1TJEA

Crystal structure of the editing domain of threonyl-trna synthetase
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
224
structure length
224
Chain Sequence
MPVITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNKMLQRIYGTAWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Achieving Error-Free Translation; The Mechanism of Proofreading of Threonyl-tRNA Synthetase at Atomic Resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords Threonyl-tRNA synthetase
total genus 76
structure length 224
sequence length 224
ec nomenclature ec 6.1.1.3: Threonine--tRNA ligase.
pdb deposition date 2004-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
A PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1tjeA01
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1tjeA03
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1tjeA02
3LB8C 2PVOD 5EE9A 5G5GA 5C3JB 3NVWA 2W54A 3AN1A 4JWUC 3ZYYX 3AE7B 4ZHOA 3VR8B 3EUB2 4USAA 4N58A 1YQ3B 5GXGB 3AMZA 4LTUA 3NVVA 4US8A 1F0ZA 1FRRA 5EE0A 1CJEA 1RYJA 2W3RA 3NVZA 1ZOYB 2B76B 1L0VB 2G1EA 1JALA 4YXDB 1N61A 1TYGB 2MJEA 2H89B 2BT6A 5AUIA 1XLOA 3AE3B 1NYQA 1TKGA 2BS3B 2MJ3A 4YSXB 4YTNB 3AE8B 2WDQB 3AE2B 1JROA 1NVID 3AB5A 3LXFA 3B2GA 5EE1A 2M19A 3SR6A 1JW9D 1I7HA 3RHUA 2WLBA 3AEBB 2DBYA 2AX5A 1B9RA 1WGKA 3AV8A 2PKOA 1RFKA 2WDVB 5AUKA 4US9A 4C7ZA 2MH7A 2JX5A 2WP9B 4KX6B 1QOAA 2W3SA 1UWMA 3AEEB 3B9JA 5C2TB 4YT0B 3W5VB 1FO4A 1GPXA 2ZZEA 3WQZA 1QLBB 3B2FA 2QJLA 3WCQA 1KRHA 3P4RB 3VR9B 1FXIA 1L6UA 1YJJA 2WU5B 2PIAA 3PO0A 1E9MA 1TKEA 2CJNA 1A70A 2QIEB 3DWGC 1J7AA 1AWDA 1XO3A 2ACZB 4WWMA 2BS2B 1QOGA 4HROA 1N62A 1NEKB 1DOYA 1TJEA 4HRSA 1E10A 1ZXIA 3AE5B 1XLQA 1FFVA 3RPFC 1SIJA 4YSYB 1QT9A 2BS4B 2L52A 3AECB 2E3TA 3P1MA 1J7CA 4YSZB 1RM6C 3ETRA 1RWSA 1J7BA 1WRIA 1R7SA 1DOXA 1IUEA 1FXAA 2H88B 1QOBA 3BIID 1FFUA 3AE6B 3P63A 2OHFA 2JQRB 4FXCA 3AH7A 1EWYC 1TKYA 3P4QB 1E0ZA 2DWQA 1JWBD 3RFNA 4P6VF 3AEFB 5H8YE 2MJDA 2N0SB 1XLPA 3AEAB 3AEGB 4ZOHC 2ZTGA 4N6EB 3SFDB 3DWMA 2FBWB 1L5PA 3VRAB 1ROEA 3CIRB 4YTMB 1OFFA 1SB3C 1OQRA 4C80A 1GAQB 1DOIA 2CU3A 5G5HA 1WNUA 1VJKA 2Q5WD 1JWAD 3CWIA 1T3QA 3AM9A 1DGJA 2K5PA 3KEWA 3HVZA 2K9XA 1FRDA 4JX1C 4IDIA 1N5XA 3AEDB 3P4SB 1CZPA 5EE3A 1XLNA 2KMMA 1E6EB 1WXQA 1V8CA 2CJOA 2WDRB 1AYFA 1OQQA 3ABVB 3AE1B 3NVYA 4ITKA 2WS3B 1WWTA 3L4PA 1FIQA 1V4PA 2PVGC 4ZHPA 2HTME 3NS1A 1KFYB 1WYGA 3AE4B 3FAHA 4N59A 1JRPA 2E1BA 1FMAD 2Y5CA 1N60A 1VDVA 2EKIA 2LEKA 1NYRA 3NRZA 1ZP0B 1PUTA 2M56B 3VRBB 1ZUD2 1WXOA 2W55A 1E7PB 3AE9B 5H92C 5MPOA 2L83A 3SFEB 1QOFA 3FC4A 3HUIA 1L6VA 1NI3A 1KF6B 1YQ4B 1N5WA 4JWSC 2WU2B 4YTPB 2ZZGA 2ZZFA 1V97A 4A9AA 3HRDD 3KWLA 1VLBA 1PFDA 1NENB 4C7YA 3W9CB 1N63A 4WQMA 2WQYB 3W5UB 1SF0A 2KAJA 3P4PB 1QF6A 1V7OA 1PDXA 1JQ4A 2K22A 1YJIA 1FM0D
chains in the Genus database with same CATH superfamily
2MA9B 4W9DA 2WDTB 2BYFA 3RCZA 1Q5WB 2LFIA 1LQBA 2CS4A 1F0ZA 3SU8X 2PMVA 2KJRA 1C77A 2W3RA 2CHXA 4A6QA 4AR8A 2KOXA 3AE3B 1TKGA 3U30A 2DZKA 2KDMA 2QEJC 1SE4A 3ZRFA 1JW9D 1KH0A 4NJCA 1RFKA 5AUKA 4M0WB 3TCAA 4XYCA 3ZTWA 1LXDA 2KJHB 1B1ZA 2B5LA 3K9OB 3IAS1 2MQJA 2RDHA 1AWDA 4BFRA 3W1SA 1DOYA 2IGHA 3E9SA 3MC0B 4ASWC 3AECB 4GOCA 1EWCA 3V6CB 2L0TA 2INNE 2DZJA 1DOXA 2MP2B 2R2QA 5AZGA 4EUTA 3TSSA 3AEFB 5H8YE 3M95A 1XLPA 4MGKE 3HM3A 4F1SA 4YTMB 4NAWB 1JCKB 1UNSA 1F52A 5T8IA 3UIPB 4A8XC 4RM8A 1JWAD 3CWIA 2J0KA 2AQ3B 1RFAA 4I6LB 2LVPA 4IDIA 3B0AA 1WGDA 5EE3A 3C8YA 1SE9A 2CJOA 2X38A 3OAWA 3L4PA 4DHJB 1E7UA 3T8MA 4FBJB 2W55A 3E0CA 3QHTA 4TSSA 2NBUA 3PRMB 3V6EB 1J0GA 4DBGA 2SEBD 4GN1A 4XX5A 2WU2B 3ML8A 4CQNA 1C78A 3U8ZA 3I7KA 1QF6A 4W9HA 4KKIA 3LB8C 4KIKA 2V9HA 1SSNA 4YWGG 2RPVA 2KDBA 3ZNID 4LTUA 2O6VB 1WM2A 4K7WA 4EEWA 4GSWA 2CHWA 4K1RB 4B95A 4YTNB 2RDBC 2JXXA 5EE1A 1K51A 3AEBB 4TV3A 3ZJTA 4XR1A 1KLVA 2WP9B 4WWOA 2DLBA 3RFNA 1FO4A 3C19A 3RNFC 3KQ4A 2IBIB 4HJGE 1L6UA 2OOBB 1TKEA 1V80A 1J7AA 4IM0A 2ZPYA 4NQKE 4HRSA 4HEA1 4RM9A 1TZOA 4HCNB 4II2B 2BTEA 2WYQA 2KFKA 3BK1A 3ZVVA 1T0YA 3BY4B 1E0ZA 1J19A 2G45B 1K50A 4TQ1A 4RGTA 2MLBA 3VTUA 2D07B 4AR1A 1V5TA 2J4XA 3P42A 5G5HA 3R7QA 1WY8A 5BYRA 2UWQA 4PS7A 1DGJA 1CK1A 3TEXA 5CX3A 1OEYA 5D3DA 5IAAC 2EWJA 1VZ7A 2KMMA 4RGMA 3ZRCA 4LNOA 2GRIA 3VFKA 3EC8A 1WWTA 3RI7C 4ZYNA 1KFYB 2R2OA 5LXIB 1TY0A 4OZAA 3A9KA 2WX0A 2JSVX 1VD2A 1C4CA 4PT5A 1UUPA 3I57A 4RF0A 2XK5B 1NI3A 1N5WA 4DQOC 2JUOA 3HRDD 3H1UA 3W9CB 4WQMA 1JQ4A 3DHIC 1GNUA 2LXAA 4ICVA 4KGRA 3VTWA 3ZWKA 2R61A 2V3SA 3ZNHB 1N61A 3KYDD 1WSPA 2A5UA 1Y56A 3LDZE 3L16A 1IGCA 3B2GA 4A3OA 2BYVE 3D32A 1EU4A 1LGRA 5D6JB 4IKGA 4AUQC 2ONQA 4L23A 5DPTA 2UYZB 2L8JA 1JRUA 1P9DU 3SFEB 1MI0A 1MHXA 2KYWA 1N62A 3JW0X 2WXHA 1E10A 1ZXIA 1WZ0A 2ZVOA 1SJED 3OWEB 3DBRI 1L0YB 3Q14C 1GUAB 2J52A 2VZKD 3EFUA 2QILA 3ZGZA 2UU7A 1EO6A 3VUXA 4E5ZA 1SB3C 3CMMB 1WMHB 1LO5D 2WXOA 2DX5B 3CSFA 4WWPA 3H9DA 1CZPA 2WWZA 2K1FA 4ITKA 2E6XA 2WS3B 1K8RB 1HQRD 2E1BA 3ZDTA 2FAZA 3IHPC 4GGQA 2LGSA 2HDEA 1ESFA 1BT0A 1D5XC 1SE3A 1WGHA 3QIJA 5H92C 4MGZE 5J2RA 3R8BA 1D6EC 1YQ4B 2RMMA 4HJKA 2Z8LA 1KJTA 4LCDE 1XQQA 2KDEB 2EMTA 4ANWA 1UGMA 4KVGB 3VR8B 3EHVA 1NDDA 1J8CA 3S2AA 1UBQA 3PLVA 1E8WA 3NY5A 1XCTL 2PPHA 3ZKJC 3DVNU 3NVZA 5HI1A 2QHOA 1YIWA 2D3GA 1UGJA 4S0RA 4J3OD 4FN2A 4KKJA 1E8ZA 2ZW0A 2KQ4X 4GB9A 2AYOB 4DDID 1ET9A 1MG8A 4C7ZA 3ZDMC 1JMLA 3X23A 5IO9A 2MCNB 3GB1A 4E74A 2L1AA 2I2YA 4XZ4A 2D2QA 1EUVB 1Q1OA 1V1PB 3JVZX 5LXHA 1AN8A 4FULA 1YMHE 3L17A 1ZXHA 4FLHA 4HXDA 2ZW1A 3MP9A 3DVGX 1I42A 2DWQA 3Q8EA 3QAQA 3AEGB 1E7VA 2Y5PA 4WAAA 4EZLA 4ZRKA 1P7EA 2CU3A 4KZCA 2G3QB 5JH5C 4GDKA 2GLSA 4PS8A 4EFOA 4JX1C 4ANUA 1GB1A 2MHJA 3URYA 4NJ7A 5C23A 2GBKA 1V4PA 2N4FA 2MBQA 2AQ1B 4N59A 4XDCA 1VDVA 1FNWA 3HHMA 2JYEA 5HKHA 4MGYE 2EELA 2M4NA 1IBXB 5LLIA 4NNJB 2IZVB 1V7OA 1RLFA 1TS4A 1ZDXA 1ZGUB 3X0WA 4W9GA 3OG5A 3RZFA 1KM7A 2WXKA 1UH6A 1YQ3B 3ALBA 3RNAC 3CSTA 3QQ8B 3MC9A 3Q8CA 4L2YA 3Q69A 3SD5A 1YN5A 2XEWA 1UBIA 3N1YC 4KZ0A 3RHUA 3VHTC 4XR2A 3JSVA 3DBRB 2K25A 3OJ3A 2M17A 3MJ5A 1ACCA 4OZCA 2JWZA 2LHEA 4MM3A 4OHJA 4ZRJA 1KRHA 3GS2A 2PIAA 1E9MA 3P4PB 3TEWA 3APDA 4W9EA 1H8CA 5DPWA 1QT9A 1V86A 1RM6C 2ZEQA 2V1YA 3K9PB 1C79A 1QOBA 2KMCA 2AEHA 2B3AA 2HTHA 4A09A 1GC7A 2L05A 1Q0WB 1WXSA 2BWFA 4AR9A 3QC8B 3VXWA 1S3SG 3R2TA 4AQ7A 4JLCA 1MG4A 2ZTGA 3AU4A 2JWUA 4MH8A 1L5PA 3MTNB 2QCZA 3H7SA 3I3TB 2K5PA 1N5XA 1AYFA 2LGYA 3HK0A 4NQLB 1N6ZA 3BZDB 3I7HA 3EECA 1N60A 1NI2A 4O1NA 3TMPB 4RMAA 3DBHI 2D3AA 4K3CA 3VRBB 2KANA 3H7PB 1IP9A 2AL6A 5BMGA 2VH1A 2N7JA 1CQVA 1F2RC 3DPDA 2D3BA 3R2IA 4RGNA 3M63B 1TT5B 4MM3B 1T0QC 2I06A 4M01A 2W54A 4KDLB 1A5RA 3Q3OC 2CU1A 3ZNGC 4II3B 4D2KA 1KLUD 4XE0A 4YXDB 2KKCA 2VRRB 1WH3A 2ZVNA 5KHQA 4F7ZA 3KW5B 3PT2B 1NVID 4IWPA 2KMAA 3ZUNA 3I7NA 2YEPB 3LJ3A 4DDGD 2IYDB 4KX6B 1UWMA 2IDYA 4X57B 5L95C 1M4VA 4IC7B 4F8CB 3NZSA 4GXBA 2BPSA 2RR9A 4IM2A 4CI1A 4WIPA 2GMIC 1FD6A 2BS4B 4MJSA 1ENFA 1V5OA 1WZCA 3P63A 2FCMA 2JZZA 3N9YC 4C56C 4MT5A 5BO4B 4GDKB 4ZOHC 4N6EB 2NCNA 3RFZB 3PS6A 2IUUA 1KLGD 1MJDA 3HM6X 2LHDA 1FRDA 3VAWA 4HPPA 1WXQA 2N9EB 2WDRB 2WXNA 4FHKA 3NS1A 5L83A 2ZCCA 2DAFA 4J6IA 2Y5CA 1F1HA 1HTQA 1HXYD 1C1YB 2LJIA 5EDSA 2AQ2B 1ECRA 1S1QB 1HZ6A 3FC4A 4L1BA 1R4MB 3R66C 1Q10A 4MH0E 1N63A 4MACA 4EOYA 1E90A 1XD3B 3WAMA 1OQYA 2HJ8A 4N58A 4A90A 3T3NA 2GOWA 3ZW7A 4NZLB 2B76B 2DYOA 2PE9A 1TYGB 4LJOB 4Q2JA 1NYQA 1TZ1A 4UDUC 3SHQA 3QK0A 3L54A 4A3PA 4KV2A 3KH0A 3KYCD 3N32A 4US9A 3Q3NC 3AEEB 2MWSB 2DNFA 1I4GA 3B2FA 4REZA 2KACA 3WCQA 5E6JA 1I4HA 3IBEA 1WMHA 2QIEB 2V0GA 3PSEB 1UD7A 2IUTA 1NEKB 2M0XA 2JPHA 1SIJA 1STEA 1QILA 3A1QA 1FXAA 2A4ZA 4M00A 2OHFA 1XVIA 2HE7A 2Y5BB 4G0NB 2MJDA 2D10A 4ZRPA 4BVUC 3CIRB 2L00B 1WR6E 2V4IB 1XT9B 4PS3A 1T3QA 2QMTA 3EA6A 3ZUPA 1P98A 1TBEA 1KTKA 4WJNA 3J9CA 3NOBA 2ZOSA 3JSVB 4W9KA 3APFA 1XLNA 1E6EB 3GZNI 1FIQA 1OEYJ 2HTME 4LDTB 3AE4B 2Y50A 1DYQA 2NPTB 2EKIA 2JT4B 2N9LA 5D2MB 1C4PA 3IXSA 2WNMA 3ZX4A 1C4AA 1EM7A 2K6QA 2KN4A 2WQYB 5CTRC 5E6OA 3U7DA 3AN1A 2LD9A 4JWUC 4ZHOA 2IY1B 2BYEA 2IUSA 3AMZA 3UQBA 5D3IB 3GE3C 4DXAB 3AU5A 2JY6A 4DWFA 5HFYA 3I7OA 4ZDVA 1WXMA 1P1AA 4HPLB 2YVCA 2PKOA 3UQAA 2I05A 2KWDA 3OJ4B 3I5JC 2LRWA 3VUWA 3B1LX 3ZX5A 1KOTA 4W9JA 2WXGA 4AOFA 4JPSA 2WXLA 5FR6A 2WXFA 2IJ0A 1MHHE 5E6PA 3QCAA 1HE8A 4WJOA 1QOGA 1TGZB 2JZ3B 1QKZA 2K8HA 2PE6B 4MSMB 4TKNA 4ZRQA 2D11A 4B0MA 2TSSA 1FFVA 4YSYB 4A55A 1D4BA 4YSZB 1WJNA 2CHZA 1HTOA 4XWWA 1NBFC 3GOEA 2KFJA 3V60A 4IUMB 3DCGA 5TSSA 4BBNC 4ZRIA 1OQRA 2Q5WD 3AM9A 1WM3A 1L7YA 1M94A 2XBBC 1HEZE 3VH4B 4IOIE 3AE1B 2MX2A 3UIOB 3FAHA 3V62A 1P7FA 2IPKD 2MP2A 2JU6X 2BW2A 3PREA 2RPQA 3GZNB 3L10B 4AS1A 1IPGA 1PUTA 3FILA 1GG3A 3ZO5B 3PRZA 3R3MA 3PLUA 4C7YA 4MJSB 1F9JA 2DAJA 1Z2MA 3OLMD 1WF9A 2ZPNA 4A11A 1PDXA 2K22A 2CR5A 2OJRA 2KNBA 2ZNVC 4TUUA 4N9F4 1EU3A 3ZYYX 3PZ7A 3IAM1 4G11A 4E71A 3PRPB 4MEMA 3BWUD 5GMVA 3Q8AA 4JIOU 1YQBA 2FIDA 2L76A 3TUOA 1TTNA 1JALA 3PV1A 2LWPA 3ENEA 1FEHA 2MJEA 2LGXA 3AE8B 1H4RA 3I7PA 1SE2A 2VZKB 5JHAA 3E56A 4OZBA 1I7HA 4PYUA 1WE7A 2DBYA 4WH4A 2JVCA 3AV8A 1ZW7A 4BAXA 3VUYA 4JE3B 3B9JA 4MELA 3DHHC 4GIVA 2KC2A 1ZDVA 3ZXRA 4JL9A 2QDFA 2DZIA 2ZNVB 3NUHB 4WWMA 4RF1A 1XXGA 2BS2B 1TJEA 3PVLA 3EI1A 1L0XB 3O65B 3TBLD 1R4NB 1WRDB 3QA8A 1IUEA 2V3NA 1FFUA 2EMSA 2GI9A 2JQRB 3FILB 5CHFA 3I7LA 1FPYA 4PYZA 3AEAB 3U52E 4MGIE 4H2AA 2LJ5A 3MJWA 3RMKC 1JWMD 2O2VA 4MDKE 2J0MA 2M1MA 2N7DA 4DHZB 3HVZA 3CF6E 3SDLC 2NMQA 3VDZA 2KX0A 1IYFA 3RNGC 3RULA 1ZPSA 1R4MI 4XC2A 4C00A 1EF1A 1JRPA 5KHOA 1IGDA 3MHSD 5LNK1 2NVUI 1VCBA 4W9IA 2KFKB 2KWVB 2KWCA 1L6VA 1VLBA 1NENB 3U7ZA 1FNUA 2KWUB 2C7NB 2PVOD 3Q3MC 3I8CA 3QARA 3QX1A 2LRUA 2W82A 5GXGB 4KGSA 2KJ6A 1VRAB 2KO3A 5EE0A 5BMHA 3RUIB 2LGDA 3DBSA 4RGOS 1WGYA 1UF0A 2AWTA 4XGAB 3I89A 3I9V1 3T9LA 1YJ1A 2QC8A 4YSXB 3ZWDA 2KQSA 3AE2B 4M8MA 2WXQA 2Y6IA 2V4LA 1YD8U 2DENB 1WJUA 2FCSA 2MH7A 1TY2A 3A4RA 3EI2A 1RAXA 2ZCBA 4CO7A 3EI3A 5C2TB 5D94A 1QLBB 2MBBB 1PGAA 3NJTA 5HG2A 3P4RB 2C5LC 2WXRA 2CJNA 3UI3A 5FQDA 2BGFA 4I6NB 3MHZA 4RH6A 3B08A 3NG0A 1XEEA 1V49A 4WQOB 4RFBA 3W1SC 2K8CA 5AZHA 4FHJA 2M8SA 4K7SA 3ZQ4A 3DWMA 3TL5A 3DQVA 2KD0A 3ZTCA 1SBBB 1GOZA 2JRIB 4OVVA 1WXAA 1V8CA 3ABVB 4FJYA 3NVYA 4ZHPA 1UWXA 2D3CA 1WXVA 2JRHA 1WZ3A 2K0PA 2LVQA 4FADA 3NRZA 5HHDG 3ZLZA 2C7HA 3Q2AC 1D3ZA 2KT7A 2K8BA 1QOFA 1V9JA 1WI0A 2FUG1 4W9FA 4AJWA 1KF6B 4CI2A 3ZJVA 2DYBA 1FM0D 1LM8B 3L08A 2NTSA 2WGSA 3DVNV 5BYQA 4US8A 1CJEA 1U4AA 4B6WA 5E6NA 3H6NA 1L0VB 3ONSA 4G50A 5AUIA 2MJ3A 4LNNA 2IO1B 3A1QB 3AULA 1I4XA 1L4ZB 4P16A 3NS8A 2KDIA 1T0SC 1QOAA 3EGRA 1GPXA 3RNCC 4BKTA 2GBRA 4ARCA 3Q3FA 2C60A 1XO3A 1E5WA 3H7PA 1P0RA 4TZ4A 2NTTA 1J7CA 3N30A 3ETRA 3KUZA 4B9KA 1ZE3D 1G6JA 4DHZE 2O2VB 2KHWB 4G3XB 2BB5A 4P6VF 2BKRB 2ZZPB 4EKUA 2FBWB 3HVDA 4EZKA 3WAOA 1MFWA 1MPEA 5IKCM 4NJ6A 1V1PA 2BB6A 2W9NA 1GB4A 4BKSD 1OTRB 1FCCC 1WGGA 1X1MA 1XF5L 4XDDA 1FMAD 1RRBA 1YOVB 3QJZA 2L3ZA 4XWTA 1WXOA 3AE9B 3VH3B 2KVZA 2I38A 5C1ZA 1BUIC 3KWLA 1E8XA 4DXGA 4XR0A 2KAJA 2O6VA 1D5MC 1WGRA 2Z59B 1VZ8A 5C3JB 4EZJA 5DPRA 3ML9A 3BINA 2IY0B 1BMLC 2G9HD 1FCLA 4NAWA 3L13A 5IOIA 1UZXB 4LDTD 2HD5B 1FNVA 3DBLI 3KUCB 2J7QB 2X8XX 4KGTA 3RN9C 2CKHB 1K53A 3RZWC 4LJPB 4M02A 2AX5A 3NHEB 2WDVB 2KTRA 3DVGY 2KTFA 2RSUA 4C80A 3PO0A 3RYTA 5J18A 4A08A 2N9XA 3RPFC 3N1XC 4AWJA 3V61A 3WIMA 2YEPF 1WE6A 3SEBA 4FXCA 5IP4D 4DK5A 3AH7A 4MSQB 4EE2A 1JWBD 5BYSA 2N0SB 3RNBC 4IM3A 1JWSD 1K52A 2KLGA 3PHXB 3NZUA 1DOIA 3PZ8A 4IW0A 2REXA 4ICUA 3BYYB 3RNEC 3RT3B 3A33B 3AEDB 3A9JA 3IT6B 4HKQA 2NBWB 2LUMA 3MFGA 3TEYA 5TR5A 4LLGM 2SAKA 2L7RA 2FUHB 2L32A 5CHVC 1E8YA 4E54A 2ASQA 2KLCA 5MPOA 3P2BA 1V2YA 2N9PC 2ZZFA 2BF8B 4JWSC 2WXPA 3U2SC 1SGHA 5G5GA 3GP7A 3NZ3A 2N9KA 2FCNA 3R7RA 2ICIA 3NVVA 2GBJA 2KZRA 4AREA 4BZAA 1ZOYB 4WWNA 2VH2A 3BVGA 4IWOA 2KK8A 1EF5A 3M62B 4ZYSA 2BWES 2OJWA 3N1ZC 2GB1A 1GC6A 3DBLB 2O6VD 2INCC 2M19A 3UINB 4ANXA 1B9RA 4BBNF 5JHBA 4K81A 1JWUD 2NR2A 2W3SA 4LK0M 2NPTA 2MBEA 1FXIA 2WU5B 2QSDA 2LI5A 4HPMB 1I4PA 2XN9C 3A9JB 1XLQA 3DOWA 3APCA 3DHGC 1WRIA 3BIID 4LNKA 1TKYA 3P4QB 2LXCA 3I8EA 1AARA 1IBXA 1ROEA 4JQWC 1OFFA 4PK1A 1L2NA 2DZMA 1GJZA 1WNUA 1HZ5A 3I63C 2KVRA 3KLSX 1WX8A 2PEAA 5FR3A 1T6BX 2L0FA 4P1BC 2FCQA 3Q3JA 2KC1A 3T3OA 1OQQA 5I4DA 3WAPA 3ZTYA 3GE8C 3C0RB 1PQSA 3HIZA 2G4DB 2ON8A 3ZNZB 1E7PB 5DCNA 2FE8A 1V97A 4KSLC 3ZIMA 1PFDA 4HDOA 2Y3AA 4LNFA 3IVFA 3W5UB 4ANVA 4A0BA 5G55A 4OVUA 2FIFA 3AE7B 2MSED 3VVWB 1PYWD 4HCPB 2PJHA 5DPSA 4BKGA 3IFWB 2LMCA 4OVZA 1D5ZC 4DHJD 4IWQA 2BT6A 1XLOA 2LUEA 1QZEA 2BS3B 1BXTA 3KUDB 3PGEA 1JROA 3SR6A 1HA5A 1C9FA 3ZU6A 3KVFB 1WGKA 3Q8BA 5JZEB 3EFCA 4YT0B 4W9LA 4GDLB 5J17A 3TEZA 3H8HA 4NY0A 2V3PA 3AI5A 2Z0DB 2ACZB 4HROA 1WYWB 2BQQA 2JZPA 3AE5B 4S17A 1XCQL 3PPAA 3N20C 2K39A 2BVCA 3UF8A 4I6PA 1RWSA 1I35A 2H88B 3AE6B 2MW5A 4FJZA 4RNAA 1YX5B 3V3XA 4HDQA 2XNAC 4IG7B 1EWYC 2DYMA 4C4VA 1OGWA 3VRAB 2KN5A 2WX1A 1VJKA 1F77A 2LASA 4W9CA 4LNIA 5JXVA 1VR9A 3P4SB 2Z0EB 5IA7A 4ARFA 2KTRB 1C76A 1MVKA 2PVGC 4YL8A 4WAFA 5FK9C 4HK2A 2J42A 2J0JA 4M8NA 2LEKA 1WX7A 5CHWA 2G4SA 3V05A 3TIXA 2N1WA 2HYEA 3BVMA 2I1KA 2L83A 3AXCA 4P1CC 4HLEA 4CI3A 2ZZGA 5FKAC 2N7EA 1Y8RC 1WJ4A 4BOZB 2IGDA 5EE9A 3RD2A 4FA6A 2IO2B 3JYUA 4RCOA 2INDC 3EUB2 2FNJB 2IO0B 4WURA 2GBNA 3Q8FA 5G2NA 1FRRA 1RYJA 4WJQA 3VQIA 1WR1A 1L4DB 2G1EA 1SIFA 2LVOA 1FXTB 2EKEC 2KXJA 3MC8A 1TS5A 2H89B 2MBOA 2WDQB 1YX6B 2I1JA 4K3BA 3AB5A 3LXFA 2PTLA 1YN4A 2WLBA 2BYTA 1R4NI 1YNTE 4TMAB 4XR3A 2BBCA 1I4RA 1LFDA 2JX5A 1SXTA 3WA0A 2ZZEA 3W5VB 2INPE 2WXMA 3WQZA 3VR9B 1TS3A 1A70A 3ECIA 3QWZB 3TJPA 4M0WA 2BKFA 4HWIB 3A4SC 4NPNA 2L52A 3WANA 2WHIA 1J7BA 4NAMA 3DBHB 4BKSA 1PGBA 5IN7A 2MRPA 1C3TA 4GMVA 5D7GA 3PZDA 3SFDB 1Z5SB 3BYTB 1GAQB 4GLSC 3PTFC 3KEWA 2K9XA 2HJ1A 4QAYA 4ACFA 2KX3A 1WJ6A 4R3DA 3IT4B 3IG3A 4E3CA 3W2DA 4AJYB 2Y3UA 2J53A 2WXIA 2JYTA 2OEDA 1WYGA 3UGBB 2DHZA 1I4QA 2K3UA 2C9WB 1ZP0B 2IGGA 1ZUD2 1T0RC 3FKYA 4B0EA 3HUIA 4A9AA 2NBVB 2KQ7A 4CYEA 4OW0A 1YJIA 2K6DB 3NVWA 3ZW3A 1QQRA 1YN3A 4USAA 2IO3B 3ZTDA 2MEKA 4AP4C 4KIKB 1CMXB 3U4EG 2JXTA 1VZ6A 1ZKHA 4K7UA 4HKZE 3ZXVA 4URKA 3DDCB 2B5MA 3PHWB 1V1OA 2PLPA 2AL3A 1WIAA 5AZFA 4HVBA 1ISNA 4BOSC 3ZJUA 1TS2A 1ET6A 2RGFA 3W1YA 2YLMA 4P7IA 5AEKB 2ZJDA 4JGHB 2QJLA 3EI4A 1YJJA 4FJVB 3DWGC 1V81A 3Q6BA 2C7MB 3N3KB 4KDIC 4A0AA 1AW7A 2N1VA 2RD0A 3L0WB 2XK5A 2LZ6A 4CHKA 1F2RI 3WALA 3P1MA 2E3TA 1WFYA 4KSKC 4DXFA 2NS5A 2PW9A 4C4VB 1R7SA 3O13A 1PGXA 1WX9A 1SEBD 2M0AA 2WXJA 4WJPA 2D5GA 2MBHA 1TIFA 3BK2A 3BVZA 1V6EA 4ARIA 1T5XD 3M3JA 3VTVA 1UELA 2KDFB 3LYYA 4GDLA 2JF5A 3KWVA 1NYRA 1SJHD 2GBMA 2M56B 4TQ0A 4GU2A 4YTPB 5BMIA 2RDGA 3A9KB 1P3QU 4A20A 1SF0A 2LGIA
chains in the Genus database with same CATH topology
1TS4A 5G5GA 3GP7A 1ZDXA 3NZ3A 2N9KA 1EU3A 3ZYYX 2LFIA 3IAM1 3PZ7A 2WXKA 1YQ3B 2ICIA 3NVVA 1F0ZA 2PMVA 1C77A 3BWUD 4AREA 2W3RA 3Q8CA 3Q8AA 1ZOYB 4L2YA 4A6QA 4AR8A 3BVGA 3Q69A 3TUOA 1JALA 4ZYSA 1YN5A 1FEHA 2MJEA 3AE3B 1TKGA 2GB1A 3AE8B 3I7PA 1SE2A 2KDMA 2QEJC 2VZKB 1SE4A 3E56A 2M19A 4OZBA 1JW9D 1I7HA 3RHUA 4XR2A 4WH4A 2DBYA 1B9RA 3AV8A 1KH0A 4NJCA 1RFKA 5AUKA 1JWUD 3MJ5A 1ACCA 4JE3B 2W3SA 4OZCA 3B9JA 2LHEA 1B1ZA 1ZDVA 4OHJA 4LK0M 1KRHA 3GS2A 2B5LA 1FXIA 2WU5B 2PIAA 3IAS1 1E9MA 3NUHB 3P4PB 2RDHA 4WWMA 1AWDA 4RF1A 3TEWA 1XXGA 3W1SA 2QSDA 2BS2B 1DOYA 1TJEA 1I4PA 2XN9C 2IGHA 3E9SA 3MC0B 3EI1A 1XLQA 1QT9A 3AECB 1L0XB 1EWCA 1RM6C 2INNE 1WRIA 1DOXA 1IUEA 2V3NA 1C79A 1QOBA 1FFUA 3BIID 2GI9A 2JQRB 3FILB 4A09A 1TKYA 3P4QB 3TSSA 3I7LA 4AR9A 3I8EA 3AEFB 5H8YE 3R2TA 3AEAB 1XLPA 3U52E 4AQ7A 1IBXA 2ZTGA 4H2AA 2JWUA 4MH8A 1L5PA 1ROEA 4YTMB 1JWMD 1OFFA 1JCKB 1UNSA 4NAWB 5T8IA 1WNUA 4A8XC 1HZ5A 3KLSX 1JWAD 3CWIA 2AQ3B 2K5PA 5FR3A 3HVZA 1T6BX 2NMQA 4IDIA 1N5XA 5EE3A 3C8YA 2CJOA 2X38A 1AYFA 1OQQA 3T3OA 5I4DA 3L4PA 1ZPSA 3BZDB 3I7HA 1JRPA 1N60A 1IGDA 4O1NA 5LNK1 2ON8A 3VRBB 2W55A 1E7PB 3E0CA 4TSSA 5BMGA 1L6VA 2SEBD 2FE8A 2WU2B 1V97A 1CQVA 2N7JA 1F2RC 4CQNA 1VLBA 1PFDA 1NENB 1C78A 3U7ZA 3R2IA 2Y3AA 3I7KA 3W5UB 1FNUA 4RGNA 1QF6A 4MM3B 4KKIA 3LB8C 2PVOD 2I06A 4A0BA 1SSNA 2W54A 3I8CA 3AE7B 4YWGG 2RPVA 2W82A 1PYWD 5GXGB 4KGSA 4LTUA 1VRAB 5EE0A 5BMHA 4D2KA 1KLUD 2LMCA 4OVZA 4RGOS 4XE0A 3I89A 1D5ZC 4YXDB 2BT6A 3I9V1 1XLOA 2BS3B 1BXTA 4YTNB 4YSXB 3AE2B 1JROA 1NVID 2WXQA 5EE1A 3SR6A 1HA5A 1K51A 1C9FA 3AEBB 2Y6IA 3I7NA 2YEPB 3ZJTA 1WGKA 3Q8BA 4XR1A 2MH7A 1TY2A 3EI2A 2WP9B 2DLBA 4KX6B 3RFNA 1UWMA 2IDYA 5C2TB 1FO4A 4YT0B 3EI3A 4GDLB 3KQ4A 1QLBB 1PGAA 5HG2A 3TEZA 3P4RB 4HJGE 1L6UA 1M4VA 3H8HA 2WXRA 1TKEA 2CJNA 2V3PA 3UI3A 1J7AA 2ACZB 5FQDA 4HROA 4CI1A 4HRSA 2JZPA 3AE5B 4WIPA 4HEA1 1XCQL 1FD6A 2BS4B 3MHZA 4RH6A 1ENFA 1RWSA 1TZOA 2H88B 3AE6B 3P63A 1XEEA 2BTEA 4RNAA 3V3XA 4RFBA 2XNAC 3BK1A 1EWYC 3N9YC 4C56C 1E0ZA 2DYMA 4MT5A 1K50A 4GDKB 4TQ1A 4ZOHC 4RGTA 4N6EB 3ZQ4A 3DWMA 3VRAB 4AR1A 3RFZB 1SBBB 3P42A 2J4XA 5G5HA 1GOZA 1VJKA 5BYRA 1F77A 2IUUA 1DGJA 1KLGD 1CK1A 2LHDA 1FRDA 3TEXA 5JXVA 1VR9A 3P4SB 5D3DA 2EWJA 1VZ7A 2KMMA 4RGMA 1WXQA 1V8CA 4ARFA 2WDRB 3ABVB 2GRIA 1C76A 1MVKA 3NVYA 2WXNA 1WWTA 2PVGC 4ZHPA 1UWXA 3NS1A 4WAFA 1KFYB 5FK9C 2Y5CA 1TY0A 2J42A 4OZAA 2JSVX 2LEKA 1HXYD 2K0PA 2LJIA 3NRZA 5HHDG 3V05A 1C4CA 2HYEA 2AQ2B 1ECRA 3BVMA 4PT5A 1UUPA 2L83A 1HZ6A 1QOFA 3FC4A 3I57A 2FUG1 4RF0A 1NI3A 4CI3A 1KF6B 1N5WA 4DQOC 2ZZGA 4L1BA 4CI2A 3ZJVA 1Q10A 3HRDD 5FKAC 3W9CB 1N63A 4WQMA 4MACA 1JQ4A 1FM0D 2IGDA 5EE9A 4RCOA 3EUB2 4KGRA 4N58A 4WURA 4A90A 2NTSA 3T3NA 3Q8FA 5BYQA 4US8A 1FRRA 4NZLB 1CJEA 1RYJA 2R61A 3VQIA 1L4DB 2B76B 1L0VB 2G1EA 2DYOA 1N61A 1TYGB 1TS5A 2H89B 5AUIA 4Q2JA 1WSPA 1NYQA 2MJ3A 1Y56A 2WDQB 4UDUC 1IGCA 3AB5A 3LXFA 3B2GA 2PTLA 1YN4A 1I4XA 1L4ZB 1EU4A 2WLBA 2BYTA 4P16A 1YNTE 4IKGA 4TMAB 4XR3A 2BBCA 4US9A 2ONQA 1I4RA 2JX5A 4L23A 1SXTA 1QOAA 3AEEB 2ZZEA 3EGRA 2INPE 3W5VB 2WXMA 1GPXA 3WQZA 1I4GA 3B2FA 4REZA 2KACA 3WCQA 5E6JA 1I4HA 3VR9B 1TS3A 4ARCA 3SFEB 1A70A 2QIEB 1MI0A 1XO3A 1MHXA 4M0WA 2V0GA 1N62A 1NEKB 2IUTA 2WXHA 1E10A 4TZ4A 1ZXIA 1SIJA 2L52A 1SJED 2NTTA 1J7CA 1STEA 3OWEB 1QILA 3ETRA 1J7BA 4NAMA 1FXAA 1ZE3D 1L0YB 2OHFA 1PGBA 2BB5A 2J52A 2VZKD 4P6VF 2MJDA 2QILA 5D7GA 3ZGZA 4ZRPA 3SFDB 2FBWB 3HVDA 3CIRB 4E5ZA 3BYTB 1SB3C 1GAQB 4GLSC 2V4IB 1T3QA 2QMTA 3EA6A 1LO5D 1MPEA 2WXOA 3KEWA 2K9XA 1V1PA 1KTKA 2BB6A 3J9CA 1CZPA 1XLNA 1GB4A 1E6EB 4R3DA 1FCCC 4ITKA 2E6XA 2WS3B 3IT4B 1FIQA 3W2DA 2Y3UA 2J53A 2HTME 2JYTA 2OEDA 1XF5L 1WYGA 2WXIA 3AE4B 4XDDA 1HQRD 1I4QA 1FMAD 2E1BA 1DYQA 2Y50A 2EKIA 2HDEA 2K3UA 1ESFA 2N9LA 1C4PA 1ZP0B 2IGGA 4XWTA 1D5XC 1ZUD2 3IXSA 1WXOA 1SE3A 3AE9B 5H92C 2WNMA 2I38A 4B0EA 3HUIA 1BUIC 1D6EC 1YQ4B 2RMMA 1C4AA 1EM7A 3R8BA 4A9AA 2Z8LA 3KWLA 2KN4A 4DXGA 2WQYB 4XR0A 2KAJA 1D5MC 4OW0A 1YJIA 1VZ8A 5C3JB 3NVWA 3AN1A 4JWUC 1QQRA 1YN3A 4ZHOA 3VR8B 4USAA 2IUSA 3AMZA 2MEKA 1BMLC 1XCTL 5D3IB 2G9HD 1FCLA 3NVZA 5HI1A 3U4EG 2JXTA 5HFYA 3I7OA 1VZ6A 1UGJA 1FNVA 4HKZE 2B5MA 1V1OA 4KGTA 2PLPA 4J3OD 4KKJA 1K53A 2ZW0A 2KQ4X 3ZJUA 2AX5A 1ET9A 1TS2A 2PKOA 1ET6A 2WDVB 2KWDA 2I05A 4C7ZA 1JMLA 2WXGA 2QJLA 3GB1A 4JPSA 2L1AA 2I2YA 3EI4A 2WXLA 1YJJA 2IJ0A 2WXFA 3PO0A 4C80A 1MHHE 1V1PB 3DWGC 1AN8A 4A08A 4A0AA 1AW7A 1QOGA 1QKZA 4ZRQA 3RPFC 2TSSA 1FFVA 1YMHE 1F2RI 4B0MA 4YSYB 1ZXHA 3P1MA 2E3TA 4A55A 1D4BA 4YSZB 4DXFA 2PW9A 1R7SA 3O13A 2YEPF 2ZW1A 1PGXA 3SEBA 3MP9A 4FXCA 4XWWA 3AH7A 1SEBD 2M0AA 4EE2A 2WXJA 2DWQA 3Q8EA 1JWBD 5BYSA 2N0SB 3AEGB 2D5GA 2Y5PA 1JWSD 1K52A 3BK2A 3BVZA 5TSSA 4ARIA 1OQRA 1P7EA 1T5XD 2CU3A 1DOIA 3PZ8A 2Q5WD 3BYYB 3AM9A 4JX1C 3AEDB 1HEZE 1GB1A 4IOIE 3LYYA 3AE1B 3IT6B 4HKQA 3URYA 2LUMA 1V4PA 3MFGA 3FAHA 2AQ1B 1P7FA 3TEYA 2IPKD 4LLGM 4N59A 2SAKA 4XDCA 2JU6X 2L32A 2BW2A 1VDVA 3KWVA 1NYRA 1FNWA 1SJHD 4AS1A 1PUTA 2M56B 3FILA 2JYEA 4E54A 2EELA 5MPOA 4TQ0A 2ZZFA 4JWSC 4YTPB 1IBXB 5BMIA 2RDGA 4C7YA 1SF0A 1V7OA 4A11A 2LGIA 1PDXA 2WXPA 2K22A 3U2SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LB8 C;  2PVO D;  5EE9 A;  5G5G A;  5C3J B;  3NVW A;  2W54 A;  3AN1 A;  4JWU C;  3ZYY X;  3AE7 B;  4ZHO A;  3VR8 B;  3EUB 2;  4USA A;  4N58 A;  1YQ3 B;  5GXG B;  3AMZ A;  4LTU A;  3NVV A;  4US8 A;  1F0Z A;  1FRR A;  5EE0 A;  1CJE A;  1RYJ A;  2W3R A;  3NVZ A;  1ZOY B;  2B76 B;  1L0V B;  2G1E A;  1JAL A;  4YXD B;  1N61 A;  1TYG B;  2MJE A;  2H89 B;  2BT6 A;  5AUI A;  1XLO A;  3AE3 B;  1NYQ A;  1TKG A;  2BS3 B;  2MJ3 A;  4YSX B;  4YTN B;  3AE8 B;  2WDQ B;  3AE2 B;  1JRO A;  1NVI D;  3AB5 A;  3LXF A;  3B2G A;  5EE1 A;  2M19 A;  3SR6 A;  1JW9 D;  1I7H A;  3RHU A;  2WLB A;  3AEB B;  2DBY A;  2AX5 A;  1B9R A;  1WGK A;  3AV8 A;  2PKO A;  1RFK A;  2WDV B;  5AUK A;  4US9 A;  4C7Z A;  2MH7 A;  2JX5 A;  2WP9 B;  4KX6 B;  1QOA A;  2W3S A;  1UWM A;  3AEE B;  3B9J A;  5C2T B;  4YT0 B;  3W5V B;  1FO4 A;  1GPX A;  2ZZE A;  3WQZ A;  1QLB B;  3B2F A;  2QJL A;  3WCQ A;  1KRH A;  3P4R B;  3VR9 B;  1FXI A;  1L6U A;  1YJJ A;  2WU5 B;  2PIA A;  3PO0 A;  1E9M A;  1TKE A;  2CJN A;  1A70 A;  2QIE B;  3DWG C;  1J7A A;  1AWD A;  1XO3 A;  2ACZ B;  4WWM A;  2BS2 B;  1QOG A;  4HRO A;  1N62 A;  1NEK B;  1DOY A;  1TJE A;  4HRS A;  1E10 A;  1ZXI A;  3AE5 B;  1XLQ A;  1FFV A;  3RPF C;  1SIJ A;  4YSY B;  1QT9 A;  2BS4 B;  2L52 A;  3AEC B;  2E3T A;  3P1M A;  1J7C A;  4YSZ B;  1RM6 C;  3ETR A;  1RWS A;  1J7B A;  1WRI A;  1R7S A;  1DOX A;  1IUE A;  1FXA A;  2H88 B;  1QOB A;  3BII D;  1FFU A;  3AE6 B;  3P63 A;  2OHF A;  2JQR B;  4FXC A;  3AH7 A;  1EWY C;  1TKY A;  3P4Q B;  1E0Z A;  2DWQ A;  1JWB D;  3RFN A;  4P6V F;  3AEF B;  5H8Y E;  2MJD A;  2N0S B;  1XLP A;  3AEA B;  3AEG B;  4ZOH C;  2ZTG A;  4N6E B;  3SFD B;  3DWM A;  2FBW B;  1L5P A;  3VRA B;  1ROE A;  3CIR B;  4YTM B;  1OFF A;  1SB3 C;  1OQR A;  4C80 A;  1GAQ B;  1DOI A;  2CU3 A;  5G5H A;  1WNU A;  1VJK A;  2Q5W D;  1JWA D;  3CWI A;  1T3Q A;  3AM9 A;  1DGJ A;  2K5P A;  3KEW A;  3HVZ A;  2K9X A;  1FRD A;  4JX1 C;  4IDI A;  1N5X A;  3AED B;  3P4S B;  1CZP A;  5EE3 A;  1XLN A;  2KMM A;  1E6E B;  1WXQ A;  1V8C A;  2CJO A;  2WDR B;  1AYF A;  1OQQ A;  3ABV B;  3AE1 B;  3NVY A;  4ITK A;  2WS3 B;  1WWT A;  3L4P A;  1FIQ A;  1V4P A;  2PVG C;  4ZHP A;  2HTM E;  3NS1 A;  1KFY B;  1WYG A;  3AE4 B;  3FAH A;  4N59 A;  1JRP A;  2E1B A;  1FMA D;  2Y5C A;  1N60 A;  1VDV A;  2EKI A;  2LEK A;  1NYR A;  3NRZ A;  1ZP0 B;  1PUT A;  2M56 B;  3VRB B;  1ZUD 2;  1WXO A;  2W55 A;  1E7P B;  3AE9 B;  5H92 C;  5MPO A;  2L83 A;  3SFE B;  1QOF A;  3FC4 A;  3HUI A;  1L6V A;  1NI3 A;  1KF6 B;  1YQ4 B;  1N5W A;  4JWS C;  2WU2 B;  4YTP B;  2ZZG A;  2ZZF A;  1V97 A;  4A9A A;  3HRD D;  3KWL A;  1VLB A;  1PFD A;  1NEN B;  4C7Y A;  3W9C B;  1N63 A;  4WQM A;  2WQY B;  3W5U B;  1SF0 A;  2KAJ A;  3P4P B;  1QF6 A;  1V7O A;  1PDX A;  1JQ4 A;  2K22 A;  1YJI A;  1FM0 D; 
#chains in the Genus database with same CATH topology
 2MA9 B;  4W9D A;  2WDT B;  2BYF A;  3RCZ A;  1Q5W B;  2LFI A;  1LQB A;  2CS4 A;  1F0Z A;  3SU8 X;  2PMV A;  2KJR A;  1C77 A;  2W3R A;  2CHX A;  4A6Q A;  4AR8 A;  2KOX A;  3AE3 B;  1TKG A;  3U30 A;  2DZK A;  2KDM A;  2QEJ C;  1SE4 A;  3ZRF A;  1JW9 D;  1KH0 A;  4NJC A;  1RFK A;  5AUK A;  4M0W B;  3TCA A;  4XYC A;  3ZTW A;  1LXD A;  2KJH B;  1B1Z A;  2B5L A;  3K9O B;  3IAS 1;  2MQJ A;  2RDH A;  1AWD A;  4BFR A;  3W1S A;  1DOY A;  2IGH A;  3E9S A;  3MC0 B;  4ASW C;  3AEC B;  4GOC A;  1EWC A;  3V6C B;  2L0T A;  2INN E;  2DZJ A;  1DOX A;  2MP2 B;  2R2Q A;  5AZG A;  4EUT A;  3TSS A;  3AEF B;  5H8Y E;  3M95 A;  1XLP A;  4MGK E;  3HM3 A;  4F1S A;  4YTM B;  4NAW B;  1JCK B;  1UNS A;  1F52 A;  5T8I A;  3UIP B;  4A8X C;  4RM8 A;  1JWA D;  3CWI A;  2J0K A;  2AQ3 B;  1RFA A;  4I6L B;  2LVP A;  4IDI A;  3B0A A;  1WGD A;  5EE3 A;  3C8Y A;  1SE9 A;  2CJO A;  2X38 A;  3OAW A;  3L4P A;  4DHJ B;  1E7U A;  3T8M A;  4FBJ B;  2W55 A;  3E0C A;  3QHT A;  4TSS A;  2NBU A;  3PRM B;  3V6E B;  1J0G A;  4DBG A;  2SEB D;  4GN1 A;  4XX5 A;  2WU2 B;  3ML8 A;  4CQN A;  1C78 A;  3U8Z A;  3I7K A;  1QF6 A;  4W9H A;  4KKI A;  3LB8 C;  4KIK A;  2V9H A;  1SSN A;  4YWG G;  2RPV A;  2KDB A;  3ZNI D;  4LTU A;  2O6V B;  1WM2 A;  4K7W A;  4EEW A;  4GSW A;  2CHW A;  4K1R B;  4B95 A;  4YTN B;  2RDB C;  2JXX A;  5EE1 A;  1K51 A;  3AEB B;  4TV3 A;  3ZJT A;  4XR1 A;  1KLV A;  2WP9 B;  4WWO A;  2DLB A;  3RFN A;  1FO4 A;  3C19 A;  3RNF C;  3KQ4 A;  2IBI B;  4HJG E;  1L6U A;  2OOB B;  1TKE A;  1V80 A;  1J7A A;  4IM0 A;  2ZPY A;  4NQK E;  4HRS A;  4HEA 1;  4RM9 A;  1TZO A;  4HCN B;  4II2 B;  2BTE A;  2WYQ A;  2KFK A;  3BK1 A;  3ZVV A;  1T0Y A;  3BY4 B;  1E0Z A;  1J19 A;  2G45 B;  1K50 A;  4TQ1 A;  4RGT A;  2MLB A;  3VTU A;  2D07 B;  4AR1 A;  1V5T A;  2J4X A;  3P42 A;  5G5H A;  3R7Q A;  1WY8 A;  5BYR A;  2UWQ A;  4PS7 A;  1DGJ A;  1CK1 A;  3TEX A;  5CX3 A;  1OEY A;  5D3D A;  5IAA C;  2EWJ A;  1VZ7 A;  2KMM A;  4RGM A;  3ZRC A;  4LNO A;  2GRI A;  3VFK A;  3EC8 A;  1WWT A;  3RI7 C;  4ZYN A;  1KFY B;  2R2O A;  5LXI B;  1TY0 A;  4OZA A;  3A9K A;  2WX0 A;  2JSV X;  1VD2 A;  1C4C A;  4PT5 A;  1UUP A;  3I57 A;  4RF0 A;  2XK5 B;  1NI3 A;  1N5W A;  4DQO C;  2JUO A;  3HRD D;  3H1U A;  3W9C B;  4WQM A;  1JQ4 A;  3DHI C;  1GNU A;  2LXA A;  4ICV A;  4KGR A;  3VTW A;  3ZWK A;  2R61 A;  2V3S A;  3ZNH B;  1N61 A;  3KYD D;  1WSP A;  2A5U A;  1Y56 A;  3LDZ E;  3L16 A;  1IGC A;  3B2G A;  4A3O A;  2BYV E;  3D32 A;  1EU4 A;  1LGR A;  5D6J B;  4IKG A;  4AUQ C;  2ONQ A;  4L23 A;  5DPT A;  2UYZ B;  2L8J A;  1JRU A;  1P9D U;  3SFE B;  1MI0 A;  1MHX A;  2KYW A;  1N62 A;  3JW0 X;  2WXH A;  1E10 A;  1ZXI A;  1WZ0 A;  2ZVO A;  1SJE D;  3OWE B;  3DBR I;  1L0Y B;  3Q14 C;  1GUA B;  2J52 A;  2VZK D;  3EFU A;  2QIL A;  3ZGZ A;  2UU7 A;  1EO6 A;  3VUX A;  4E5Z A;  1SB3 C;  3CMM B;  1WMH B;  1LO5 D;  2WXO A;  2DX5 B;  3CSF A;  4WWP A;  3H9D A;  1CZP A;  2WWZ A;  2K1F A;  4ITK A;  2E6X A;  2WS3 B;  1K8R B;  1HQR D;  2E1B A;  3ZDT A;  2FAZ A;  3IHP C;  4GGQ A;  2LGS A;  2HDE A;  1ESF A;  1BT0 A;  1D5X C;  1SE3 A;  1WGH A;  3QIJ A;  5H92 C;  4MGZ E;  5J2R A;  3R8B A;  1D6E C;  1YQ4 B;  2RMM A;  4HJK A;  2Z8L A;  1KJT A;  4LCD E;  1XQQ A;  2KDE B;  2EMT A;  4ANW A;  1UGM A;  4KVG B;  3VR8 B;  3EHV A;  1NDD A;  1J8C A;  3S2A A;  1UBQ A;  3PLV A;  1E8W A;  3NY5 A;  1XCT L;  2PPH A;  3ZKJ C;  3DVN U;  3NVZ A;  5HI1 A;  2QHO A;  1YIW A;  2D3G A;  1UGJ A;  4S0R A;  4J3O D;  4FN2 A;  4KKJ A;  1E8Z A;  2ZW0 A;  2KQ4 X;  4GB9 A;  2AYO B;  4DDI D;  1ET9 A;  1MG8 A;  4C7Z A;  3ZDM C;  1JML A;  3X23 A;  5IO9 A;  2MCN B;  3GB1 A;  4E74 A;  2L1A A;  2I2Y A;  4XZ4 A;  2D2Q A;  1EUV B;  1Q1O A;  1V1P B;  3JVZ X;  5LXH A;  1AN8 A;  4FUL A;  1YMH E;  3L17 A;  1ZXH A;  4FLH A;  4HXD A;  2ZW1 A;  3MP9 A;  3DVG X;  1I42 A;  2DWQ A;  3Q8E A;  3QAQ A;  3AEG B;  1E7V A;  2Y5P A;  4WAA A;  4EZL A;  4ZRK A;  1P7E A;  2CU3 A;  4KZC A;  2G3Q B;  5JH5 C;  4GDK A;  2GLS A;  4PS8 A;  4EFO A;  4JX1 C;  4ANU A;  1GB1 A;  2MHJ A;  3URY A;  4NJ7 A;  5C23 A;  2GBK A;  1V4P A;  2N4F A;  2MBQ A;  2AQ1 B;  4N59 A;  4XDC A;  1VDV A;  1FNW A;  3HHM A;  2JYE A;  5HKH A;  4MGY E;  2EEL A;  2M4N A;  1IBX B;  5LLI A;  4NNJ B;  2IZV B;  1V7O A;  1RLF A;  1TS4 A;  1ZDX A;  1ZGU B;  3X0W A;  4W9G A;  3OG5 A;  3RZF A;  1KM7 A;  2WXK A;  1UH6 A;  1YQ3 B;  3ALB A;  3RNA C;  3CST A;  3QQ8 B;  3MC9 A;  3Q8C A;  4L2Y A;  3Q69 A;  3SD5 A;  1YN5 A;  2XEW A;  1UBI A;  3N1Y C;  4KZ0 A;  3RHU A;  3VHT C;  4XR2 A;  3JSV A;  3DBR B;  2K25 A;  3OJ3 A;  2M17 A;  3MJ5 A;  1ACC A;  4OZC A;  2JWZ A;  2LHE A;  4MM3 A;  4OHJ A;  4ZRJ A;  1KRH A;  3GS2 A;  2PIA A;  1E9M A;  3P4P B;  3TEW A;  3APD A;  4W9E A;  1H8C A;  5DPW A;  1QT9 A;  1V86 A;  1RM6 C;  2ZEQ A;  2V1Y A;  3K9P B;  1C79 A;  1QOB A;  2KMC A;  2AEH A;  2B3A A;  2HTH A;  4A09 A;  1GC7 A;  2L05 A;  1Q0W B;  1WXS A;  2BWF A;  4AR9 A;  3QC8 B;  3VXW A;  1S3S G;  3R2T A;  4AQ7 A;  4JLC A;  1MG4 A;  2ZTG A;  3AU4 A;  2JWU A;  4MH8 A;  1L5P A;  3MTN B;  2QCZ A;  3H7S A;  3I3T B;  2K5P A;  1N5X A;  1AYF A;  2LGY A;  3HK0 A;  4NQL B;  1N6Z A;  3BZD B;  3I7H A;  3EEC A;  1N60 A;  1NI2 A;  4O1N A;  3TMP B;  4RMA A;  3DBH I;  2D3A A;  4K3C A;  3VRB B;  2KAN A;  3H7P B;  1IP9 A;  2AL6 A;  5BMG A;  2VH1 A;  2N7J A;  1CQV A;  1F2R C;  3DPD A;  2D3B A;  3R2I A;  4RGN A;  3M63 B;  1TT5 B;  4MM3 B;  1T0Q C;  2I06 A;  4M01 A;  2W54 A;  4KDL B;  1A5R A;  3Q3O C;  2CU1 A;  3ZNG C;  4II3 B;  4D2K A;  1KLU D;  4XE0 A;  4YXD B;  2KKC A;  2VRR B;  1WH3 A;  2ZVN A;  5KHQ A;  4F7Z A;  3KW5 B;  3PT2 B;  1NVI D;  4IWP A;  2KMA A;  3ZUN A;  3I7N A;  2YEP B;  3LJ3 A;  4DDG D;  2IYD B;  4KX6 B;  1UWM A;  2IDY A;  4X57 B;  5L95 C;  1M4V A;  4IC7 B;  4F8C B;  3NZS A;  4GXB A;  2BPS A;  2RR9 A;  4IM2 A;  4CI1 A;  4WIP A;  2GMI C;  1FD6 A;  2BS4 B;  4MJS A;  1ENF A;  1V5O A;  1WZC A;  3P63 A;  2FCM A;  2JZZ A;  3N9Y C;  4C56 C;  4MT5 A;  5BO4 B;  4GDK B;  4ZOH C;  4N6E B;  2NCN A;  3RFZ B;  3PS6 A;  2IUU A;  1KLG D;  1MJD A;  3HM6 X;  2LHD A;  1FRD A;  3VAW A;  4HPP A;  1WXQ A;  2N9E B;  2WDR B;  2WXN A;  4FHK A;  3NS1 A;  5L83 A;  2ZCC A;  2DAF A;  4J6I A;  2Y5C A;  1F1H A;  1HTQ A;  1HXY D;  1C1Y B;  2LJI A;  5EDS A;  2AQ2 B;  1ECR A;  1S1Q B;  1HZ6 A;  3FC4 A;  4L1B A;  1R4M B;  3R66 C;  1Q10 A;  4MH0 E;  1N63 A;  4MAC A;  4EOY A;  1E90 A;  1XD3 B;  3WAM A;  1OQY A;  2HJ8 A;  4N58 A;  4A90 A;  3T3N A;  2GOW A;  3ZW7 A;  4NZL B;  2B76 B;  2DYO A;  2PE9 A;  1TYG B;  4LJO B;  4Q2J A;  1NYQ A;  1TZ1 A;  4UDU C;  3SHQ A;  3QK0 A;  3L54 A;  4A3P A;  4KV2 A;  3KH0 A;  3KYC D;  3N32 A;  4US9 A;  3Q3N C;  3AEE B;  2MWS B;  2DNF A;  1I4G A;  3B2F A;  4REZ A;  2KAC A;  3WCQ A;  5E6J A;  1I4H A;  3IBE A;  1WMH A;  2QIE B;  2V0G A;  3PSE B;  1UD7 A;  2IUT A;  1NEK B;  2M0X A;  2JPH A;  1SIJ A;  1STE A;  1QIL A;  3A1Q A;  1FXA A;  2A4Z A;  4M00 A;  2OHF A;  1XVI A;  2HE7 A;  2Y5B B;  4G0N B;  2MJD A;  2D10 A;  4ZRP A;  4BVU C;  3CIR B;  2L00 B;  1WR6 E;  2V4I B;  1XT9 B;  4PS3 A;  1T3Q A;  2QMT A;  3EA6 A;  3ZUP A;  1P98 A;  1TBE A;  1KTK A;  4WJN A;  3J9C A;  3NOB A;  2ZOS A;  3JSV B;  4W9K A;  3APF A;  1XLN A;  1E6E B;  3GZN I;  1FIQ A;  1OEY J;  2HTM E;  4LDT B;  3AE4 B;  2Y50 A;  1DYQ A;  2NPT B;  2EKI A;  2JT4 B;  2N9L A;  5D2M B;  1C4P A;  3IXS A;  2WNM A;  3ZX4 A;  1C4A A;  1EM7 A;  2K6Q A;  2KN4 A;  2WQY B;  5CTR C;  5E6O A;  3U7D A;  3AN1 A;  2LD9 A;  4JWU C;  4ZHO A;  2IY1 B;  2BYE A;  2IUS A;  3AMZ A;  3UQB A;  5D3I B;  3GE3 C;  4DXA B;  3AU5 A;  2JY6 A;  4DWF A;  5HFY A;  3I7O A;  4ZDV A;  1WXM A;  1P1A A;  4HPL B;  2YVC A;  2PKO A;  3UQA A;  2I05 A;  2KWD A;  3OJ4 B;  3I5J C;  2LRW A;  3VUW A;  3B1L X;  3ZX5 A;  1KOT A;  4W9J A;  2WXG A;  4AOF A;  4JPS A;  2WXL A;  5FR6 A;  2WXF A;  2IJ0 A;  1MHH E;  5E6P A;  3QCA A;  1HE8 A;  4WJO A;  1QOG A;  1TGZ B;  2JZ3 B;  1QKZ A;  2K8H A;  2PE6 B;  4MSM B;  4TKN A;  4ZRQ A;  2D11 A;  4B0M A;  2TSS A;  1FFV A;  4YSY B;  4A55 A;  1D4B A;  4YSZ B;  1WJN A;  2CHZ A;  1HTO A;  4XWW A;  1NBF C;  3GOE A;  2KFJ A;  3V60 A;  4IUM B;  3DCG A;  5TSS A;  4BBN C;  4ZRI A;  1OQR A;  2Q5W D;  3AM9 A;  1WM3 A;  1L7Y A;  1M94 A;  2XBB C;  1HEZ E;  3VH4 B;  4IOI E;  3AE1 B;  2MX2 A;  3UIO B;  3FAH A;  3V62 A;  1P7F A;  2IPK D;  2MP2 A;  2JU6 X;  2BW2 A;  3PRE A;  2RPQ A;  3GZN B;  3L10 B;  4AS1 A;  1IPG A;  1PUT A;  3FIL A;  1GG3 A;  3ZO5 B;  3PRZ A;  3R3M A;  3PLU A;  4C7Y A;  4MJS B;  1F9J A;  2DAJ A;  1Z2M A;  3OLM D;  1WF9 A;  2ZPN A;  4A11 A;  1PDX A;  2K22 A;  2CR5 A;  2OJR A;  2KNB A;  2ZNV C;  4TUU A;  4N9F 4;  1EU3 A;  3ZYY X;  3PZ7 A;  3IAM 1;  4G11 A;  4E71 A;  3PRP B;  4MEM A;  3BWU D;  5GMV A;  3Q8A A;  4JIO U;  1YQB A;  2FID A;  2L76 A;  3TUO A;  1TTN A;  1JAL A;  3PV1 A;  2LWP A;  3ENE A;  1FEH A;  2MJE A;  2LGX A;  3AE8 B;  1H4R A;  3I7P A;  1SE2 A;  2VZK B;  5JHA A;  3E56 A;  4OZB A;  1I7H A;  4PYU A;  1WE7 A;  2DBY A;  4WH4 A;  2JVC A;  3AV8 A;  1ZW7 A;  4BAX A;  3VUY A;  4JE3 B;  3B9J A;  4MEL A;  3DHH C;  4GIV A;  2KC2 A;  1ZDV A;  3ZXR A;  4JL9 A;  2QDF A;  2DZI A;  2ZNV B;  3NUH B;  4WWM A;  4RF1 A;  1XXG A;  2BS2 B;  1TJE A;  3PVL A;  3EI1 A;  1L0X B;  3O65 B;  3TBL D;  1R4N B;  1WRD B;  3QA8 A;  1IUE A;  2V3N A;  1FFU A;  2EMS A;  2GI9 A;  2JQR B;  3FIL B;  5CHF A;  3I7L A;  1FPY A;  4PYZ A;  3AEA B;  3U52 E;  4MGI E;  4H2A A;  2LJ5 A;  3MJW A;  3RMK C;  1JWM D;  2O2V A;  4MDK E;  2J0M A;  2M1M A;  2N7D A;  4DHZ B;  3HVZ A;  3CF6 E;  3SDL C;  2NMQ A;  3VDZ A;  2KX0 A;  1IYF A;  3RNG C;  3RUL A;  1ZPS A;  1R4M I;  4XC2 A;  4C00 A;  1EF1 A;  1JRP A;  5KHO A;  1IGD A;  3MHS D;  5LNK 1;  2NVU I;  1VCB A;  4W9I A;  2KFK B;  2KWV B;  2KWC A;  1L6V A;  1VLB A;  1NEN B;  3U7Z A;  1FNU A;  2KWU B;  2C7N B;  2PVO D;  3Q3M C;  3I8C A;  3QAR A;  3QX1 A;  2LRU A;  2W82 A;  5GXG B;  4KGS A;  2KJ6 A;  1VRA B;  2KO3 A;  5EE0 A;  5BMH A;  3RUI B;  2LGD A;  3DBS A;  4RGO S;  1WGY A;  1UF0 A;  2AWT A;  4XGA B;  3I89 A;  3I9V 1;  3T9L A;  1YJ1 A;  2QC8 A;  4YSX B;  3ZWD A;  2KQS A;  3AE2 B;  4M8M A;  2WXQ A;  2Y6I A;  2V4L A;  1YD8 U;  2DEN B;  1WJU A;  2FCS A;  2MH7 A;  1TY2 A;  3A4R A;  3EI2 A;  1RAX A;  2ZCB A;  4CO7 A;  3EI3 A;  5C2T B;  5D94 A;  1QLB B;  2MBB B;  1PGA A;  3NJT A;  5HG2 A;  3P4R B;  2C5L C;  2WXR A;  2CJN A;  3UI3 A;  5FQD A;  2BGF A;  4I6N B;  3MHZ A;  4RH6 A;  3B08 A;  3NG0 A;  1XEE A;  1V49 A;  4WQO B;  4RFB A;  3W1S C;  2K8C A;  5AZH A;  4FHJ A;  2M8S A;  4K7S A;  3ZQ4 A;  3DWM A;  3TL5 A;  3DQV A;  2KD0 A;  3ZTC A;  1SBB B;  1GOZ A;  2JRI B;  4OVV A;  1WXA A;  1V8C A;  3ABV B;  4FJY A;  3NVY A;  4ZHP A;  1UWX A;  2D3C A;  1WXV A;  2JRH A;  1WZ3 A;  2K0P A;  2LVQ A;  4FAD A;  3NRZ A;  5HHD G;  3ZLZ A;  2C7H A;  3Q2A C;  1D3Z A;  2KT7 A;  2K8B A;  1QOF A;  1V9J A;  1WI0 A;  2FUG 1;  4W9F A;  4AJW A;  1KF6 B;  4CI2 A;  3ZJV A;  2DYB A;  1FM0 D;  1LM8 B;  3L08 A;  2NTS A;  2WGS A;  3DVN V;  5BYQ A;  4US8 A;  1CJE A;  1U4A A;  4B6W A;  5E6N A;  3H6N A;  1L0V B;  3ONS A;  4G50 A;  5AUI A;  2MJ3 A;  4LNN A;  2IO1 B;  3A1Q B;  3AUL A;  1I4X A;  1L4Z B;  4P16 A;  3NS8 A;  2KDI A;  1T0S C;  1QOA A;  3EGR A;  1GPX A;  3RNC C;  4BKT A;  2GBR A;  4ARC A;  3Q3F A;  2C60 A;  1XO3 A;  1E5W A;  3H7P A;  1P0R A;  4TZ4 A;  2NTT A;  1J7C A;  3N30 A;  3ETR A;  3KUZ A;  4B9K A;  1ZE3 D;  1G6J A;  4DHZ E;  2O2V B;  2KHW B;  4G3X B;  2BB5 A;  4P6V F;  2BKR B;  2ZZP B;  4EKU A;  2FBW B;  3HVD A;  4EZK A;  3WAO A;  1MFW A;  1MPE A;  5IKC M;  4NJ6 A;  1V1P A;  2BB6 A;  2W9N A;  1GB4 A;  4BKS D;  1OTR B;  1FCC C;  1WGG A;  1X1M A;  1XF5 L;  4XDD A;  1FMA D;  1RRB A;  1YOV B;  3QJZ A;  2L3Z A;  4XWT A;  1WXO A;  3AE9 B;  3VH3 B;  2KVZ A;  2I38 A;  5C1Z A;  1BUI C;  3KWL A;  1E8X A;  4DXG A;  4XR0 A;  2KAJ A;  2O6V A;  1D5M C;  1WGR A;  2Z59 B;  1VZ8 A;  5C3J B;  4EZJ A;  5DPR A;  3ML9 A;  3BIN A;  2IY0 B;  1BML C;  2G9H D;  1FCL A;  4NAW A;  3L13 A;  5IOI A;  1UZX B;  4LDT D;  2HD5 B;  1FNV A;  3DBL I;  3KUC B;  2J7Q B;  2X8X X;  4KGT A;  3RN9 C;  2CKH B;  1K53 A;  3RZW C;  4LJP B;  4M02 A;  2AX5 A;  3NHE B;  2WDV B;  2KTR A;  3DVG Y;  2KTF A;  2RSU A;  4C80 A;  3PO0 A;  3RYT A;  5J18 A;  4A08 A;  2N9X A;  3RPF C;  3N1X C;  4AWJ A;  3V61 A;  3WIM A;  2YEP F;  1WE6 A;  3SEB A;  4FXC A;  5IP4 D;  4DK5 A;  3AH7 A;  4MSQ B;  4EE2 A;  1JWB D;  5BYS A;  2N0S B;  3RNB C;  4IM3 A;  1JWS D;  1K52 A;  2KLG A;  3PHX B;  3NZU A;  1DOI A;  3PZ8 A;  4IW0 A;  2REX A;  4ICU A;  3BYY B;  3RNE C;  3RT3 B;  3A33 B;  3AED B;  3A9J A;  3IT6 B;  4HKQ A;  2NBW B;  2LUM A;  3MFG A;  3TEY A;  5TR5 A;  4LLG M;  2SAK A;  2L7R A;  2FUH B;  2L32 A;  5CHV C;  1E8Y A;  4E54 A;  2ASQ A;  2KLC A;  5MPO A;  3P2B A;  1V2Y A;  2N9P C;  2ZZF A;  2BF8 B;  4JWS C;  2WXP A;  3U2S C;  1SGH A;  5G5G A;  3GP7 A;  3NZ3 A;  2N9K A;  2FCN A;  3R7R A;  2ICI A;  3NVV A;  2GBJ A;  2KZR A;  4ARE A;  4BZA A;  1ZOY B;  4WWN A;  2VH2 A;  3BVG A;  4IWO A;  2KK8 A;  1EF5 A;  3M62 B;  4ZYS A;  2BWE S;  2OJW A;  3N1Z C;  2GB1 A;  1GC6 A;  3DBL B;  2O6V D;  2INC C;  2M19 A;  3UIN B;  4ANX A;  1B9R A;  4BBN F;  5JHB A;  4K81 A;  1JWU D;  2NR2 A;  2W3S A;  4LK0 M;  2NPT A;  2MBE A;  1FXI A;  2WU5 B;  2QSD A;  2LI5 A;  4HPM B;  1I4P A;  2XN9 C;  3A9J B;  1XLQ A;  3DOW A;  3APC A;  3DHG C;  1WRI A;  3BII D;  4LNK A;  1TKY A;  3P4Q B;  2LXC A;  3I8E A;  1AAR A;  1IBX A;  1ROE A;  4JQW C;  1OFF A;  4PK1 A;  1L2N A;  2DZM A;  1GJZ A;  1WNU A;  1HZ5 A;  3I63 C;  2KVR A;  3KLS X;  1WX8 A;  2PEA A;  5FR3 A;  1T6B X;  2L0F A;  4P1B C;  2FCQ A;  3Q3J A;  2KC1 A;  3T3O A;  1OQQ A;  5I4D A;  3WAP A;  3ZTY A;  3GE8 C;  3C0R B;  1PQS A;  3HIZ A;  2G4D B;  2ON8 A;  3ZNZ B;  1E7P B;  5DCN A;  2FE8 A;  1V97 A;  4KSL C;  3ZIM A;  1PFD A;  4HDO A;  2Y3A A;  4LNF A;  3IVF A;  3W5U B;  4ANV A;  4A0B A;  5G55 A;  4OVU A;  2FIF A;  3AE7 B;  2MSE D;  3VVW B;  1PYW D;  4HCP B;  2PJH A;  5DPS A;  4BKG A;  3IFW B;  2LMC A;  4OVZ A;  1D5Z C;  4DHJ D;  4IWQ A;  2BT6 A;  1XLO A;  2LUE A;  1QZE A;  2BS3 B;  1BXT A;  3KUD B;  3PGE A;  1JRO A;  3SR6 A;  1HA5 A;  1C9F A;  3ZU6 A;  3KVF B;  1WGK A;  3Q8B A;  5JZE B;  3EFC A;  4YT0 B;  4W9L A;  4GDL B;  5J17 A;  3TEZ A;  3H8H A;  4NY0 A;  2V3P A;  3AI5 A;  2Z0D B;  2ACZ B;  4HRO A;  1WYW B;  2BQQ A;  2JZP A;  3AE5 B;  4S17 A;  1XCQ L;  3PPA A;  3N20 C;  2K39 A;  2BVC A;  3UF8 A;  4I6P A;  1RWS A;  1I35 A;  2H88 B;  3AE6 B;  2MW5 A;  4FJZ A;  4RNA A;  1YX5 B;  3V3X A;  4HDQ A;  2XNA C;  4IG7 B;  1EWY C;  2DYM A;  4C4V A;  1OGW A;  3VRA B;  2KN5 A;  2WX1 A;  1VJK A;  1F77 A;  2LAS A;  4W9C A;  4LNI A;  5JXV A;  1VR9 A;  3P4S B;  2Z0E B;  5IA7 A;  4ARF A;  2KTR B;  1C76 A;  1MVK A;  2PVG C;  4YL8 A;  4WAF A;  5FK9 C;  4HK2 A;  2J42 A;  2J0J A;  4M8N A;  2LEK A;  1WX7 A;  5CHW A;  2G4S A;  3V05 A;  3TIX A;  2N1W A;  2HYE A;  3BVM A;  2I1K A;  2L83 A;  3AXC A;  4P1C C;  4HLE A;  4CI3 A;  2ZZG A;  5FKA C;  2N7E A;  1Y8R C;  1WJ4 A;  4BOZ B;  2IGD A;  5EE9 A;  3RD2 A;  4FA6 A;  2IO2 B;  3JYU A;  4RCO A;  2IND C;  3EUB 2;  2FNJ B;  2IO0 B;  4WUR A;  2GBN A;  3Q8F A;  5G2N A;  1FRR A;  1RYJ A;  4WJQ A;  3VQI A;  1WR1 A;  1L4D B;  2G1E A;  1SIF A;  2LVO A;  1FXT B;  2EKE C;  2KXJ A;  3MC8 A;  1TS5 A;  2H89 B;  2MBO A;  2WDQ B;  1YX6 B;  2I1J A;  4K3B A;  3AB5 A;  3LXF A;  2PTL A;  1YN4 A;  2WLB A;  2BYT A;  1R4N I;  1YNT E;  4TMA B;  4XR3 A;  2BBC A;  1I4R A;  1LFD A;  2JX5 A;  1SXT A;  3WA0 A;  2ZZE A;  3W5V B;  2INP E;  2WXM A;  3WQZ A;  3VR9 B;  1TS3 A;  1A70 A;  3ECI A;  3QWZ B;  3TJP A;  4M0W A;  2BKF A;  4HWI B;  3A4S C;  4NPN A;  2L52 A;  3WAN A;  2WHI A;  1J7B A;  4NAM A;  3DBH B;  4BKS A;  1PGB A;  5IN7 A;  2MRP A;  1C3T A;  4GMV A;  5D7G A;  3PZD A;  3SFD B;  1Z5S B;  3BYT B;  1GAQ B;  4GLS C;  3PTF C;  3KEW A;  2K9X A;  2HJ1 A;  4QAY A;  4ACF A;  2KX3 A;  1WJ6 A;  4R3D A;  3IT4 B;  3IG3 A;  4E3C A;  3W2D A;  4AJY B;  2Y3U A;  2J53 A;  2WXI A;  2JYT A;  2OED A;  1WYG A;  3UGB B;  2DHZ A;  1I4Q A;  2K3U A;  2C9W B;  1ZP0 B;  2IGG A;  1ZUD 2;  1T0R C;  3FKY A;  4B0E A;  3HUI A;  4A9A A;  2NBV B;  2KQ7 A;  4CYE A;  4OW0 A;  1YJI A;  2K6D B;  3NVW A;  3ZW3 A;  1QQR A;  1YN3 A;  4USA A;  2IO3 B;  3ZTD A;  2MEK A;  4AP4 C;  4KIK B;  1CMX B;  3U4E G;  2JXT A;  1VZ6 A;  1ZKH A;  4K7U A;  4HKZ E;  3ZXV A;  4URK A;  3DDC B;  2B5M A;  3PHW B;  1V1O A;  2PLP A;  2AL3 A;  1WIA A;  5AZF A;  4HVB A;  1ISN A;  4BOS C;  3ZJU A;  1TS2 A;  1ET6 A;  2RGF A;  3W1Y A;  2YLM A;  4P7I A;  5AEK B;  2ZJD A;  4JGH B;  2QJL A;  3EI4 A;  1YJJ A;  4FJV B;  3DWG C;  1V81 A;  3Q6B A;  2C7M B;  3N3K B;  4KDI C;  4A0A A;  1AW7 A;  2N1V A;  2RD0 A;  3L0W B;  2XK5 A;  2LZ6 A;  4CHK A;  1F2R I;  3WAL A;  3P1M A;  2E3T A;  1WFY A;  4KSK C;  4DXF A;  2NS5 A;  2PW9 A;  4C4V B;  1R7S A;  3O13 A;  1PGX A;  1WX9 A;  1SEB D;  2M0A A;  2WXJ A;  4WJP A;  2D5G A;  2MBH A;  1TIF A;  3BK2 A;  3BVZ A;  1V6E A;  4ARI A;  1T5X D;  3M3J A;  3VTV A;  1UEL A;  2KDF B;  3LYY A;  4GDL A;  2JF5 A;  3KWV A;  1NYR A;  1SJH D;  2GBM A;  2M56 B;  4TQ0 A;  4GU2 A;  4YTP B;  5BMI A;  2RDG A;  3A9K B;  1P3Q U;  4A20 A;  1SF0 A;  2LGI A; 
#chains in the Genus database with same CATH homology
 1TS4 A;  5G5G A;  3GP7 A;  1ZDX A;  3NZ3 A;  2N9K A;  1EU3 A;  3ZYY X;  2LFI A;  3IAM 1;  3PZ7 A;  2WXK A;  1YQ3 B;  2ICI A;  3NVV A;  1F0Z A;  2PMV A;  1C77 A;  3BWU D;  4ARE A;  2W3R A;  3Q8C A;  3Q8A A;  1ZOY B;  4L2Y A;  4A6Q A;  4AR8 A;  3BVG A;  3Q69 A;  3TUO A;  1JAL A;  4ZYS A;  1YN5 A;  1FEH A;  2MJE A;  3AE3 B;  1TKG A;  2GB1 A;  3AE8 B;  3I7P A;  1SE2 A;  2KDM A;  2QEJ C;  2VZK B;  1SE4 A;  3E56 A;  2M19 A;  4OZB A;  1JW9 D;  1I7H A;  3RHU A;  4XR2 A;  4WH4 A;  2DBY A;  1B9R A;  3AV8 A;  1KH0 A;  4NJC A;  1RFK A;  5AUK A;  1JWU D;  3MJ5 A;  1ACC A;  4JE3 B;  2W3S A;  4OZC A;  3B9J A;  2LHE A;  1B1Z A;  1ZDV A;  4OHJ A;  4LK0 M;  1KRH A;  3GS2 A;  2B5L A;  1FXI A;  2WU5 B;  2PIA A;  3IAS 1;  1E9M A;  3NUH B;  3P4P B;  2RDH A;  4WWM A;  1AWD A;  4RF1 A;  3TEW A;  1XXG A;  3W1S A;  2QSD A;  2BS2 B;  1DOY A;  1TJE A;  1I4P A;  2XN9 C;  2IGH A;  3E9S A;  3MC0 B;  3EI1 A;  1XLQ A;  1QT9 A;  3AEC B;  1L0X B;  1EWC A;  1RM6 C;  2INN E;  1WRI A;  1DOX A;  1IUE A;  2V3N A;  1C79 A;  1QOB A;  1FFU A;  3BII D;  2GI9 A;  2JQR B;  3FIL B;  4A09 A;  1TKY A;  3P4Q B;  3TSS A;  3I7L A;  4AR9 A;  3I8E A;  3AEF B;  5H8Y E;  3R2T A;  3AEA B;  1XLP A;  3U52 E;  4AQ7 A;  1IBX A;  2ZTG A;  4H2A A;  2JWU A;  4MH8 A;  1L5P A;  1ROE A;  4YTM B;  1JWM D;  1OFF A;  1JCK B;  1UNS A;  4NAW B;  5T8I A;  1WNU A;  4A8X C;  1HZ5 A;  3KLS X;  1JWA D;  3CWI A;  2AQ3 B;  2K5P A;  5FR3 A;  3HVZ A;  1T6B X;  2NMQ A;  4IDI A;  1N5X A;  5EE3 A;  3C8Y A;  2CJO A;  2X38 A;  1AYF A;  1OQQ A;  3T3O A;  5I4D A;  3L4P A;  1ZPS A;  3BZD B;  3I7H A;  1JRP A;  1N60 A;  1IGD A;  4O1N A;  5LNK 1;  2ON8 A;  3VRB B;  2W55 A;  1E7P B;  3E0C A;  4TSS A;  5BMG A;  1L6V A;  2SEB D;  2FE8 A;  2WU2 B;  1V97 A;  1CQV A;  2N7J A;  1F2R C;  4CQN A;  1VLB A;  1PFD A;  1NEN B;  1C78 A;  3U7Z A;  3R2I A;  2Y3A A;  3I7K A;  3W5U B;  1FNU A;  4RGN A;  1QF6 A;  4MM3 B;  4KKI A;  3LB8 C;  2PVO D;  2I06 A;  4A0B A;  1SSN A;  2W54 A;  3I8C A;  3AE7 B;  4YWG G;  2RPV A;  2W82 A;  1PYW D;  5GXG B;  4KGS A;  4LTU A;  1VRA B;  5EE0 A;  5BMH A;  4D2K A;  1KLU D;  2LMC A;  4OVZ A;  4RGO S;  4XE0 A;  3I89 A;  1D5Z C;  4YXD B;  2BT6 A;  3I9V 1;  1XLO A;  2BS3 B;  1BXT A;  4YTN B;  4YSX B;  3AE2 B;  1JRO A;  1NVI D;  2WXQ A;  5EE1 A;  3SR6 A;  1HA5 A;  1K51 A;  1C9F A;  3AEB B;  2Y6I A;  3I7N A;  2YEP B;  3ZJT A;  1WGK A;  3Q8B A;  4XR1 A;  2MH7 A;  1TY2 A;  3EI2 A;  2WP9 B;  2DLB A;  4KX6 B;  3RFN A;  1UWM A;  2IDY A;  5C2T B;  1FO4 A;  4YT0 B;  3EI3 A;  4GDL B;  3KQ4 A;  1QLB B;  1PGA A;  5HG2 A;  3TEZ A;  3P4R B;  4HJG E;  1L6U A;  1M4V A;  3H8H A;  2WXR A;  1TKE A;  2CJN A;  2V3P A;  3UI3 A;  1J7A A;  2ACZ B;  5FQD A;  4HRO A;  4CI1 A;  4HRS A;  2JZP A;  3AE5 B;  4WIP A;  4HEA 1;  1XCQ L;  1FD6 A;  2BS4 B;  3MHZ A;  4RH6 A;  1ENF A;  1RWS A;  1TZO A;  2H88 B;  3AE6 B;  3P63 A;  1XEE A;  2BTE A;  4RNA A;  3V3X A;  4RFB A;  2XNA C;  3BK1 A;  1EWY C;  3N9Y C;  4C56 C;  1E0Z A;  2DYM A;  4MT5 A;  1K50 A;  4GDK B;  4TQ1 A;  4ZOH C;  4RGT A;  4N6E B;  3ZQ4 A;  3DWM A;  3VRA B;  4AR1 A;  3RFZ B;  1SBB B;  3P42 A;  2J4X A;  5G5H A;  1GOZ A;  1VJK A;  5BYR A;  1F77 A;  2IUU A;  1DGJ A;  1KLG D;  1CK1 A;  2LHD A;  1FRD A;  3TEX A;  5JXV A;  1VR9 A;  3P4S B;  5D3D A;  2EWJ A;  1VZ7 A;  2KMM A;  4RGM A;  1WXQ A;  1V8C A;  4ARF A;  2WDR B;  3ABV B;  2GRI A;  1C76 A;  1MVK A;  3NVY A;  2WXN A;  1WWT A;  2PVG C;  4ZHP A;  1UWX A;  3NS1 A;  4WAF A;  1KFY B;  5FK9 C;  2Y5C A;  1TY0 A;  2J42 A;  4OZA A;  2JSV X;  2LEK A;  1HXY D;  2K0P A;  2LJI A;  3NRZ A;  5HHD G;  3V05 A;  1C4C A;  2HYE A;  2AQ2 B;  1ECR A;  3BVM A;  4PT5 A;  1UUP A;  2L83 A;  1HZ6 A;  1QOF A;  3FC4 A;  3I57 A;  2FUG 1;  4RF0 A;  1NI3 A;  4CI3 A;  1KF6 B;  1N5W A;  4DQO C;  2ZZG A;  4L1B A;  4CI2 A;  3ZJV A;  1Q10 A;  3HRD D;  5FKA C;  3W9C B;  1N63 A;  4WQM A;  4MAC A;  1JQ4 A;  1FM0 D;  2IGD A;  5EE9 A;  4RCO A;  3EUB 2;  4KGR A;  4N58 A;  4WUR A;  4A90 A;  2NTS A;  3T3N A;  3Q8F A;  5BYQ A;  4US8 A;  1FRR A;  4NZL B;  1CJE A;  1RYJ A;  2R61 A;  3VQI A;  1L4D B;  2B76 B;  1L0V B;  2G1E A;  2DYO A;  1N61 A;  1TYG B;  1TS5 A;  2H89 B;  5AUI A;  4Q2J A;  1WSP A;  1NYQ A;  2MJ3 A;  1Y56 A;  2WDQ B;  4UDU C;  1IGC A;  3AB5 A;  3LXF A;  3B2G A;  2PTL A;  1YN4 A;  1I4X A;  1L4Z B;  1EU4 A;  2WLB A;  2BYT A;  4P16 A;  1YNT E;  4IKG A;  4TMA B;  4XR3 A;  2BBC A;  4US9 A;  2ONQ A;  1I4R A;  2JX5 A;  4L23 A;  1SXT A;  1QOA A;  3AEE B;  2ZZE A;  3EGR A;  2INP E;  3W5V B;  2WXM A;  1GPX A;  3WQZ A;  1I4G A;  3B2F A;  4REZ A;  2KAC A;  3WCQ A;  5E6J A;  1I4H A;  3VR9 B;  1TS3 A;  4ARC A;  3SFE B;  1A70 A;  2QIE B;  1MI0 A;  1XO3 A;  1MHX A;  4M0W A;  2V0G A;  1N62 A;  1NEK B;  2IUT A;  2WXH A;  1E10 A;  4TZ4 A;  1ZXI A;  1SIJ A;  2L52 A;  1SJE D;  2NTT A;  1J7C A;  1STE A;  3OWE B;  1QIL A;  3ETR A;  1J7B A;  4NAM A;  1FXA A;  1ZE3 D;  1L0Y B;  2OHF A;  1PGB A;  2BB5 A;  2J52 A;  2VZK D;  4P6V F;  2MJD A;  2QIL A;  5D7G A;  3ZGZ A;  4ZRP A;  3SFD B;  2FBW B;  3HVD A;  3CIR B;  4E5Z A;  3BYT B;  1SB3 C;  1GAQ B;  4GLS C;  2V4I B;  1T3Q A;  2QMT A;  3EA6 A;  1LO5 D;  1MPE A;  2WXO A;  3KEW A;  2K9X A;  1V1P A;  1KTK A;  2BB6 A;  3J9C A;  1CZP A;  1XLN A;  1GB4 A;  1E6E B;  4R3D A;  1FCC C;  4ITK A;  2E6X A;  2WS3 B;  3IT4 B;  1FIQ A;  3W2D A;  2Y3U A;  2J53 A;  2HTM E;  2JYT A;  2OED A;  1XF5 L;  1WYG A;  2WXI A;  3AE4 B;  4XDD A;  1HQR D;  1I4Q A;  1FMA D;  2E1B A;  1DYQ A;  2Y50 A;  2EKI A;  2HDE A;  2K3U A;  1ESF A;  2N9L A;  1C4P A;  1ZP0 B;  2IGG A;  4XWT A;  1D5X C;  1ZUD 2;  3IXS A;  1WXO A;  1SE3 A;  3AE9 B;  5H92 C;  2WNM A;  2I38 A;  4B0E A;  3HUI A;  1BUI C;  1D6E C;  1YQ4 B;  2RMM A;  1C4A A;  1EM7 A;  3R8B A;  4A9A A;  2Z8L A;  3KWL A;  2KN4 A;  4DXG A;  2WQY B;  4XR0 A;  2KAJ A;  1D5M C;  4OW0 A;  1YJI A;  1VZ8 A;  5C3J B;  3NVW A;  3AN1 A;  4JWU C;  1QQR A;  1YN3 A;  4ZHO A;  3VR8 B;  4USA A;  2IUS A;  3AMZ A;  2MEK A;  1BML C;  1XCT L;  5D3I B;  2G9H D;  1FCL A;  3NVZ A;  5HI1 A;  3U4E G;  2JXT A;  5HFY A;  3I7O A;  1VZ6 A;  1UGJ A;  1FNV A;  4HKZ E;  2B5M A;  1V1O A;  4KGT A;  2PLP A;  4J3O D;  4KKJ A;  1K53 A;  2ZW0 A;  2KQ4 X;  3ZJU A;  2AX5 A;  1ET9 A;  1TS2 A;  2PKO A;  1ET6 A;  2WDV B;  2KWD A;  2I05 A;  4C7Z A;  1JML A;  2WXG A;  2QJL A;  3GB1 A;  4JPS A;  2L1A A;  2I2Y A;  3EI4 A;  2WXL A;  1YJJ A;  2IJ0 A;  2WXF A;  3PO0 A;  4C80 A;  1MHH E;  1V1P B;  3DWG C;  1AN8 A;  4A08 A;  4A0A A;  1AW7 A;  1QOG A;  1QKZ A;  4ZRQ A;  3RPF C;  2TSS A;  1FFV A;  1YMH E;  1F2R I;  4B0M A;  4YSY B;  1ZXH A;  3P1M A;  2E3T A;  4A55 A;  1D4B A;  4YSZ B;  4DXF A;  2PW9 A;  1R7S A;  3O13 A;  2YEP F;  2ZW1 A;  1PGX A;  3SEB A;  3MP9 A;  4FXC A;  4XWW A;  3AH7 A;  1SEB D;  2M0A A;  4EE2 A;  2WXJ A;  2DWQ A;  3Q8E A;  1JWB D;  5BYS A;  2N0S B;  3AEG B;  2D5G A;  2Y5P A;  1JWS D;  1K52 A;  3BK2 A;  3BVZ A;  5TSS A;  4ARI A;  1OQR A;  1P7E A;  1T5X D;  2CU3 A;  1DOI A;  3PZ8 A;  2Q5W D;  3BYY B;  3AM9 A;  4JX1 C;  3AED B;  1HEZ E;  1GB1 A;  4IOI E;  3LYY A;  3AE1 B;  3IT6 B;  4HKQ A;  3URY A;  2LUM A;  1V4P A;  3MFG A;  3FAH A;  2AQ1 B;  1P7F A;  3TEY A;  2IPK D;  4LLG M;  4N59 A;  2SAK A;  4XDC A;  2JU6 X;  2L32 A;  2BW2 A;  1VDV A;  3KWV A;  1NYR A;  1FNW A;  1SJH D;  4AS1 A;  1PUT A;  2M56 B;  3FIL A;  2JYE A;  4E54 A;  2EEL A;  5MPO A;  4TQ0 A;  2ZZF A;  4JWS C;  4YTP B;  1IBX B;  5BMI A;  2RDG A;  4C7Y A;  1SF0 A;  1V7O A;  4A11 A;  2LGI A;  1PDX A;  2WXP A;  2K22 A;  3U2S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...