1F89A

Crystal structure of saccharomyces cerevisiae nit3, a member of branch 10 of the nitrilase superfamily
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
281
structure length
271
Chain Sequence
SASKILSQKIKVALVQLSGSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPYSTDQFRKYSEVINPKEPSTSVQFLSNLANKFKIILVGGTIPELDPKTDKIYNTSIIFNEDGKLIDKHRKVHLFHESETLSPGEKSTTIDTKYGKFGVGICYDMRFPELAMLSARKGAFAMIYPSAFNTVTGPLHWHLLARSRAVDNQVYVMLCSPARNLQSSYHAYGHSIVVDPRGKIVAEAGEGEEIIYAELDPEVIESFRQAVPLTKQRRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative CN hydrolase from yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords 32.5 KDA PROTEIN YLR351C
total genus 78
structure length 271
sequence length 281
chains with identical sequence B
ec nomenclature ec 3.5.1.3: Omega-amidase.
pdb deposition date 2000-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00795 CN_hydrolase Carbon-nitrogen hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.110.10 Alpha Beta 4-Layer Sandwich Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase Carbon-nitrogen hydrolase 1f89A00
4GYLA 4IZTA 5H8KA 2E2LA 3DLAA 3KI8A 2GGKA 3SEZA 3KLCA 4CYYA 5H8IA 2E11A 3N05A 4KZFA 1UF8A 5H8JA 3IW3A 1EMSA 3ILVA 1UF5A 4HG5A 3SZGA 2UXYA 2VHIA 3HKXA 3SDBA 4CYGA 5H8LA 1UF4A 1FO6A 4IZVA 1ERZA 2DYVA 3SEQA 5KHAA 3SYTA 1F89A 1UF7A 2VHHA 2PLQA 4HGDA 2DYUA 4HG3A 3P8KA 1J31A 3WUYA 4IZUA 2W1VA 4CYFA 5JQNA 3IVZA 4H5UA 4GYNA 4IZWA 2E2KA 4F4HA 4LF0A 4IZSA 2GGLA
chains in the Genus database with same CATH superfamily
4GYLA 4IZTA 5H8KA 2E2LA 3DLAA 3KI8A 2GGKA 3SEZA 3KLCA 4CYYA 5H8IA 2E11A 3N05A 4KZFA 1UF8A 5H8JA 3IW3A 1EMSA 3ILVA 1UF5A 4HG5A 3SZGA 2UXYA 2VHIA 3HKXA 3SDBA 4CYGA 5H8LA 1UF4A 1FO6A 4IZVA 1ERZA 2DYVA 3SEQA 5KHAA 3SYTA 1F89A 1UF7A 2VHHA 2PLQA 4HGDA 2DYUA 4HG3A 3P8KA 1J31A 3WUYA 4IZUA 2W1VA 4CYFA 5JQNA 3IVZA 4H5UA 4GYNA 4IZWA 2E2KA 4F4HA 4LF0A 4IZSA 2GGLA
chains in the Genus database with same CATH topology
4GYLA 4IZTA 5H8KA 2E2LA 3DLAA 3KI8A 2GGKA 3SEZA 3KLCA 4CYYA 5H8IA 2E11A 3N05A 4KZFA 1UF8A 5H8JA 3IW3A 1EMSA 3ILVA 1UF5A 4HG5A 3SZGA 2UXYA 2VHIA 3HKXA 3SDBA 4CYGA 5H8LA 1UF4A 1FO6A 4IZVA 1ERZA 2DYVA 3SEQA 5KHAA 3SYTA 1F89A 1UF7A 2VHHA 2PLQA 4HGDA 2DYUA 4HG3A 3P8KA 1J31A 3WUYA 4IZUA 2W1VA 4CYFA 5JQNA 3IVZA 4H5UA 4GYNA 4IZWA 2E2KA 4F4HA 4LF0A 4IZSA 2GGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYL A;  4IZT A;  5H8K A;  2E2L A;  3DLA A;  3KI8 A;  2GGK A;  3SEZ A;  3KLC A;  4CYY A;  5H8I A;  2E11 A;  3N05 A;  4KZF A;  1UF8 A;  5H8J A;  3IW3 A;  1EMS A;  3ILV A;  1UF5 A;  4HG5 A;  3SZG A;  2UXY A;  2VHI A;  3HKX A;  3SDB A;  4CYG A;  5H8L A;  1UF4 A;  1FO6 A;  4IZV A;  1ERZ A;  2DYV A;  3SEQ A;  5KHA A;  3SYT A;  1F89 A;  1UF7 A;  2VHH A;  2PLQ A;  4HGD A;  2DYU A;  4HG3 A;  3P8K A;  1J31 A;  3WUY A;  4IZU A;  2W1V A;  4CYF A;  5JQN A;  3IVZ A;  4H5U A;  4GYN A;  4IZW A;  2E2K A;  4F4H A;  4LF0 A;  4IZS A;  2GGL A; 
#chains in the Genus database with same CATH topology
 4GYL A;  4IZT A;  5H8K A;  2E2L A;  3DLA A;  3KI8 A;  2GGK A;  3SEZ A;  3KLC A;  4CYY A;  5H8I A;  2E11 A;  3N05 A;  4KZF A;  1UF8 A;  5H8J A;  3IW3 A;  1EMS A;  3ILV A;  1UF5 A;  4HG5 A;  3SZG A;  2UXY A;  2VHI A;  3HKX A;  3SDB A;  4CYG A;  5H8L A;  1UF4 A;  1FO6 A;  4IZV A;  1ERZ A;  2DYV A;  3SEQ A;  5KHA A;  3SYT A;  1F89 A;  1UF7 A;  2VHH A;  2PLQ A;  4HGD A;  2DYU A;  4HG3 A;  3P8K A;  1J31 A;  3WUY A;  4IZU A;  2W1V A;  4CYF A;  5JQN A;  3IVZ A;  4H5U A;  4GYN A;  4IZW A;  2E2K A;  4F4H A;  4LF0 A;  4IZS A;  2GGL A; 
#chains in the Genus database with same CATH homology
 4GYL A;  4IZT A;  5H8K A;  2E2L A;  3DLA A;  3KI8 A;  2GGK A;  3SEZ A;  3KLC A;  4CYY A;  5H8I A;  2E11 A;  3N05 A;  4KZF A;  1UF8 A;  5H8J A;  3IW3 A;  1EMS A;  3ILV A;  1UF5 A;  4HG5 A;  3SZG A;  2UXY A;  2VHI A;  3HKX A;  3SDB A;  4CYG A;  5H8L A;  1UF4 A;  1FO6 A;  4IZV A;  1ERZ A;  2DYV A;  3SEQ A;  5KHA A;  3SYT A;  1F89 A;  1UF7 A;  2VHH A;  2PLQ A;  4HGD A;  2DYU A;  4HG3 A;  3P8K A;  1J31 A;  3WUY A;  4IZU A;  2W1V A;  4CYF A;  5JQN A;  3IVZ A;  4H5U A;  4GYN A;  4IZW A;  2E2K A;  4F4H A;  4LF0 A;  4IZS A;  2GGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...