1WXOA

Structure of archaeal trans-editing protein alax in complex with zinc
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords alanyl-tRNA synthetase
publication title Molecular basis of alanine discrimination in editing site
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 47
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1wxoA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1wxoA01
1TKGA 2ZZEA 2ZTGA 2ZZFA 1V4PA 2E1BA 1QF6A 1TJEA 1NYQA 1TKYA 3KEWA 1V7OA 3RHUA 2ZZGA 3RFNA 3WQZA 1TKEA 1NYRA 1WNUA 1WXOA
chains in the Genus database with same CATH superfamily
4XR3A 4XR2A 2Y50A 4CI1A 3EI3A 3KEWA 4E5ZA 3WQZA 3E0CA 3ZWKA 4A0AA 1NYRA 3I7LA 2Y3UA 3ZX4A 4AREA 2ZZEA 4CI2A 5FQDA 1QF6A 1TJEA 1NYQA 4AR9A 2Y6IA 2HYEA 3ZTYA 2I06A 4E54A 3ZW7A 3I89A 3ZX5A 2B5LA 2IUTA 3I7HA 4A11A 3ZUPA 1TKGA 3I7OA 4A08A 3I7NA 1XVIA 3I7PA 2ZZGA 4AR8A 2IUSA 3I8CA 3ZU6A 3ZTWA 3EI4A 3ZWDA 1ECRA 1TKEA 4AR1A 2EWJA 2I05A 2ZTGA 2ZZFA 1V4PA 2E1BA 4ARFA 2B5MA 1TKYA 4A0BA 1WZCA 3I7KA 1V7OA 3RHUA 2ZOSA 3RFNA 4XR1A 2IUUA 4A09A 4TZ4A 3EI2A 4CI3A 3EI1A 1WNUA 1WXOA 3I8EA 4XR0A
chains in the Genus database with same CATH topology
4AREA 1TKGA 2ZZEA 2I05A 4CI2A 3I7OA 2ZTGA 2ZZFA 4XR3A 1V4PA 4XR2A 5FQDA 2Y50A 2E1BA 4CI1A 1QF6A 4ARFA 2B5MA 4A08A 1TJEA 1NYQA 3I7NA 1TKYA 3EI3A 4AR9A 3KEWA 4A0BA 2Y6IA 4E5ZA 3I7PA 3I7KA 1V7OA 3RHUA 2HYEA 2ZZGA 2I06A 3RFNA 4AR8A 2IUSA 4XR1A 4E54A 3WQZA 3E0CA 3I8CA 2IUUA 4A09A 3EI4A 4TZ4A 4A0AA 3EI2A 3I89A 1ECRA 1TKEA 1NYRA 2B5LA 3I7LA 2IUTA 3I7HA 1WNUA 1WXOA 4AR1A 4CI3A 2Y3UA 3EI1A 3I8EA 2EWJA 4XR0A 4A11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKG A;  2ZZE A;  2ZTG A;  2ZZF A;  1V4P A;  2E1B A;  1QF6 A;  1TJE A;  1NYQ A;  1TKY A;  3KEW A;  1V7O A;  3RHU A;  2ZZG A;  3RFN A;  3WQZ A;  1TKE A;  1NYR A;  1WNU A;  1WXO A; 
#chains in the Genus database with same CATH topology
 4XR3 A;  4XR2 A;  2Y50 A;  4CI1 A;  3EI3 A;  3KEW A;  4E5Z A;  3WQZ A;  3E0C A;  3ZWK A;  4A0A A;  1NYR A;  3I7L A;  2Y3U A;  3ZX4 A;  4ARE A;  2ZZE A;  4CI2 A;  5FQD A;  1QF6 A;  1TJE A;  1NYQ A;  4AR9 A;  2Y6I A;  2HYE A;  3ZTY A;  2I06 A;  4E54 A;  3ZW7 A;  3I89 A;  3ZX5 A;  2B5L A;  2IUT A;  3I7H A;  4A11 A;  3ZUP A;  1TKG A;  3I7O A;  4A08 A;  3I7N A;  1XVI A;  3I7P A;  2ZZG A;  4AR8 A;  2IUS A;  3I8C A;  3ZU6 A;  3ZTW A;  3EI4 A;  3ZWD A;  1ECR A;  1TKE A;  4AR1 A;  2EWJ A;  2I05 A;  2ZTG A;  2ZZF A;  1V4P A;  2E1B A;  4ARF A;  2B5M A;  1TKY A;  4A0B A;  1WZC A;  3I7K A;  1V7O A;  3RHU A;  2ZOS A;  3RFN A;  4XR1 A;  2IUU A;  4A09 A;  4TZ4 A;  3EI2 A;  4CI3 A;  3EI1 A;  1WNU A;  1WXO A;  3I8E A;  4XR0 A; 
#chains in the Genus database with same CATH homology
 4ARE A;  1TKG A;  2ZZE A;  2I05 A;  4CI2 A;  3I7O A;  2ZTG A;  2ZZF A;  4XR3 A;  1V4P A;  4XR2 A;  5FQD A;  2Y50 A;  2E1B A;  4CI1 A;  1QF6 A;  4ARF A;  2B5M A;  4A08 A;  1TJE A;  1NYQ A;  3I7N A;  1TKY A;  3EI3 A;  4AR9 A;  3KEW A;  4A0B A;  2Y6I A;  4E5Z A;  3I7P A;  3I7K A;  1V7O A;  3RHU A;  2HYE A;  2ZZG A;  2I06 A;  3RFN A;  4AR8 A;  2IUS A;  4XR1 A;  4E54 A;  3WQZ A;  3E0C A;  3I8C A;  2IUU A;  4A09 A;  3EI4 A;  4TZ4 A;  4A0A A;  3EI2 A;  3I89 A;  1ECR A;  1TKE A;  1NYR A;  2B5L A;  3I7L A;  2IUT A;  3I7H A;  1WNU A;  1WXO A;  4AR1 A;  4CI3 A;  2Y3U A;  3EI1 A;  3I8E A;  2EWJ A;  4XR0 A;  4A11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...