1WXOA

Structure of archaeal trans-editing protein alax in complex with zinc
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
MYSIEVRTHSALHVVKGAVVKVLGSEAKWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKVKENAPIKIYELPREEAEKMFGEDMYDLFPVPEDVRILKVVVIEDWNVNACNKEHTKTTGEIGPIKIRKVRFRKSKGLLEIHFELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of alanine discrimination in editing site
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords alanyl-tRNA synthetase
total genus 47
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.54.20 Alpha Beta 2-Layer Sandwich Replication Terminator Protein; Chain A, domain 2 Replication Terminator Protein; Chain A, domain 2 1wxoA02
3.30.980.10 Alpha Beta 2-Layer Sandwich Threonyl-tRNA Synthetase; Chain A, domain 2 Threonyl-trna Synthetase; Chain A, domain 2 1wxoA01
1TKGA 2ZTGA 1NYRA 1QF6A 1V4PA 1WXOA 2ZZGA 3RFNA 1TJEA 1NYQA 3RHUA 2E1BA 2ZZFA 1V7OA 3KEWA 3WQZA 1TKYA 2ZZEA 1TKEA 1WNUA
chains in the Genus database with same CATH superfamily
4AR9A 2IUSA 4XR1A 1TKEA 2Y6IA 3ZX4A 3EI3A 4AR8A 3KEWA 3I7NA 4CI1A 4A0BA 4A09A 3WQZA 1XVIA 4AR1A 3ZW7A 2ZZEA 2ZTGA 5FQDA 4E54A 1QF6A 1WXOA 3I7HA 3ZUPA 3EI2A 2EWJA 4XR0A 3ZX5A 3I7OA 3ZTYA 4TZ4A 4CI3A 3EI1A 1ECRA 4XR3A 1WNUA 3ZU6A 1TKGA 1NYRA 4CI2A 4A08A 4AREA 1V4PA 3RFNA 1V7OA 3E0CA 3I8EA 3I7PA 3I7KA 3I8CA 4A11A 1TKYA 2I06A 4E5ZA 4A0AA 2HYEA 4XR2A 3I89A 2ZZGA 2Y50A 2I05A 3EI4A 1TJEA 1NYQA 2E1BA 3I7LA 2ZZFA 3ZWDA 2B5MA 2IUTA 3ZWKA 2ZOSA 2Y3UA 3ZTWA 4ARFA 2IUUA 1WZCA 2B5LA 3RHUA
chains in the Genus database with same CATH topology
4AR9A 2IUSA 4XR1A 1TKEA 2Y6IA 4AR8A 3EI3A 4CI1A 3KEWA 3I7NA 4A0BA 4A09A 3WQZA 2ZZEA 2ZTGA 5FQDA 4E54A 1QF6A 1WXOA 3I7HA 3EI2A 2EWJA 4XR0A 3I7OA 4TZ4A 4CI3A 3EI1A 1ECRA 4XR3A 1WNUA 4A08A 1TKGA 1NYRA 4CI2A 4AREA 1V4PA 3RFNA 1V7OA 3E0CA 3I8EA 3I7PA 3I7KA 3I8CA 4A11A 1TKYA 2I06A 4E5ZA 4A0AA 2HYEA 4XR2A 3I89A 2ZZGA 2Y50A 2I05A 3EI4A 1TJEA 1NYQA 2E1BA 3I7LA 2ZZFA 4AR1A 2B5MA 2IUTA 2Y3UA 4ARFA 2IUUA 2B5LA 3RHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKG A;  2ZTG A;  1NYR A;  1QF6 A;  1V4P A;  1WXO A;  2ZZG A;  3RFN A;  1TJE A;  1NYQ A;  3RHU A;  2E1B A;  2ZZF A;  1V7O A;  3KEW A;  3WQZ A;  1TKY A;  2ZZE A;  1TKE A;  1WNU A; 
#chains in the Genus database with same CATH topology
 4AR9 A;  2IUS A;  4XR1 A;  1TKE A;  2Y6I A;  3ZX4 A;  3EI3 A;  4AR8 A;  3KEW A;  3I7N A;  4CI1 A;  4A0B A;  4A09 A;  3WQZ A;  1XVI A;  4AR1 A;  3ZW7 A;  2ZZE A;  2ZTG A;  5FQD A;  4E54 A;  1QF6 A;  1WXO A;  3I7H A;  3ZUP A;  3EI2 A;  2EWJ A;  4XR0 A;  3ZX5 A;  3I7O A;  3ZTY A;  4TZ4 A;  4CI3 A;  3EI1 A;  1ECR A;  4XR3 A;  1WNU A;  3ZU6 A;  1TKG A;  1NYR A;  4CI2 A;  4A08 A;  4ARE A;  1V4P A;  3RFN A;  1V7O A;  3E0C A;  3I8E A;  3I7P A;  3I7K A;  3I8C A;  4A11 A;  1TKY A;  2I06 A;  4E5Z A;  4A0A A;  2HYE A;  4XR2 A;  3I89 A;  2ZZG A;  2Y50 A;  2I05 A;  3EI4 A;  1TJE A;  1NYQ A;  2E1B A;  3I7L A;  2ZZF A;  3ZWD A;  2B5M A;  2IUT A;  3ZWK A;  2ZOS A;  2Y3U A;  3ZTW A;  4ARF A;  2IUU A;  1WZC A;  2B5L A;  3RHU A; 
#chains in the Genus database with same CATH homology
 4AR9 A;  2IUS A;  4XR1 A;  1TKE A;  2Y6I A;  4AR8 A;  3EI3 A;  4CI1 A;  3KEW A;  3I7N A;  4A0B A;  4A09 A;  3WQZ A;  2ZZE A;  2ZTG A;  5FQD A;  4E54 A;  1QF6 A;  1WXO A;  3I7H A;  3EI2 A;  2EWJ A;  4XR0 A;  3I7O A;  4TZ4 A;  4CI3 A;  3EI1 A;  1ECR A;  4XR3 A;  1WNU A;  4A08 A;  1TKG A;  1NYR A;  4CI2 A;  4ARE A;  1V4P A;  3RFN A;  1V7O A;  3E0C A;  3I8E A;  3I7P A;  3I7K A;  3I8C A;  4A11 A;  1TKY A;  2I06 A;  4E5Z A;  4A0A A;  2HYE A;  4XR2 A;  3I89 A;  2ZZG A;  2Y50 A;  2I05 A;  3EI4 A;  1TJE A;  1NYQ A;  2E1B A;  3I7L A;  2ZZF A;  4AR1 A;  2B5M A;  2IUT A;  2Y3U A;  4ARF A;  2IUU A;  2B5L A;  3RHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...