The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
49
|
sequence length |
171
|
structure length |
171
|
Chain Sequence |
EDPPACGSIVPRREWRALASECRERLTRPVRYVVVSHTAGSHCDTPASCAQQAQNVQSYHVRNLGWCDVGYNFLIGEDGLVYEGRGWNIKGAHAGPTWNPISIGISFMGNYMNRVPPPRALRAAQNLLACGVALGALRSNYEVKGHRDVQPTLSPGDRLYEIIQTWSHYRA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Antibiotic, antimicrobial protein
|
molecule keywords |
Peptidoglycan recognition protein 1
|
publication title |
Structural insights into the dual strategy of recognition by peptidoglycan recognition protein, PGRP-S: structure of the ternary complex of PGRP-S with lipopolysaccharide and stearic acid.
pubmed doi rcsb |
total genus |
49
|
structure length |
171
|
sequence length |
171
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2012-08-03 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01510 | Amidase_2 | N-acetylmuramoyl-L-alanine amidase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Lysozyme-like | Peptidoglycan recognition protein-like |
#chains in the Genus database with same CATH superfamily 4Q9E A; 1SK3 A; 4KNL A; 3LAT A; 3RDR A; 4OLS A; 2EAV A; 3USX A; 4BXJ A; 2Y28 A; 3D2Y A; 2XZ8 A; 2Y2C A; 2F2L A; 2RKQ A; 3NG4 A; 3T39 A; 1LBA A; 2R90 A; 4BXD A; 1YCK A; 4OPP A; 3COR A; 3UIL A; 2Z9N A; 1YB0 A; 1SK4 A; 2CB3 A; 1SXR A; 2Y2E A; 3QS0 A; 3RT4 A; 4BXE A; 4ZXM A; 3UMQ A; 5E0B A; 4Z8I A; 2R2K A; 2AR3 A; 2WKX A; 2APH A; 2F2L X; 1J3G A; 3TRU A; 2BH7 A; 4BPA A; 4BOL A; 4GF9 A; 2Y2B A; 5CTV A; 3HMB A; 3CXA A; 1OHT A; 3CG9 A; 3QV4 A; 1S2J A; 3UML A; 4ORV A; 3OGX A; 2Y2D A; 4IVV A; 3QJ1 A; 4X36 A; 3NW3 A; 2L47 A; 2EAX A; 3C2X A; 3NNO A; 4OUG A; 3EP1 A; 4Q8S A; 5E0A A; 5DWF A; 4KNK A; 1Z6I A; 3T2V A; 2XZ4 A; 1ARO L; 3D2Z A; 4FNN A; 3O4K A; 1TWQ A; 4BJ4 A; #chains in the Genus database with same CATH topology 4Q9E A; 1SK3 A; 4KNL A; 3LAT A; 3RDR A; 4OLS A; 2EAV A; 3USX A; 4BXJ A; 2Y28 A; 3D2Y A; 2XZ8 A; 2Y2C A; 2F2L A; 2RKQ A; 3NG4 A; 3T39 A; 1LBA A; 2R90 A; 4BXD A; 1YCK A; 4OPP A; 3COR A; 3UIL A; 2Z9N A; 1YB0 A; 1SK4 A; 2CB3 A; 1SXR A; 2Y2E A; 3QS0 A; 3RT4 A; 4BXE A; 4ZXM A; 3UMQ A; 5E0B A; 4Z8I A; 2R2K A; 2AR3 A; 2WKX A; 2APH A; 2F2L X; 1J3G A; 3TRU A; 2BH7 A; 4BPA A; 4BOL A; 4GF9 A; 2Y2B A; 5CTV A; 3HMB A; 3CXA A; 1OHT A; 3CG9 A; 3QV4 A; 1S2J A; 3UML A; 4ORV A; 3OGX A; 2Y2D A; 4IVV A; 3QJ1 A; 4X36 A; 3NW3 A; 2L47 A; 2EAX A; 3C2X A; 3NNO A; 4OUG A; 3EP1 A; 4Q8S A; 5E0A A; 5DWF A; 4KNK A; 1Z6I A; 3T2V A; 2XZ4 A; 1ARO L; 3D2Z A; 4FNN A; 3O4K A; 1TWQ A; 4BJ4 A; #chains in the Genus database with same CATH homology 4Q9E A; 1SK3 A; 4KNL A; 3LAT A; 3RDR A; 4OLS A; 2EAV A; 3USX A; 4BXJ A; 2Y28 A; 3D2Y A; 2XZ8 A; 2Y2C A; 2F2L A; 2RKQ A; 3NG4 A; 3T39 A; 1LBA A; 2R90 A; 4BXD A; 1YCK A; 4OPP A; 3COR A; 3UIL A; 2Z9N A; 1YB0 A; 1SK4 A; 2CB3 A; 1SXR A; 2Y2E A; 3QS0 A; 3RT4 A; 4BXE A; 4ZXM A; 3UMQ A; 5E0B A; 4Z8I A; 2R2K A; 2AR3 A; 2WKX A; 2APH A; 2F2L X; 1J3G A; 3TRU A; 2BH7 A; 4BPA A; 4BOL A; 4GF9 A; 2Y2B A; 5CTV A; 3HMB A; 3CXA A; 1OHT A; 3CG9 A; 3QV4 A; 1S2J A; 3UML A; 4ORV A; 3OGX A; 2Y2D A; 4IVV A; 3QJ1 A; 4X36 A; 3NW3 A; 2L47 A; 2EAX A; 3C2X A; 3NNO A; 4OUG A; 3EP1 A; 4Q8S A; 5E0A A; 5DWF A; 4KNK A; 1Z6I A; 3T2V A; 2XZ4 A; 1ARO L; 3D2Z A; 4FNN A; 3O4K A; 1TWQ A; 4BJ4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...