3N9YC 3ZQ4A 1SEBD 4N58A 2XNAC 1AWDA 2YEPF 4Q2JA 1ET6A 1MVKA 1K52A 2PW9A 4C7YA 1CK1A 2WXPA 2E3TA 3TEYA 4XDCA 3I8CA 1XLNA 1WGKA 4HKQA 2WXIA 1P7EA 3HRDD 5D3IB 2JSVX 1M4VA 2AQ3B 3B2FA 4GDKB 2B5LA 1I4HA 4OVZA 2BS2B 3URYA 4REZA 1XLQA 1V97A 2ZW1A 4IDIA 1CZPA 1K51A 1SF0A 3RFZB 3EGRA 4XWWA 3MP9A 4ARIA 3AE8B 1SJED 3Q8AA 2M56B 1FM0D 2MJDA 4OZBA 1FFUA 3HVDA 3MHZA 3LYYA 1B9RA 3H8HA 1YNTE 5E6JA 2WLBA 3VR9B 3BYYB 4P6VF 2JX5A 2JYTA 2PMVA 2BB5A 5BYSA 1QOGA 1F2RC 1E9MA 2NTSA 2WU5B 3Q8EA 2INPE 2WXMA 3B2GA 2SAKA 2M19A 3AE2B 4XR3A 3NUHB 2KQ4X 2IGGA 1AW7A 2ZZEA 1UUPA 3I7OA 1E0ZA 4C7ZA 3J9CA 1JMLA 1TS2A 1JRPA 4AR8A 2J53A 1BMLC 2Y5CA 1E6EB 1IGDA 2WXFA 1ZDVA 4CI1A 2N9LA 4IOIE 2JU6X 1SE3A 1C76A 1FXAA 3AEFB 3LXFA 4UDUC 1IBXA 3ZYYX 5BMIA 2SEBD 3B9JA 1SIJA 1B1ZA 3BYTB 3R2TA 5G5HA 4YTMB 2BB6A 3E0CA 4USAA 2PVOD 1JCKB 4KGTA 2AX5A 3NRZA 1L4DB 4A8XC 1ESFA 2JYEA 4YXDB 2IPKD 1L6VA 2KACA 2WQYB 3L4PA 3VRAB 4AR1A 1RFKA 3ZJVA 3AE3B 1E10A 5H8YE 1JROA 1L0YB 1QF6A 2WXKA 1GB1A 4IKGA 5LNK1 3I7KA 3NVWA 3P4QB 1YMHE 2KAJA 2L32A 1F77A 4NJCA 2WXJA 1L0XB 2ZZFA 4US9A 4XE0A 2H88B 1KF6B 2B76B 2MJEA 3I7NA 2BT6A 2WXLA 4AREA 1NEKB 3IAM1 2CJOA 4C56C 3W5VB 1EM7A 2V4IB 4L1BA 3EI1A 1FEHA 4J3OD 4YSXB 5AUKA 2ZTGA 1CQVA 5FR3A 4A55A 3FILA 4MT5A 4C80A 4ARFA 3U7ZA 3RPFC 4A0BA 1WXQA 4MACA 3W9CB 4D2KA 1L5PA 4OW0A 1N63A 1LO5D 3P1MA 4TZ4A 3NS1A 5EE9A 1C77A 1FO4A 1K53A 1KLGD 2BS4B 1TY0A 3W5UB 2E6XA 1ROEA 1XF5L 4N6EB 1WXOA 3P4RB 3SFEB 1JWUD 2MJ3A 2IUSA 1XO3A 4TQ0A 3AECB 4CI3A 4JWSC 4B0MA 2LEKA 1QOFA 2WXHA 1QOBA 1TKYA 3FILB 1V1PA 1V1OA 1EU4A 4FXCA 4WH4A 1QOAA 2CU3A 2DYOA 4CQNA 4HROA 1HQRD 5HHDG 4ZHPA 1ZUD2 2OHFA 3EA6A 2CJNA 1PGAA 4A11A 4MH8A 3CIRB 3VRBB 4RH6A 3I57A 1YQ4B 3U52E 2EKIA 2G1EA 5BMHA 1FD6A 4A08A 2ONQA 2JWUA 1SSNA 1FRDA 2WXGA 3BK2A 4KGSA 2J42A 2NMQA 4AS1A 4NAMA 2HYEA 1VZ6A 2N0SB 1R7SA 3AB5A 5GXGB 2BTEA 1TKGA 4A6QA 3EI4A 1JW9D 1YN4A 1XCTL 4E5ZA 3T3NA 2WU2B 2I38A 5AUIA 1UGJA 2ZZGA 4RFBA 2Q5WD 4RGNA 2LHEA 4JPSA 2AQ1B 1IUEA 1T5XD 2DWQA 2QIEB 3AE1B 2WS3B 3EUB2 2ICIA 4ARCA 4HKZE 3BK1A 4JE3B 3AEGB 1XCQL 1GAQB 2IJ0A 2DYMA 2BYTA 1V8CA 3AE7B 4JX1C 2ACZB 2V0GA 4A0AA 2JQRB 2PLPA 1CJEA 1WYGA 4GDLB 1ZP0B 2I06A 3TEXA 4XR2A 1BXTA 4DXGA 1L4ZB 2IUUA 1V4PA 4KX6B 1T3QA 1QLBB 2FE8A 5C3JB 3RHUA 4P16A 1QILA 4ZRPA 1AYFA 4RNAA 3P4PB 5HFYA 3GB1A 3AM9A 4M0WA 1FRRA 1GB4A 3AE5B 4A90A 2KMMA 2I2YA 4KKIA 5D7GA 2WDQB 1L0VB 1N5XA 2PVGC 2LGIA 4N59A 3I8EA 3VQIA 1VRAB 2K3UA 1FNVA 2OEDA 4H2AA 4WQMA 2MH7A 1YQ3B 4RGTA 3U4EG 3KEWA 1MHHE 1N60A 1QQRA 3P42A 1NVID 3U2SC 1J7CA 4A09A 3SR6A 3IT4B 2PIAA 5EE3A 1JWSD 3AE9B 3AEAB 2N7JA 1T6BX 3VR8B 3OWEB 1TZOA 1C78A 2D5GA 1C4AA 5I4DA 2IUTA 1NENB 3TUOA 1WWTA 2BBCA 1ZE3D 3MFGA 4YSZB 3I9V1 4ITKA 5EE0A 1A70A 1IGCA 3ABVB 3V05A 1ACCA 1D6EC 1TS5A 3E9SA 3AN1A 4GLSC 1XLOA 3GS2A 1DGJA 1BUIC 2MEKA 3E56A 4ZOHC 1FNUA 3O13A 1QKZA 3NVYA 5HG2A 5D3DA 1Q10A 2LUMA 2W3RA 3ETRA 2JXTA 5BYQA 4WAFA 3KWLA 2IDYA 2WXOA 1J7AA 2HDEA 4LK0M 1EU3A 2K22A 4L2YA 4TQ1A 4AR9A 5C2TB 1FCLA 3AV8A 2EWJA 2Y6IA 1JWBD 2WXQA 4R3DA 3DWGC 2QJLA 4B0EA 1JALA 2LJIA 4O1NA 1VR9A 1QT9A 3Q8BA 4YTNB 3AE4B 4CI2A 1TS3A 1I7HA 2QMTA 1DOYA 5BYRA 2AQ2B 2RDGA 1TKEA 1D5XC 5FQDA 1ENFA 2W82A 4TMAB 1FIQA 3CWIA 3R2IA 4KGRA 2M0AA 3Q8CA 4DQOC 1GOZA 1SB3C 1UNSA 1PGBA 4HEA1 4ZYSA 4RF0A 2QSDA 1KRHA 1RM6C 4PT5A 1ZXHA 4OZAA 4RF1A 3SFDB 1UWMA 1I4PA 4A9AA 1RWSA 3RFNA 1P7FA 3BVZA 2WP9B 3KWVA 3AH7A 5EE1A 1N61A 2Y3UA 2RMMA 2PTLA 3V3XA 1WRIA 3ZGZA 2INNE 1TS4A 4HRSA 2IGDA 3EI2A 3C8YA 2TSSA 2X38A 4WIPA 2FUG1 1UWXA 1YJIA 4AQ7A 1J7BA 2R61A 1GPXA 2ZW0A 2XN9C 1JWAD 2L83A 3GP7A 1C4PA 2K9XA 1MPEA 2DLBA 2W3SA 3PZ7A 1IBXB 1I4GA 1YJJA 5TSSA 1TY2A 3HVZA 1JWMD 1ZDXA 2RPVA 2PKOA 1I4RA 5JXVA 3P63A 2BW2A 3BWUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OFF A;  1OQQ A;  3KEW A;  4YSX B;  1N60 A;  5AUK A;  1VLB A;  1FMA D;  1ZOY B;  1NVI D;  1NYR A;  1N62 A;  1J7C A;  1ZXI A;  3AEE B;  3SR6 A;  2ZTG A;  1PUT A;  3AMZ A;  2FBW B;  4C80 A;  2PIA A;  1RYJ A;  2HTM E;  5EE3 A;  1WNU A;  3AE9 B;  3RPF C;  1WXQ A;  3AEA B;  3W9C B;  3VR8 B;  1F0Z A;  1L5P A;  4N58 A;  4US8 A;  1NEN B;  1WWT A;  3DWM A;  1AWD A;  1N63 A;  3P1M A;  3NS1 A;  1E7P B;  1OQR A;  1KFY B;  4ITK A;  5EE0 A;  5EE9 A;  4YSZ B;  1FO4 A;  2WDR B;  2BS4 B;  1A70 A;  4C7Y A;  3W5U B;  2E3T A;  3RFN A;  3ABV B;  3AED B;  1ROE A;  1NYQ A;  1XLN A;  4N6E B;  1WGK A;  1WXO A;  2E1B A;  3P4R B;  3SFE B;  3HRD D;  2MJ3 A;  3PO0 A;  1XO3 A;  3AEC B;  3NVV A;  4JWS C;  2LEK A;  5H92 C;  1QOF A;  3AN1 A;  3B2F A;  3W5V B;  4YT0 B;  1QOB A;  3P4S B;  1XLO A;  5MPO A;  1DGJ A;  2BS2 B;  4ZOH C;  4YSY B;  1TKY A;  1XLQ A;  1V97 A;  3NVY A;  3HUI A;  4FXC A;  4IDI A;  1QOA A;  2CU3 A;  1CZP A;  1SF0 A;  1JQ4 A;  2W55 A;  2W3R A;  3ETR A;  4HRO A;  3KWL A;  4ZHP A;  1ZUD 2;  2OHF A;  1J7A A;  2CJN A;  3AE8 B;  2M56 B;  1FM0 D;  2MJD A;  2K22 A;  3CIR B;  3VRB B;  4ZHO A;  5C2T B;  1FFU A;  1YQ4 B;  3AV8 A;  1B9R A;  1DOI A;  1JWB D;  2EKI A;  2G1E A;  3BII D;  3DWG C;  2QJL A;  4WWM A;  2WLB A;  3VR9 B;  1FRD A;  1JAL A;  1XLP A;  2JX5 A;  4P6V F;  1V7O A;  1QOG A;  1QT9 A;  2L52 A;  1E9M A;  4YTN B;  4YTP B;  3AE4 B;  3LB8 C;  2WU5 B;  1I7H A;  3B2G A;  1DOY A;  2N0S B;  1R7S A;  3AB5 A;  2M19 A;  5GXG B;  1TKG A;  3AE2 B;  1JW9 D;  1TKE A;  1FIQ A;  2WU2 B;  3CWI A;  1E0Z A;  2K5P A;  5AUI A;  4C7Z A;  1DOX A;  2ZZG A;  1JRP A;  1SB3 C;  3WCQ A;  1PDX A;  2Q5W D;  1E6E B;  2Y5C A;  4LTU A;  1L6U A;  2DWQ A;  1IUE A;  1NI3 A;  2QIE B;  3AE1 B;  1TYG B;  1FXA A;  3AEF B;  1KRH A;  1RM6 C;  3LXF A;  2WS3 B;  3EUB 2;  5G5G A;  3ZYY X;  5G5H A;  3AE6 B;  1SIJ A;  1UWM A;  3AEG B;  1FFV A;  1RWS A;  1VDV A;  3B9J A;  3SFD B;  4A9A A;  4USA A;  2PVO D;  4YTM B;  1GAQ B;  3AH7 A;  1N61 A;  5EE1 A;  2AX5 A;  3NRZ A;  1WRI A;  3NVZ A;  1V8C A;  3AE7 B;  2BS3 B;  4JX1 C;  4YXD B;  2ACZ B;  1L6V A;  3FC4 A;  4HRS A;  2JQR B;  1PFD A;  1CJE A;  1WYG A;  1ZP0 B;  2WQY B;  3L4P A;  3VRA B;  1EWY C;  4JWU C;  1RFK A;  1YJI A;  3AE3 B;  1J7B A;  5H8Y E;  1JRO A;  2DBY A;  1QF6 A;  1E10 A;  1GPX A;  3AEB B;  1V4P A;  1JWA D;  2L83 A;  2H89 B;  2K9X A;  4KX6 B;  1T3Q A;  1QLB B;  2W3S A;  5C3J B;  1FXI A;  3NVW A;  3P4Q B;  2KAJ A;  2ZZF A;  3RHU A;  2ZZE A;  1AYF A;  3WQZ A;  3P4P B;  4US9 A;  1YJJ A;  3AM9 A;  1FRR A;  3HVZ A;  3AE5 B;  2KMM A;  2H88 B;  1KF6 B;  2B76 B;  2WDV B;  3FAH A;  2WDQ B;  2MJE A;  2PKO A;  1L0V B;  1N5X A;  2PVG C;  4N59 A;  2BT6 A;  1NEK B;  1N5W A;  2W54 A;  2CJO A;  1VJK A;  3P63 A;  4WQM A;  2MH7 A;  1TJE A;  2WP9 B;  1YQ3 B; 
#chains in the Genus database with same CATH topology
 4FHJ A;  4N9F 4;  3UI3 A;  1T0Y A;  1N62 A;  1WJU A;  2DZM A;  3DOW A;  1ZPS A;  1F0Z A;  1K50 A;  3DWM A;  2JF5 A;  4PK1 A;  3QAR A;  3T3O A;  3GZN B;  2BWF A;  4LNO A;  5H92 C;  3ZVV A;  4KZC A;  4MM3 B;  3HUI A;  1YIW A;  2WNM A;  1GC7 A;  2J52 A;  2CHZ A;  3ZTD A;  1ZW7 A;  4P7I A;  2PE9 A;  4P1B C;  3ZDT A;  5T8I A;  3SEB A;  1FNW A;  3VTU A;  4EE2 A;  1SIF A;  1V80 A;  3I7L A;  2B5M A;  1XLP A;  1V7O A;  4YTP B;  1C4C A;  5IAA C;  2KQ7 A;  1V5O A;  2JRH A;  2V3P A;  3DHH C;  1DOX A;  3ECI A;  4TUU A;  4MJS A;  4LTU A;  5FKA C;  4K7U A;  1TYG B;  4G11 A;  5G5G A;  2WXN A;  4F1S A;  2LD9 A;  1VDV A;  2G9H D;  2N9K A;  3PHX B;  3NVZ A;  4ZDV A;  4XR0 A;  4M8N A;  3I5J C;  2BS3 B;  5D2M B;  2QIL A;  2ON8 A;  1YN3 A;  1D5Z C;  1KLU D;  2KN4 A;  3SDL C;  1PGX A;  2LFI A;  2KWD A;  1MHX A;  2N7D A;  1KH0 A;  3I7H A;  1FXI A;  2X8X X;  5IOI A;  3ZJT A;  1OEY A;  3PLU A;  3VDZ A;  4W9I A;  1WIA A;  3H7P B;  3FAH A;  4XWT A;  1C9F A;  4BKT A;  2QEJ C;  2ZOS A;  1FCC C;  1HEZ E;  3ENE A;  3QCA A;  2KVR A;  1I4Q A;  2LMC A;  3AMZ A;  2HTM E;  2KTR A;  2NVU I;  5CHF A;  3N30 A;  4P1C C;  5L83 A;  2QC8 A;  2BYV E;  2YEP F;  3ZLZ A;  1ET6 A;  4B95 A;  1K52 A;  2Z59 B;  3EC8 A;  2PE6 B;  2WXP A;  4EFO A;  4XDC A;  1J19 A;  5LLI A;  1WGK A;  3X23 A;  2JY6 A;  1P7E A;  1T0R C;  3HRD D;  1M4V A;  2IO1 B;  4HVB A;  2LGX A;  3B2F A;  4C4V A;  2ZW1 A;  4IDI A;  4XWW A;  1T0Q C;  2QDF A;  1TGZ B;  1SJE D;  2M56 B;  1OQY A;  3ZNI D;  1FFU A;  1WM2 A;  3LYY A;  1WJ4 A;  3H8H A;  4BOS C;  2L8J A;  3AU4 A;  5D94 A;  3VR9 B;  1T0S C;  4P6V F;  2N1V A;  2BB5 A;  2D07 B;  2MA9 B;  3Q8E A;  3UQB A;  2WXM A;  3L16 A;  2LRW A;  4XR3 A;  3NUH B;  4HDQ A;  2L7R A;  1G6J A;  2IGG A;  1AAR A;  1JML A;  1V81 A;  4CYE A;  2WXF A;  1ZDV A;  3DCG A;  4RMA A;  1FXT B;  1V2Y A;  4IOI E;  3KVF B;  1FXA A;  1IBX A;  2V3S A;  5G5H A;  1SIJ A;  3BYT B;  3A9J A;  3PV1 A;  3E0C A;  3W1Y A;  1L4D B;  1ESF A;  3LDZ E;  1XT9 B;  2M17 A;  4DWF A;  2J0K A;  1L6V A;  2D3G A;  4YL8 A;  2K1F A;  2WQY B;  3L4P A;  3VRA B;  3R7R A;  1RFK A;  3ZJV A;  3RD2 A;  5H8Y E;  1GB1 A;  4IKG A;  5LNK 1;  4FUL A;  4KV2 A;  3NY5 A;  4NJC A;  4PYZ A;  2ZZF A;  2WXJ A;  4XE0 A;  1WZ0 A;  2MJE A;  1TIF A;  2FID A;  3OG5 A;  2CJO A;  3Q6B A;  3LJ3 A;  2MP2 A;  3RUI B;  3EI1 A;  1FEH A;  2LGY A;  3TMP B;  4A55 A;  4MT5 A;  2J7Q B;  3U7Z A;  1UGM A;  1WXQ A;  1L5P A;  2WYQ A;  2NPT A;  1N63 A;  3P1M A;  5EE9 A;  4NJ6 A;  2MLB A;  1KLG D;  5DPS A;  1WXO A;  4GXB A;  1JWU D;  2MJ3 A;  3RNE C;  3Q3J A;  2KK8 A;  1WRD B;  2MBH A;  1N6Z A;  4I6P A;  2C5L C;  1TKY A;  2KX0 A;  1EU4 A;  4CQN A;  4ZHP A;  1PGA A;  4MH0 E;  4A11 A;  3I57 A;  3U52 E;  1GUA B;  2N9P C;  2G1E A;  3ZO5 B;  4EZJ A;  1WX8 A;  4WJN A;  4AS1 A;  3RCZ A;  4NAM A;  4KSK C;  5GXG B;  2C7N B;  1E7U A;  5AUI A;  2LI5 A;  4IUM B;  2Q5W D;  4RGN A;  2LHE A;  1IUE A;  2QIE B;  2ICI A;  3BK1 A;  4JE3 B;  4DHZ B;  5KHO A;  2KN5 A;  4AJY B;  4JX1 C;  2JQR B;  1CJE A;  4GDL B;  1ZP0 B;  2I06 A;  3P2B A;  1BXT A;  1EO6 A;  5D6J B;  4DXG A;  3DHI C;  1V4P A;  1WR6 E;  4KX6 B;  5C3J B;  4HWI B;  2ZZE A;  3L17 A;  3AXC A;  2DAF A;  2KMM A;  4KKI A;  5D7G A;  3IG3 A;  2LZ6 A;  2LGI A;  3KYC D;  2K3U A;  3ZXV A;  2MH7 A;  3B0A A;  4LDT D;  2WWZ A;  3GOE A;  1N60 A;  1QQR A;  3Q14 C;  1J7C A;  2O2V A;  3IT4 B;  2PIA A;  5EE3 A;  3AEA B;  3JSV A;  1TZO A;  1C78 A;  2D5G A;  2KC2 A;  5I4D A;  1NEN B;  4ICV A;  3W1S C;  3N1X C;  4YSZ B;  2IO2 B;  2KQS A;  4K7W A;  4NPN A;  2KDI A;  3ZU6 A;  3NS8 A;  1TS5 A;  2AEH A;  1EUV B;  3AI5 A;  3T8M A;  3GS2 A;  3E56 A;  1FNU A;  3O13 A;  4CO7 A;  2LUM A;  4DBG A;  1GNU A;  2W3R A;  4BOZ B;  3K9P B;  3ML9 A;  3QIJ A;  3N32 A;  2HDE A;  4LK0 M;  3HM6 X;  2ZCC A;  4AR9 A;  2EWJ A;  3DHG C;  4GIV A;  2LJI A;  3PPA A;  4K7S A;  3AE4 B;  5DPW A;  1TS3 A;  2QMT A;  3Q3F A;  2L00 B;  4IM3 A;  2KLG A;  1TKE A;  4WQO B;  1D5X C;  3VUX A;  5FQD A;  1ENF A;  4KZ0 A;  3CWI A;  2I1J A;  3HM3 A;  2FNJ B;  4HEA 1;  4ZYS A;  1RM6 C;  5C1Z A;  2G45 B;  3RFN A;  1RFA A;  3EFC A;  3TL5 A;  3ZNG C;  3ZGZ A;  4ACF A;  2X38 A;  4WIP A;  2FUG 1;  3IHP C;  1GPX A;  2L83 A;  1C4P A;  1JRU A;  2K9X A;  2L76 A;  2DLB A;  2W3S A;  3PGE A;  2IY0 B;  1SGH A;  4LNF A;  3HVZ A;  1JWM D;  2M1M A;  4IW0 A;  2PKO A;  1R4M I;  3MJW A;  1I4R A;  4XX5 A;  1WE7 A;  2REX A;  2BW2 A;  3AEE B;  4RGM A;  2KFK A;  4OVV A;  2GB1 A;  1LQB A;  1D3Z A;  4NZL B;  4OZC A;  3PHW B;  4LDT B;  2BF8 B;  2WDR B;  2M8S A;  1YN5 A;  2Y3A A;  3AED B;  2O6V B;  4HPP A;  3VFK A;  4RM9 A;  1EWC A;  1Y56 A;  2O6V D;  2LXA A;  1NI2 A;  4G3X B;  4ZRQ A;  4I6L B;  4YT0 B;  3Q8F A;  3MC9 A;  3M95 A;  1SXT A;  4HK2 A;  3H9D A;  1C79 A;  2MCN B;  2GRI A;  4RCO A;  4WJQ A;  4HJG E;  3KYD D;  4ZHO A;  1DOI A;  3A1Q A;  3JW0 X;  5IA7 A;  1MG8 A;  5TR5 A;  1KLV A;  2INC C;  2VZK B;  4E3C A;  2LGS A;  3WCQ A;  4W9E A;  3VUW A;  1R4M B;  1NI3 A;  4MSQ B;  2L1A A;  3AE6 B;  4K3C A;  2VZK D;  3IAS 1;  4XR1 A;  1E8Z A;  2Z8L A;  2LHD A;  3SHQ A;  1YQB A;  3FC4 A;  2KXJ A;  1WFY A;  1EWY C;  4IWQ A;  2DBY A;  3AEB B;  2LXC A;  2H89 B;  3CST A;  4RGO S;  5DPR A;  4A3O A;  4XGA B;  1SJH D;  2RPQ A;  1OTR B;  3KQ4 A;  2N7E A;  2W54 A;  1STE A;  3TEW A;  1LFD A;  4JLC A;  5G55 A;  3HHM A;  1ZOY B;  1PYW D;  3BZD B;  5LXI B;  1PUT A;  2J0M A;  1I4X A;  3L10 B;  1WNU A;  3C0R B;  1R4N I;  3ZQ4 A;  1SEB D;  2XNA C;  1AWD A;  4Q2J A;  2JT4 B;  4C7Y A;  1CK1 A;  2E3T A;  2D2Q A;  3UIO B;  4HKQ A;  2WXI A;  2JSV X;  2HJ8 A;  1OGW A;  4GDK B;  4A20 A;  1I4H A;  4ANW A;  2BS2 B;  5DCN A;  1XLQ A;  1E90 A;  1SF0 A;  3EGR A;  1Q0W B;  2KVZ A;  3MP9 A;  4FHK A;  3UQA A;  4IWO A;  2VH1 A;  2GBM A;  4OZB A;  1P9D U;  5L95 C;  3T9L A;  4GGQ A;  2OOB B;  5E6J A;  3HK0 A;  3BYY B;  5BYS A;  1QOG A;  5JH5 C;  2NTS A;  2WU5 B;  2D3B A;  2INP E;  3B2G A;  3WAP A;  2M19 A;  4CHK A;  2KQ4 X;  4NJ7 A;  2Z0E B;  3I7O A;  4C7Z A;  1TS2 A;  3RNF C;  3UGB B;  1JRP A;  2Y5C A;  1SE3 A;  1C76 A;  4UDU C;  5BMI A;  2PVO D;  1JCK B;  3X0W A;  2AX5 A;  2GMI C;  1WJN A;  2HD5 B;  3NRZ A;  4A8X C;  2JYE A;  2MP2 B;  1UBI A;  2L0T A;  3FKY A;  4AR1 A;  4I6N B;  1E10 A;  1L0Y B;  2BKF A;  1WGR A;  3CF6 E;  2KAJ A;  2L32 A;  1F77 A;  1L0X B;  3Q3N C;  1X1M A;  2B76 B;  2D3A A;  3RMK C;  4ARE A;  4EKU A;  4E71 A;  4EZK A;  2V4I B;  2FCQ A;  4WAA A;  5AUK A;  2MWS B;  1ISN A;  3ZIM A;  4W9F A;  4ZRJ A;  1WXV A;  4ARF A;  3DBR B;  2KZR A;  2WGS A;  3OJ4 B;  4AWJ A;  4HPL B;  5CTR C;  3QC8 B;  4W9C A;  1K53 A;  2GBK A;  1TY0 A;  3UIP B;  1XF5 L;  2DNF A;  5AZH A;  1XO3 A;  1IYF A;  4CI3 A;  3RZW C;  2LEK A;  1QOF A;  1A5R A;  1QOB A;  1OEY J;  2DYB A;  1V1O A;  4WH4 A;  3NZU A;  2ZPN A;  3H1U A;  1ZUD 2;  4MH8 A;  4BKS A;  1XD3 B;  3VAW A;  1YQ4 B;  2NR2 A;  2PEA A;  2EKI A;  5BMH A;  5LXH A;  1SSN A;  3ZX5 A;  4KDI C;  3APC A;  2B3A A;  4FJY A;  4BKS D;  5E6P A;  3QA8 A;  1R7S A;  3AB5 A;  4A6Q A;  1Y8R C;  4KSL C;  4E5Z A;  4GDL A;  3APF A;  2WU2 B;  4DK5 A;  1TBE A;  1UGJ A;  2MBO A;  4RFB A;  4HDO A;  2AQ1 B;  1E8W A;  3DBR I;  3EUB 2;  4ARC A;  4MSM B;  4HKZ E;  4ANU A;  4DHZ E;  3RNG C;  2KHW B;  2IJ0 A;  2DYM A;  3AE7 B;  2ACZ B;  2PLP A;  3TEX A;  1Z2M A;  2O2V B;  2IUU A;  4MDK E;  3JSV B;  3RHU A;  2FE8 A;  1AYF A;  3WA0 A;  1GB4 A;  3AM9 A;  3AE5 B;  4A90 A;  2WDQ B;  2KX3 A;  2ASQ A;  4N59 A;  2DX5 B;  1VRA B;  1FNV A;  4AOF A;  4WQM A;  1L7Y A;  3CSF A;  4RGT A;  2V9H A;  1MHH E;  3M63 B;  1IPG A;  3U2S C;  4A09 A;  3SR6 A;  1JWS D;  5JZE B;  1Q5W B;  2IUT A;  1WMH B;  2JRI B;  5EE0 A;  3D32 A;  1LXD A;  3A4R A;  2N9X A;  3V62 A;  4BZA A;  3AN1 A;  1DGJ A;  2MEK A;  3WAN A;  3NVY A;  2KTR B;  1UBQ A;  1Q10 A;  3K9O B;  2BYE A;  2K39 A;  2BQQ A;  4JIO U;  2IDY A;  2WXO A;  1UZX B;  4TQ1 A;  3I63 C;  3AV8 A;  2Y6I A;  3DBH I;  2Z0D B;  4BVU C;  3ZW3 A;  4ZYN A;  4YTN B;  4W9G A;  4GN1 A;  1RRB A;  1I7H A;  2UWQ A;  4C4V B;  4BBN C;  3ALB A;  2RDG A;  4BAX A;  2A4Z A;  1FIQ A;  1FPY A;  3DVG Y;  5J17 A;  2QSD A;  2KTF A;  1ZXH A;  5IKC M;  3SFD B;  1I4P A;  1RWS A;  1ZGU B;  2YVC A;  3AH7 A;  1WI0 A;  4JGH B;  2PTL A;  2INN E;  1TS4 A;  4HRS A;  2GBR A;  2IGD A;  3EI2 A;  1EF1 A;  3I3T B;  1GC6 A;  2CKH B;  1PQS A;  1J7B A;  4GB9 A;  2ZW0 A;  2FIF A;  1JWA D;  1L2N A;  3OAW A;  4NY0 A;  1E8X A;  1IBX B;  1TY2 A;  2MBE A;  1Z5S B;  3A9J B;  2RPV A;  3ZRC A;  2K8C A;  2O6V A;  2WP9 B;  3DPD A;  2ZNV B;  3R3M A;  2LJ5 A;  5GMV A;  1OFF A;  2ZVO A;  4FAD A;  3VHT C;  2N9E B;  2V3N A;  3OLM D;  3IBE A;  1V1P B;  1TTN A;  2BVC A;  4US8 A;  3MC0 B;  4FBJ B;  4WWN A;  1UEL A;  1E7P B;  1OQR A;  1KFY B;  5C23 A;  3BVM A;  2WDT B;  3BIN A;  2E1B A;  2JZP A;  1UD7 A;  3NVV A;  4PYU A;  3RNC C;  3KLS X;  3W1S A;  4B9K A;  2IGH A;  3IT6 B;  5DPT A;  3TEZ A;  4ANX A;  4IC7 B;  2W55 A;  3WAL A;  2NPT B;  2GBN A;  2KC1 A;  3QJZ A;  1SBB B;  1LM8 B;  4WJO A;  3ZJU A;  3KW5 B;  2ZEQ A;  3RT3 B;  2KDM A;  3LB8 C;  3ZX4 A;  2KFJ A;  2I1K A;  4WWP A;  3I89 A;  2RSU A;  2C7H A;  4LJP B;  4FJZ A;  1SE2 A;  2AL3 A;  1L6U A;  2R2O A;  2KOX A;  2QCZ A;  2WXR A;  1JQ4 A;  1D5M C;  1D4B A;  1ECR A;  3PRP B;  4M00 A;  3MJ5 A;  2YLM A;  2EEL A;  4PS3 A;  3EI3 A;  4II3 B;  3AUL A;  3WAO A;  4DXF A;  3Q69 A;  3NHE B;  4WUR A;  4BBN F;  1YX5 B;  3WQZ A;  4W9K A;  4NAW B;  4FJV B;  3TSS A;  2CHX A;  1GJZ A;  1ET9 A;  1GG3 A;  2WHI A;  3NZ3 A;  4YWG G;  4L23 A;  2Y50 A;  4NQL B;  4TSS A;  3PO0 A;  4ICU A;  3ZTY A;  2BKR B;  1OQQ A;  2ZPY A;  2RDB C;  1WGG A;  1YD8 U;  4EZL A;  2HJ1 A;  3IVF A;  2JXX A;  2GI9 A;  3N9Y C;  3ZTC A;  1V5T A;  3ZKJ C;  2PW9 A;  4LNI A;  5AEK B;  2NBU A;  2DZI A;  3TEY A;  3I8C A;  1MJD A;  2IO0 B;  3PVL A;  2AQ3 B;  4MGI E;  3L0W B;  3URY A;  4REZ A;  4NNJ B;  1K51 A;  3RFZ B;  5J2R A;  4ARI A;  1YX6 B;  4EUT A;  4M02 A;  3AE8 B;  3Q8A A;  1FM0 D;  2EMS A;  2MJD A;  5J18 A;  4EOY A;  3HVD A;  5CHW A;  3MHZ A;  1RAX A;  1YNT E;  2ZNV C;  2WLB A;  2JX5 A;  1WJ6 A;  2JYT A;  2PMV A;  4ZRI A;  1M94 A;  1E9M A;  2JVC A;  1J0G A;  1V9J A;  3L54 A;  1V86 A;  1P3Q U;  1AW7 A;  3QK0 A;  1E0Z A;  4IWP A;  5JHA A;  4AR8 A;  2J0J A;  2J53 A;  1BML C;  2G3Q B;  1IGD A;  2ZVN A;  2N9L A;  4HLE A;  4M8M A;  2DZK A;  2JU6 X;  2FAZ A;  3LXF A;  4LJO B;  3U30 A;  3ZYY X;  2AYO B;  4NQK E;  2BYF A;  1LGR A;  2BB6 A;  2G4D B;  1I42 A;  4KGT A;  2KJR A;  4W9H A;  4KIK A;  2KYW A;  4YXD B;  3PTF C;  1V6E A;  3AE3 B;  1QF6 A;  3A9K A;  2WXK A;  4AUQ C;  3I7K A;  1YMH E;  2D3C A;  4GU2 A;  4US9 A;  2LVQ A;  1KF6 B;  3DDC B;  2D10 A;  1XVI A;  2IND C;  2NS5 A;  3GE8 C;  3I7N A;  2EMT A;  1NEK B;  2OJR A;  3IAM 1;  4C56 C;  2M4N A;  4G0N B;  1EM7 A;  3W5V B;  4J3O D;  2ZTG A;  2BPS A;  4C00 A;  4C80 A;  2JWZ A;  2KLC A;  3RPF C;  4A0B A;  2MBQ A;  4MAC A;  4D2K A;  1R4N B;  1E8Y A;  4IM2 A;  3ZTW A;  5BO4 B;  4TZ4 A;  2BS4 B;  3V60 A;  3W5U B;  2E6X A;  3APD A;  2N4F A;  1S3S G;  3NOB A;  3P4R B;  3SFE B;  2IUS A;  4TQ0 A;  3AEC B;  2WXH A;  2NCN A;  5IO9 A;  3FIL B;  1WXM A;  2C7M B;  4FXC A;  1QOA A;  2CU3 A;  2DYO A;  2LUE A;  4HRO A;  1HQR D;  4A3P A;  3EA6 A;  1VD2 A;  4MJS B;  4MEM A;  4W9J A;  4KDL B;  1NBF C;  1FD6 A;  1FRD A;  2WXG A;  3BK2 A;  2J42 A;  2KAN A;  5IP4 D;  2NMQ A;  3L08 A;  2HYE A;  1VZ6 A;  2PPH A;  2N0S B;  1TKG A;  3EI4 A;  1JW9 D;  1TZ1 A;  1YN4 A;  3M62 B;  2FCN A;  2K8H A;  3T3N A;  1J8C A;  2I38 A;  4FA6 A;  2ZZG A;  3CMM B;  1WX7 A;  4JPS A;  1T5X D;  2FCS A;  3A1Q B;  2RR9 A;  2KMA A;  3H7P A;  1IP9 A;  1GAQ B;  4DDG D;  2KMC A;  1V8C A;  2KO3 A;  2UYZ B;  3DBS A;  1ZKH A;  1P98 A;  2HE7 A;  1L4Z B;  4FN2 A;  1WXA A;  2Y5B B;  4P16 A;  1QIL A;  4ZRP A;  5HFY A;  1WMH A;  3GB1 A;  1FRR A;  3N1Z C;  2DAJ A;  1L0V B;  1N5X A;  4H2A A;  4JQW C;  4K81 A;  3P42 A;  1NVI D;  2KJH B;  2IZV B;  3AE9 B;  4MGY E;  2N7J A;  3VR8 B;  3OWE B;  1SE9 A;  4M0W B;  3V61 A;  2GBJ A;  3MFG A;  3I9V 1;  1A70 A;  4URK A;  1IGC A;  3ABV B;  3V05 A;  1ACC A;  3UF8 A;  3U8Z A;  3ZW7 A;  2R2Q A;  3ZXR A;  4GLS C;  3JYU A;  5CX3 A;  1BUI C;  1S1Q B;  1QKZ A;  5HG2 A;  2MRP A;  3DBH B;  4WAF A;  3KWL A;  3Q3O C;  1J7A A;  1EU3 A;  1WF9 A;  2WXQ A;  3UIN B;  1QT9 A;  4GDK A;  3S2A A;  1DOY A;  2W82 A;  3C19 A;  3R2I A;  2A5U A;  2K8B A;  4KGR A;  3VXW A;  3Q8C A;  1SB3 C;  1UNS A;  4BKG A;  1PGB A;  4KVG B;  1E5W A;  1Q1O A;  2CU1 A;  2CHW A;  4RF0 A;  1KRH A;  4RF1 A;  4S17 A;  1P7F A;  3BVZ A;  3KWV A;  5FR6 A;  5EE1 A;  1N61 A;  2Y3U A;  2JZZ A;  2HTH A;  1WRI A;  4GOC A;  1KM7 A;  2EKE C;  3N20 C;  3QQ8 B;  3C8Y A;  1I35 A;  2TSS A;  1YJI A;  4AQ7 A;  5E6O A;  2XN9 C;  3PZ7 A;  1YJJ A;  5TSS A;  3KUC B;  1XQQ A;  3QAQ A;  3TBL D;  4ASW C;  3P63 A;  4HPM B;  3ZDM C;  1KTK A;  1VCB A;  1F2R I;  3PRZ A;  1VLB A;  1ZXI A;  1NYR A;  3R8B A;  2XK5 A;  4MGZ E;  5IN7 A;  1RYJ A;  2RDH A;  3TCA A;  1WXS A;  4QAY A;  4E54 A;  4AP4 C;  3VUY A;  2AL6 A;  2KWU B;  2LGD A;  4KKJ A;  2FUH B;  1SE4 A;  3H7S A;  4AJW A;  2KNB A;  4K3B A;  1NYQ A;  5AZG A;  3A33 B;  3ZNZ B;  4OVU A;  2K0P A;  2KDB A;  3P4S B;  5FK9 C;  5MPO A;  1WSP A;  3VTV A;  4YSY B;  3ZNH B;  2MW5 A;  3H6N A;  4MGK E;  2WX0 A;  5G2N A;  1H8C A;  2LRU A;  1P1A A;  1DYQ A;  1BT0 A;  4XDD A;  3BII D;  3I7P A;  1XEE A;  3IXS A;  4WWM A;  1AN8 A;  2L52 A;  4XC2 A;  1VZ8 A;  1WGH A;  1F52 A;  3VTW A;  4MM3 A;  1HA5 A;  4OHJ A;  3TIX A;  2Y5P A;  3JVZ X;  5HI1 A;  4LNK A;  2K5P A;  2CS4 A;  3KUD B;  1HXY D;  3M3J A;  5HKH A;  3N1Y C;  2V4L A;  1PDX A;  3R66 C;  3ZUN A;  4PS7 A;  5AZF A;  1CMX B;  2KKC A;  2QHO A;  4EEW A;  2KD0 A;  2RGF A;  1FFV A;  1WY8 A;  3MHS D;  1YOV B;  2J4X A;  3PZ8 A;  3V6C B;  4LLG M;  1PFD A;  1WX9 A;  4JWU C;  1WZC A;  3BVG A;  3W2D A;  3EEC A;  5BMG A;  4HCN B;  1HZ5 A;  2C60 A;  2NTT A;  4II2 B;  3B1L X;  1MI0 A;  1WGY A;  2WDV B;  2YEP B;  1N5W A;  4F8C B;  1VJK A;  1VZ7 A;  1TJE A;  1FMA D;  2I05 A;  4X57 B;  2IO3 B;  2C9W B;  2FBW B;  1XXG A;  1U4A A;  4BFR A;  1HZ6 A;  4W9L A;  2MHJ A;  1V49 A;  1HTO A;  2UU7 A;  4N58 A;  2V1Y A;  1MVK A;  1WZ3 A;  1XLN A;  3L13 A;  5D3I B;  1TT5 B;  2B5L A;  3QWZ B;  4OVZ A;  4IM0 A;  1V97 A;  1CZP A;  3PRE A;  2IY1 B;  2GLS A;  1B9R A;  3R7Q A;  3IFW B;  1F9J A;  3V6E B;  1F2R C;  4W9D A;  2BGF A;  2SAK A;  4ZRK A;  4KIK B;  3AE2 B;  1UUP A;  3J9C A;  3A9K B;  1E6E B;  4CI1 A;  3AEF B;  2BWE S;  2VRR B;  2W9N A;  3PS6 A;  3VVW B;  3ZWD A;  2SEB D;  3B9J A;  2JZ3 B;  1B1Z A;  3R2T A;  4YTM B;  4USA A;  1HE8 A;  1H4R A;  3GE3 C;  2KDF B;  3BY4 B;  4XZ4 A;  4B6W A;  2L05 A;  1QZE A;  3DVN V;  2IPK D;  2KAC A;  3VH3 B;  1RLF A;  2KFK B;  1JRO A;  4DDI D;  2MQJ A;  4JL9 A;  3QHT A;  3NVW A;  3P4Q B;  2DZJ A;  2VH2 A;  2H88 B;  2D11 A;  1MFW A;  2BT6 A;  2WXL A;  4L1B A;  1EF5 A;  3SD5 A;  4YSX B;  1WM3 A;  3ZRF A;  1CQV A;  5FR3 A;  3FIL A;  3WAM A;  4S0R A;  3DVG X;  3W9C B;  3Q3M C;  4OW0 A;  2DEN B;  3A4S C;  1LO5 D;  2AWT A;  3NS1 A;  1C77 A;  1FO4 A;  2NBV B;  4LCD E;  4PS8 A;  3PLV A;  1ROE A;  4N6E B;  2IBI B;  4G50 A;  4JWS C;  4B0M A;  2OJW A;  3RYT A;  1WGD A;  4RM8 A;  2KWV B;  3NZS A;  2PJH A;  4GSW A;  1V1P A;  2ZZP B;  4GMV A;  2LWP A;  3RNA C;  5HHD G;  2OHF A;  3MTN B;  2CJN A;  3CIR B;  3VRB B;  4RH6 A;  4F7Z A;  4A08 A;  2KWC A;  2ONQ A;  5EDS A;  2JWU A;  3KUZ A;  4KGS A;  2KDE B;  2BTE A;  1E7V A;  2G4S A;  2LAS A;  1XCT L;  5E6N A;  1WYW B;  3B08 A;  1WR1 A;  4J6I A;  4IG7 B;  2DWQ A;  2XEW A;  4ANV A;  3AE1 B;  1C1Y B;  1WH3 A;  3AU5 A;  2WS3 B;  3DVN U;  3AEG B;  1P0R A;  1XCQ L;  2BYT A;  3RNB C;  3PT2 B;  3SU8 X;  2V0G A;  4A0A A;  1WYG A;  4K1R B;  2K6Q A;  4XR2 A;  2LVO A;  1F1H A;  2K25 A;  1T3Q A;  1QLB B;  3EHV A;  4RNA A;  3P4P B;  4M0W A;  3Q2A C;  3DBL B;  3QX1 A;  3PRM B;  2I2Y A;  4E74 A;  1C3T A;  3RI7 C;  2PVG C;  3I8E A;  3VQI A;  2OED A;  3N3K B;  1KJT A;  2ZJD A;  1YQ3 B;  3U4E G;  4HJK A;  3KEW A;  2MBB B;  2XBB C;  3NG0 A;  1T6B X;  3RN9 C;  1YJ1 A;  1C4A A;  3TUO A;  1WWT A;  2BBC A;  1ZE3 D;  4NAW A;  2ZCB A;  4ITK A;  3U7D A;  2M0X A;  3NJT A;  4TV3 A;  3ZUP A;  4DHJ D;  3DBL I;  1D6E C;  1UH6 A;  3E9S A;  4MEL A;  1XLO A;  2KT7 A;  4TKN A;  2KJ6 A;  4ZOH C;  5D3D A;  2K6D B;  3ETR A;  2JXT A;  5BYQ A;  5JHB A;  2CR5 A;  2RD0 A;  2K22 A;  4L2Y A;  1UF0 A;  1NDD A;  3PZD A;  5C2T B;  1FCL A;  4FLH A;  3ML8 A;  3HIZ A;  1JWB D;  3DQV A;  4R3D A;  4XYC A;  3DWG C;  5KHQ A;  2QJL A;  3RZF A;  3O65 B;  2JUO A;  4B0E A;  1JAL A;  5CHV C;  2FCM A;  3TJP A;  4O1N A;  1VR9 A;  3Q8B A;  4WWO A;  3ONS A;  3EFU A;  4CI2 A;  4DXA B;  2IYD B;  5BYR A;  3VH4 B;  4WJP A;  2AQ2 B;  4HXD A;  3RUL A;  4TMA B;  2L0F A;  2M0A A;  4DQO C;  2LVP A;  1GOZ A;  2DHZ A;  2L3Z A;  3WIM A;  3PSE B;  4PT5 A;  4OZA A;  2N1W A;  2MX2 A;  2WX1 A;  1UWM A;  4A9A A;  1KOT A;  2RMM A;  3V3X A;  3OJ3 A;  4M01 A;  1WE6 A;  1UWX A;  4HCP B;  2R61 A;  2XK5 B;  3GP7 A;  1MPE A;  3MC8 A;  1MG4 A;  1K8R B;  2JPH A;  2NBW B;  1HTQ A;  1I4G A;  3GZN I;  2GOW A;  3KH0 A;  3ZWK A;  4LNN A;  1ZDX A;  5JXV A;  2MSE D;  4DHJ B;  3BWU D; 
#chains in the Genus database with same CATH homology
 1KTK A;  1OFF A;  3UI3 A;  1F2R I;  1VLB A;  3AEE B;  1ZXI A;  1NYR A;  1N62 A;  4RGM A;  3R8B A;  2V3N A;  1V1P B;  1RYJ A;  2RDH A;  2GB1 A;  4E54 A;  4NZL B;  1ZPS A;  1F0Z A;  4US8 A;  1K50 A;  4OZC A;  3DWM A;  3MC0 B;  4KKJ A;  1E7P B;  1OQR A;  1KFY B;  1SE4 A;  2WDR B;  1YN5 A;  2Y3A A;  3AED B;  3BVM A;  3T3O A;  1NYQ A;  2E1B A;  2JZP A;  1EWC A;  1Y56 A;  3NVV A;  4ZRQ A;  5H92 C;  2K0P A;  4YT0 B;  3P4S B;  5FK9 C;  3KLS X;  3Q8F A;  1WSP A;  3W1S A;  5MPO A;  4YSY B;  4MM3 B;  1SXT A;  2IGH A;  3HUI A;  3IT6 B;  1C79 A;  3TEZ A;  2GRI A;  2W55 A;  2WNM A;  4RCO A;  4HJG E;  2J52 A;  1SBB B;  4ZHO A;  1DYQ A;  5T8I A;  3SEB A;  1FNW A;  1DOI A;  4XDD A;  3BII D;  4EE2 A;  3I7P A;  1XEE A;  3IXS A;  4WWM A;  1AN8 A;  3I7L A;  3ZJU A;  2B5M A;  1XLP A;  1V7O A;  2L52 A;  1VZ8 A;  2KDM A;  4YTP B;  1C4C A;  3LB8 C;  1HA5 A;  4OHJ A;  2Y5P A;  3I89 A;  5HI1 A;  2V3P A;  2VZK B;  2K5P A;  1DOX A;  1HXY D;  3WCQ A;  1PDX A;  1SE2 A;  4LTU A;  5FKA C;  1L6U A;  1NI3 A;  1TYG B;  5G5G A;  2WXN A;  2WXR A;  2L1A A;  3AE6 B;  1JQ4 A;  1FFV A;  1D5M C;  1VDV A;  2G9H D;  2N9K A;  2J4X A;  2VZK D;  3NVZ A;  3IAS 1;  1D4B A;  4XR1 A;  4XR0 A;  1ECR A;  3PZ8 A;  2Z8L A;  2LHD A;  2BS3 B;  3MJ5 A;  2EEL A;  3FC4 A;  4LLG M;  1PFD A;  2QIL A;  2ON8 A;  1YN3 A;  1EWY C;  1D5Z C;  1KLU D;  2KN4 A;  4JWU C;  3BVG A;  3EI3 A;  3W2D A;  2DBY A;  1PGX A;  2LFI A;  2KWD A;  3AEB B;  1MHX A;  3Q69 A;  5BMG A;  2H89 B;  1KH0 A;  4WUR A;  4DXF A;  4RGO S;  1HZ5 A;  3I7H A;  1FXI A;  3WQZ A;  2NTT A;  3ZJT A;  1MI0 A;  4NAW B;  1SJH D;  3TSS A;  2WDV B;  3FAH A;  1ET9 A;  4XWT A;  1C9F A;  3NZ3 A;  3KQ4 A;  2YEP B;  4L23 A;  4YWG G;  1N5W A;  2W54 A;  2Y50 A;  1STE A;  1VJK A;  4TSS A;  3TEW A;  3PO0 A;  1VZ7 A;  1TJE A;  2QEJ C;  1FCC C;  1HEZ E;  1OQQ A;  1FMA D;  1ZOY B;  2I05 A;  1PYW D;  2LMC A;  1I4Q A;  3BZD B;  1PUT A;  3AMZ A;  2FBW B;  1I4X A;  1XXG A;  2HTM E;  1WNU A;  2GI9 A;  1HZ6 A;  3N9Y C;  3ZQ4 A;  1SEB D;  4N58 A;  2XNA C;  1AWD A;  2YEP F;  4Q2J A;  1ET6 A;  1MVK A;  1K52 A;  2PW9 A;  4C7Y A;  1CK1 A;  2WXP A;  2E3T A;  3TEY A;  4XDC A;  3I8C A;  1XLN A;  1WGK A;  4HKQ A;  2WXI A;  1P7E A;  3HRD D;  5D3I B;  2JSV X;  1M4V A;  2AQ3 B;  3B2F A;  4GDK B;  2B5L A;  1I4H A;  4OVZ A;  2BS2 B;  3URY A;  4REZ A;  1XLQ A;  1V97 A;  2ZW1 A;  4IDI A;  1CZP A;  1K51 A;  1SF0 A;  3RFZ B;  3EGR A;  4XWW A;  3MP9 A;  4ARI A;  3AE8 B;  1SJE D;  3Q8A A;  2M56 B;  1FM0 D;  2MJD A;  4OZB A;  1FFU A;  3HVD A;  3MHZ A;  3LYY A;  1B9R A;  3H8H A;  1YNT E;  5E6J A;  2WLB A;  3VR9 B;  3BYY B;  4P6V F;  2JX5 A;  2JYT A;  2PMV A;  2BB5 A;  5BYS A;  1QOG A;  1F2R C;  1E9M A;  2NTS A;  2WU5 B;  3Q8E A;  2INP E;  2WXM A;  3B2G A;  2SAK A;  2M19 A;  3AE2 B;  4XR3 A;  3NUH B;  2KQ4 X;  2IGG A;  1AW7 A;  2ZZE A;  1UUP A;  3I7O A;  1E0Z A;  4C7Z A;  3J9C A;  1JML A;  1TS2 A;  1JRP A;  4AR8 A;  2J53 A;  1BML C;  2Y5C A;  1E6E B;  1IGD A;  2WXF A;  1ZDV A;  4CI1 A;  2N9L A;  4IOI E;  2JU6 X;  1SE3 A;  1C76 A;  1FXA A;  3AEF B;  3LXF A;  4UDU C;  1IBX A;  3ZYY X;  5BMI A;  2SEB D;  3B9J A;  1SIJ A;  1B1Z A;  3BYT B;  3R2T A;  5G5H A;  4YTM B;  2BB6 A;  3E0C A;  4USA A;  2PVO D;  1JCK B;  4KGT A;  2AX5 A;  3NRZ A;  1L4D B;  4A8X C;  1ESF A;  2JYE A;  4YXD B;  2IPK D;  1L6V A;  2KAC A;  2WQY B;  3L4P A;  3VRA B;  4AR1 A;  1RFK A;  3ZJV A;  3AE3 B;  1E10 A;  5H8Y E;  1JRO A;  1L0Y B;  1QF6 A;  2WXK A;  1GB1 A;  4IKG A;  5LNK 1;  3I7K A;  3NVW A;  3P4Q B;  1YMH E;  2KAJ A;  2L32 A;  1F77 A;  4NJC A;  2WXJ A;  1L0X B;  2ZZF A;  4US9 A;  4XE0 A;  2H88 B;  1KF6 B;  2B76 B;  2MJE A;  3I7N A;  2BT6 A;  2WXL A;  4ARE A;  1NEK B;  3IAM 1;  2CJO A;  4C56 C;  3W5V B;  1EM7 A;  2V4I B;  4L1B A;  3EI1 A;  1FEH A;  4J3O D;  4YSX B;  5AUK A;  2ZTG A;  1CQV A;  5FR3 A;  4A55 A;  3FIL A;  4MT5 A;  4C80 A;  4ARF A;  3U7Z A;  3RPF C;  4A0B A;  1WXQ A;  4MAC A;  3W9C B;  4D2K A;  1L5P A;  4OW0 A;  1N63 A;  1LO5 D;  3P1M A;  4TZ4 A;  3NS1 A;  5EE9 A;  1C77 A;  1FO4 A;  1K53 A;  1KLG D;  2BS4 B;  1TY0 A;  3W5U B;  2E6X A;  1ROE A;  1XF5 L;  4N6E B;  1WXO A;  3P4R B;  3SFE B;  1JWU D;  2MJ3 A;  2IUS A;  1XO3 A;  4TQ0 A;  3AEC B;  4CI3 A;  4JWS C;  4B0M A;  2LEK A;  1QOF A;  2WXH A;  1QOB A;  1TKY A;  3FIL B;  1V1P A;  1V1O A;  1EU4 A;  4FXC A;  4WH4 A;  1QOA A;  2CU3 A;  2DYO A;  4CQN A;  4HRO A;  1HQR D;  5HHD G;  4ZHP A;  1ZUD 2;  2OHF A;  3EA6 A;  2CJN A;  1PGA A;  4A11 A;  4MH8 A;  3CIR B;  3VRB B;  4RH6 A;  3I57 A;  1YQ4 B;  3U52 E;  2EKI A;  2G1E A;  5BMH A;  1FD6 A;  4A08 A;  2ONQ A;  2JWU A;  1SSN A;  1FRD A;  2WXG A;  3BK2 A;  4KGS A;  2J42 A;  2NMQ A;  4AS1 A;  4NAM A;  2HYE A;  1VZ6 A;  2N0S B;  1R7S A;  3AB5 A;  5GXG B;  2BTE A;  1TKG A;  4A6Q A;  3EI4 A;  1JW9 D;  1YN4 A;  1XCT L;  4E5Z A;  3T3N A;  2WU2 B;  2I38 A;  5AUI A;  1UGJ A;  2ZZG A;  4RFB A;  2Q5W D;  4RGN A;  2LHE A;  4JPS A;  2AQ1 B;  1IUE A;  1T5X D;  2DWQ A;  2QIE B;  3AE1 B;  2WS3 B;  3EUB 2;  2ICI A;  4ARC A;  4HKZ E;  3BK1 A;  4JE3 B;  3AEG B;  1XCQ L;  1GAQ B;  2IJ0 A;  2DYM A;  2BYT A;  1V8C A;  3AE7 B;  4JX1 C;  2ACZ B;  2V0G A;  4A0A A;  2JQR B;  2PLP A;  1CJE A;  1WYG A;  4GDL B;  1ZP0 B;  2I06 A;  3TEX A;  4XR2 A;  1BXT A;  4DXG A;  1L4Z B;  2IUU A;  1V4P A;  4KX6 B;  1T3Q A;  1QLB B;  2FE8 A;  5C3J B;  3RHU A;  4P16 A;  1QIL A;  4ZRP A;  1AYF A;  4RNA A;  3P4P B;  5HFY A;  3GB1 A;  3AM9 A;  4M0W A;  1FRR A;  1GB4 A;  3AE5 B;  4A90 A;  2KMM A;  2I2Y A;  4KKI A;  5D7G A;  2WDQ B;  1L0V B;  1N5X A;  2PVG C;  2LGI A;  4N59 A;  3I8E A;  3VQI A;  1VRA B;  2K3U A;  1FNV A;  2OED A;  4H2A A;  4WQM A;  2MH7 A;  1YQ3 B;  4RGT A;  3U4E G;  3KEW A;  1MHH E;  1N60 A;  1QQR A;  3P42 A;  1NVI D;  3U2S C;  1J7C A;  4A09 A;  3SR6 A;  3IT4 B;  2PIA A;  5EE3 A;  1JWS D;  3AE9 B;  3AEA B;  2N7J A;  1T6B X;  3VR8 B;  3OWE B;  1TZO A;  1C78 A;  2D5G A;  1C4A A;  5I4D A;  2IUT A;  1NEN B;  3TUO A;  1WWT A;  2BBC A;  1ZE3 D;  3MFG A;  4YSZ B;  3I9V 1;  4ITK A;  5EE0 A;  1A70 A;  1IGC A;  3ABV B;  3V05 A;  1ACC A;  1D6E C;  1TS5 A;  3E9S A;  3AN1 A;  4GLS C;  1XLO A;  3GS2 A;  1DGJ A;  1BUI C;  2MEK A;  3E56 A;  4ZOH C;  1FNU A;  3O13 A;  1QKZ A;  3NVY A;  5HG2 A;  5D3D A;  1Q10 A;  2LUM A;  2W3R A;  3ETR A;  2JXT A;  5BYQ A;  4WAF A;  3KWL A;  2IDY A;  2WXO A;  1J7A A;  2HDE A;  4LK0 M;  1EU3 A;  2K22 A;  4L2Y A;  4TQ1 A;  4AR9 A;  5C2T B;  1FCL A;  3AV8 A;  2EWJ A;  2Y6I A;  1JWB D;  2WXQ A;  4R3D A;  3DWG C;  2QJL A;  4B0E A;  1JAL A;  2LJI A;  4O1N A;  1VR9 A;  1QT9 A;  3Q8B A;  4YTN B;  3AE4 B;  4CI2 A;  1TS3 A;  1I7H A;  2QMT A;  1DOY A;  5BYR A;  2AQ2 B;  2RDG A;  1TKE A;  1D5X C;  5FQD A;  1ENF A;  2W82 A;  4TMA B;  1FIQ A;  3CWI A;  3R2I A;  4KGR A;  2M0A A;  3Q8C A;  4DQO C;  1GOZ A;  1SB3 C;  1UNS A;  1PGB A;  4HEA 1;  4ZYS A;  4RF0 A;  2QSD A;  1KRH A;  1RM6 C;  4PT5 A;  1ZXH A;  4OZA A;  4RF1 A;  3SFD B;  1UWM A;  1I4P A;  4A9A A;  1RWS A;  3RFN A;  1P7F A;  3BVZ A;  2WP9 B;  3KWV A;  3AH7 A;  5EE1 A;  1N61 A;  2Y3U A;  2RMM A;  2PTL A;  3V3X A;  1WRI A;  3ZGZ A;  2INN E;  1TS4 A;  4HRS A;  2IGD A;  3EI2 A;  3C8Y A;  2TSS A;  2X38 A;  4WIP A;  2FUG 1;  1UWX A;  1YJI A;  4AQ7 A;  1J7B A;  2R61 A;  1GPX A;  2ZW0 A;  2XN9 C;  1JWA D;  2L83 A;  3GP7 A;  1C4P A;  2K9X A;  1MPE A;  2DLB A;  2W3S A;  3PZ7 A;  1IBX B;  1I4G A;  1YJJ A;  5TSS A;  1TY2 A;  3HVZ A;  1JWM D;  1ZDX A;  2RPV A;  2PKO A;  1I4R A;  5JXV A;  3P63 A;  2BW2 A;  3BWU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...