1FO6A

Crystal structure analysis of n-carbamoyl-d-amino-acid amidohydrolase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
302
structure length
302
Chain Sequence
RQMILAVGQQGPIARAETREQVVGRLLDMLTNAASRGVNFIVFPELALTTFFPRWHFTDEAELDSFYETEMPGPVVRPLFETAAELGIGFNLGYAELVVEGGVKRRFNTSILVDKSGKIVGKYRKIHLPGHKEYEAYRPFQHLEKRYFEPGDLGFPVYDVDAAKMGMFICNDRRWPETWRVMGLKGAEIICGGYNTPTHNPPVPQHDHLTSFHHLLSMQAGSYQNGAWSAAAGKVGMEEGCMLLGHSCIVAPTGEIVALTTTLEDEVITAALDLDRCRELREHIFNFKAHRQPQHYGLIAEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and site-directed mutagenesis studies of N-carbamoyl-D-amino-acid amidohydrolase from Agrobacterium radiobacter reveals a homotetramer and insight into a catalytic cleft.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Hydrolase
molecule keywords N-CARBAMoYL-D-AMINO-ACID AMIDOHYDROLASE
total genus 104
structure length 302
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.77: N-carbamoyl-D-amino-acid hydrolase.
pdb deposition date 2000-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00795 CN_hydrolase Carbon-nitrogen hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.110.10 Alpha Beta 4-Layer Sandwich Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase Carbon-nitrogen hydrolase 1fo6A00
4CYGA 1UF5A 3IVZA 1EMSA 3DLAA 4IZTA 4KZFA 5KHAA 1UF7A 3SDBA 3SYTA 3IW3A 2UXYA 3KI8A 1UF8A 3KLCA 5JQNA 4IZWA 2GGKA 4IZVA 2GGLA 5H8LA 4CYYA 1ERZA 4IZUA 3N05A 2DYUA 3SZGA 2PLQA 4HGDA 5H8KA 4GYLA 3ILVA 1UF4A 2E2LA 4GYNA 2VHIA 5H8JA 1FO6A 1F89A 3SEQA 1J31A 2E2KA 2VHHA 3HKXA 4HG5A 4IZSA 3WUYA 4CYFA 2DYVA 4HG3A 3SEZA 3P8KA 2W1VA 4F4HA 5H8IA 2E11A 4H5UA 4LF0A
chains in the Genus database with same CATH superfamily
4CYGA 1UF5A 3IVZA 1EMSA 3DLAA 4IZTA 4KZFA 5KHAA 1UF7A 3SDBA 3SYTA 3IW3A 2UXYA 3KI8A 1UF8A 3KLCA 5JQNA 4IZWA 2GGKA 4IZVA 2GGLA 5H8LA 4CYYA 1ERZA 4IZUA 3N05A 2DYUA 3SZGA 2PLQA 4HGDA 5H8KA 4GYLA 3ILVA 1UF4A 2E2LA 4GYNA 2VHIA 5H8JA 1FO6A 1F89A 3SEQA 1J31A 2E2KA 2VHHA 3HKXA 4HG5A 4IZSA 3WUYA 4CYFA 2DYVA 4HG3A 3SEZA 3P8KA 2W1VA 4F4HA 5H8IA 2E11A 4H5UA 4LF0A
chains in the Genus database with same CATH topology
4CYGA 1UF5A 3IVZA 1EMSA 3DLAA 4IZTA 4KZFA 5KHAA 1UF7A 3SDBA 3SYTA 3IW3A 2UXYA 3KI8A 1UF8A 3KLCA 5JQNA 4IZWA 2GGKA 4IZVA 2GGLA 5H8LA 4CYYA 1ERZA 4IZUA 3N05A 2DYUA 3SZGA 2PLQA 4HGDA 5H8KA 4GYLA 3ILVA 1UF4A 2E2LA 4GYNA 2VHIA 5H8JA 1FO6A 1F89A 3SEQA 1J31A 2E2KA 2VHHA 3HKXA 4HG5A 4IZSA 3WUYA 4CYFA 2DYVA 4HG3A 3SEZA 3P8KA 2W1VA 4F4HA 5H8IA 2E11A 4H5UA 4LF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYG A;  1UF5 A;  3IVZ A;  1EMS A;  3DLA A;  4IZT A;  4KZF A;  5KHA A;  1UF7 A;  3SDB A;  3SYT A;  3IW3 A;  2UXY A;  3KI8 A;  1UF8 A;  3KLC A;  5JQN A;  4IZW A;  2GGK A;  4IZV A;  2GGL A;  5H8L A;  4CYY A;  1ERZ A;  4IZU A;  3N05 A;  2DYU A;  3SZG A;  2PLQ A;  4HGD A;  5H8K A;  4GYL A;  3ILV A;  1UF4 A;  2E2L A;  4GYN A;  2VHI A;  5H8J A;  1FO6 A;  1F89 A;  3SEQ A;  1J31 A;  2E2K A;  2VHH A;  3HKX A;  4HG5 A;  4IZS A;  3WUY A;  4CYF A;  2DYV A;  4HG3 A;  3SEZ A;  3P8K A;  2W1V A;  4F4H A;  5H8I A;  2E11 A;  4H5U A;  4LF0 A; 
#chains in the Genus database with same CATH topology
 4CYG A;  1UF5 A;  3IVZ A;  1EMS A;  3DLA A;  4IZT A;  4KZF A;  5KHA A;  1UF7 A;  3SDB A;  3SYT A;  3IW3 A;  2UXY A;  3KI8 A;  1UF8 A;  3KLC A;  5JQN A;  4IZW A;  2GGK A;  4IZV A;  2GGL A;  5H8L A;  4CYY A;  1ERZ A;  4IZU A;  3N05 A;  2DYU A;  3SZG A;  2PLQ A;  4HGD A;  5H8K A;  4GYL A;  3ILV A;  1UF4 A;  2E2L A;  4GYN A;  2VHI A;  5H8J A;  1FO6 A;  1F89 A;  3SEQ A;  1J31 A;  2E2K A;  2VHH A;  3HKX A;  4HG5 A;  4IZS A;  3WUY A;  4CYF A;  2DYV A;  4HG3 A;  3SEZ A;  3P8K A;  2W1V A;  4F4H A;  5H8I A;  2E11 A;  4H5U A;  4LF0 A; 
#chains in the Genus database with same CATH homology
 4CYG A;  1UF5 A;  3IVZ A;  1EMS A;  3DLA A;  4IZT A;  4KZF A;  5KHA A;  1UF7 A;  3SDB A;  3SYT A;  3IW3 A;  2UXY A;  3KI8 A;  1UF8 A;  3KLC A;  5JQN A;  4IZW A;  2GGK A;  4IZV A;  2GGL A;  5H8L A;  4CYY A;  1ERZ A;  4IZU A;  3N05 A;  2DYU A;  3SZG A;  2PLQ A;  4HGD A;  5H8K A;  4GYL A;  3ILV A;  1UF4 A;  2E2L A;  4GYN A;  2VHI A;  5H8J A;  1FO6 A;  1F89 A;  3SEQ A;  1J31 A;  2E2K A;  2VHH A;  3HKX A;  4HG5 A;  4IZS A;  3WUY A;  4CYF A;  2DYV A;  4HG3 A;  3SEZ A;  3P8K A;  2W1V A;  4F4H A;  5H8I A;  2E11 A;  4H5U A;  4LF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...