The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
159
|
structure length |
157
|
Chain Sequence |
GMAFMEKIFPDILEAIRNEEIIKESKKIPMPYFGLFALVIFDKVKGSETSLYEIGEEFGKMLSPKNIEELKKIFKLMNFGDLEIDENKILLKNPPYKIKLSNPPYQWVSKEEPIHDFIAGILAGCLEEIFYYYFVVNEVECVSQGKDKCVFEVKEVD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Metal binding protein
|
source organism |
Methanocaldococcus jannaschii dsm 2661
|
publication title |
Crystal structure of hypothetical protein MJ_1460 (1592102) from Methanocaldococcus jannaschii at 1.90 A resolution
rcsb |
molecule keywords |
Hypothetical protein MJ1460
|
total genus |
39
|
structure length |
157
|
sequence length |
159
|
ec nomenclature | |
pdb deposition date | 2007-02-06 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02830 | V4R | V4R domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Muramoyl-pentapeptide Carboxypeptidase; domain 2 | Trafficking protein particle complex subunit 3 |
#chains in the Genus database with same CATH superfamily 2BJN A; 3KXC C; 2J3T B; 2J3W D; 2CFH A; 3CUE D; 2OSD A; 2J3R B; 2C0J A; 2J3W B; 3NJC A; 1WC8 A; 3CUE B; 2CFH C; 1SZ7 A; 1WC9 A; 2PWN A; 3KXC A; 2J3T A; 2C0J B; 2J3R A; 2OSO A; #chains in the Genus database with same CATH topology 2BJN A; 3M1N A; 4MPH A; 3KXC C; 4NT9 A; 4C4N A; 2J3T B; 2J3W D; 2CFH A; 2IBG E; 3K7I B; 3N1Q A; 2OSD A; 3CUE D; 3N1R A; 4JID A; 4OX5 A; 5HNM A; 2J3R B; 3K7G B; 3N1O A; 3N1P B; 1TZP A; 2C0J A; 2J3W B; 2WG4 A; 3N1G A; 3NJC A; 2WFR A; 3MXW A; 4MUS A; 3D1M A; 4OX3 A; 1WC8 A; 3CUE B; 4D0Y A; 2CFH C; 1VHH A; 3N1F A; 1SZ7 A; 1WC9 A; 2PWN A; 2WG3 A; 3K7H B; 4MUQ A; 3KXC A; 4OXD A; 4MUR A; 2J3T A; 2C0J B; 2WFX A; 3K7J B; 2VO9 A; 4OAK A; 3N1M B; 4MUT A; 2J3R A; 2WFQ A; 4C4M A; 4F78 A; 1R44 A; 1U10 A; 1LBU A; 2OSO A; 3HO5 H; #chains in the Genus database with same CATH homology 2BJN A; 3KXC C; 2J3T B; 2J3W D; 2CFH A; 3CUE D; 2OSD A; 2J3R B; 2C0J A; 2J3W B; 3NJC A; 1WC8 A; 3CUE B; 2CFH C; 1SZ7 A; 1WC9 A; 2PWN A; 3KXC A; 2J3T A; 2C0J B; 2J3R A; 2OSO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...