The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
52
|
structure length |
52
|
Chain Sequence |
NPEDWFTPDTCAYGDSNTAWTTCTTPGQTCYTCCSSCFDVVGEQACQMSAQC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Molecular cold-adaptation: Comparative analysis of two homologous families of psychrophilic and mesophilic signal proteins of the protozoan ciliate, Euplotes.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Mating pheromone En-1
|
| total genus |
15
|
| structure length |
52
|
| sequence length |
52
|
| ec nomenclature | |
| pdb deposition date | 2008-12-17 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Pheromone ER-1 | Pheromone ER-1 |
#chains in the Genus database with same CATH superfamily 2KC6 A; 2NSW A; 2NSV A; 2KK2 A; 2JMS A; #chains in the Genus database with same CATH topology 3KXR A; 4E2K A; 1ERC A; 2B39 A; 1DDE A; 2KK2 A; 4EDV A; 4EDT A; 4EE1 A; 2NSW A; 1DD9 A; 3B39 A; 2JMS A; 2AU3 A; 2NSV A; 4EDR A; 3CU7 A; 2LMK A; 2ERL A; 3KLS A; 2KC6 A; 4EDG A; 4EDK A; 1EQN A; #chains in the Genus database with same CATH homology 3KXR A; 4E2K A; 1ERC A; 2B39 A; 1DDE A; 2KK2 A; 4EDV A; 4EDT A; 4EE1 A; 2NSW A; 1DD9 A; 3B39 A; 2JMS A; 2AU3 A; 2NSV A; 4EDR A; 3CU7 A; 2LMK A; 2ERL A; 3KLS A; 2KC6 A; 4EDG A; 4EDK A; 1EQN A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
