The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
88
|
sequence length |
307
|
structure length |
307
|
Chain Sequence |
RYDLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Replisome speed determines the efficiency of the Tus-Ter replication termination barrier.
pubmed doi rcsb |
| molecule keywords |
DNA replication terminus site-binding protein
|
| molecule tags |
Replication/dna
|
| source organism |
Escherichia coli (strain k12)
|
| total genus |
88
|
| structure length |
307
|
| sequence length |
307
|
| ec nomenclature | |
| pdb deposition date | 2015-01-20 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05472 | Ter | DNA replication terminus site-binding protein (Ter protein) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Replication Terminator Protein; Chain A, domain 2 | Replication Terminator Protein; Chain A, domain 2 | ||
| Alpha Beta | 3-Layer(bba) Sandwich | Replication Terminator Protein (Tus); Chain A, domain 1 | Replication terminator Tus, domain 1 superfamily/Replication terminator Tus |
#chains in the Genus database with same CATH superfamily 2I06 A; 2EWJ A; 1ECR A; 4XR3 A; 4XR1 A; 2I05 A; 4XR0 A; 4XR2 A; #chains in the Genus database with same CATH topology 1V7O A; 1TKE A; 1WNU A; 2ZTG A; 4XR3 A; 1WXO A; 1TKY A; 2I05 A; 3RHU A; 2ZZF A; 3RFN A; 2ZZG A; 2I06 A; 2ZZE A; 2EWJ A; 1V4P A; 3WQZ A; 1TJE A; 4XR0 A; 1QF6 A; 4XR2 A; 1TKG A; 1ECR A; 4XR1 A; #chains in the Genus database with same CATH homology 1V7O A; 1TKE A; 1WNU A; 2ZTG A; 4XR3 A; 1WXO A; 1TKY A; 2I05 A; 3RHU A; 2ZZF A; 3RFN A; 2ZZG A; 2I06 A; 2ZZE A; 2EWJ A; 1V4P A; 3WQZ A; 1TJE A; 4XR0 A; 1QF6 A; 4XR2 A; 1TKG A; 1ECR A; 4XR1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
