The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
70
|
structure length |
70
|
Chain Sequence |
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of the focal adhesion adaptor PINCH LIM1 domain and characterization of its interaction with the integrin-linked kinase ankyrin repeat domain.
pubmed doi rcsb |
| molecule keywords |
PINCH PROTEIN
|
| molecule tags |
Cell adhesion
|
| source organism |
Homo sapiens
|
| total genus |
14
|
| structure length |
70
|
| sequence length |
70
|
| ec nomenclature | |
| pdb deposition date | 2000-10-26 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00412 | LIM | LIM domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Cysteine Rich Protein | Cysteine Rich Protein |
#chains in the Genus database with same CATH superfamily 2XJY A; 2MBV A; 1J2O A; 1WYH A; 1X61 A; 1CTL A; 2XJZ A; 4JCJ A; 1QLI A; 1X4L A; 2KBX B; 2XQN T; 2COR A; 1A7I A; 1X64 A; 4HI9 B; 2DLO A; 1X63 A; 2CUR A; 2MIU A; 2EGQ A; 2L6Y B; 2DJ7 A; 3MMK A; 2O13 A; 2D8Z A; 1IBI A; 2D8Y A; 1CXX A; 2D8X A; 2CO8 A; 3F6Q B; 1G47 A; 2DAR A; 1IML A; 1M3V A; 2L4Z A; 2YPA C; 3IXE B; 4KFZ A; 1WIG A; 1RUT X; 4HI8 B; 1X62 A; 2CUQ A; 1X3H A; 2LXD A; 1V6G A; 2O10 A; 2JTN A; 2DFY C; 2LZU A; 2CU8 A; 1NYP A; 1X6A A; 2CUP A; 2EHE A; 2IYB E; 2L6Z C; 1U5S B; 1B8T A; 1X68 A; #chains in the Genus database with same CATH topology 2MBV A; 1QLI A; 1X4L A; 5LKX A; 4HI9 B; 1X63 A; 2XUE A; 2EGQ A; 2L6Y B; 5FY7 A; 3NIK A; 5FY0 A; 3MMK A; 2D8Z A; 2D8Y A; 4EZH A; 1G47 A; 4KFZ A; 2DFY C; 2EHE A; 1U5S B; 5FXX A; 4UF0 B; 2XJY A; 5LKU A; 4EYU A; 1CTL A; 1J2O A; 2XJZ A; 5FXZ A; 2KBX B; 2XQN T; 2DLO A; 5FXV A; 2DJ7 A; 3F6Q B; 1IML A; 2L4Z A; 2YPA C; 1WIG A; 1X62 A; 1X3H A; 2JTN A; 2LZU A; 2CUP A; 5FY1 A; 1X68 A; 1WYH A; 5LKT A; 4BHW A; 4EZ4 A; 3NIH A; 1IBI A; 1CXX A; 3ZPO A; 2D8X A; 3ZLI A; 1M3V A; 5LKZ A; 4HI8 B; 4UF0 A; 2CUQ A; 3NIM A; 1V6G A; 2O10 A; 1NYP A; 2IYB E; 2L6Z C; 5FXW A; 1B8T A; 3IXE B; 1X61 A; 5A1L A; 4JCJ A; 4ASK A; 3NIS A; 3NIL A; 2COR A; 1A7I A; 1X64 A; 2CUR A; 2MIU A; 2O13 A; 2CO8 A; 5FP3 A; 2DAR A; 5FYM A; 1RUT X; 3NIN A; 2LXD A; 3AVR A; 3NIJ A; 2CU8 A; 1X6A A; 3AVS A; #chains in the Genus database with same CATH homology 2MBV A; 1QLI A; 1X4L A; 5LKX A; 4HI9 B; 1X63 A; 2XUE A; 2EGQ A; 2L6Y B; 5FY7 A; 3NIK A; 5FY0 A; 3MMK A; 2D8Z A; 2D8Y A; 4EZH A; 1G47 A; 4KFZ A; 2DFY C; 2EHE A; 1U5S B; 5FXX A; 4UF0 B; 2XJY A; 5LKU A; 4EYU A; 1CTL A; 1J2O A; 2XJZ A; 5FXZ A; 2KBX B; 2XQN T; 2DLO A; 5FXV A; 2DJ7 A; 3F6Q B; 1IML A; 2L4Z A; 2YPA C; 1WIG A; 1X62 A; 1X3H A; 2JTN A; 2LZU A; 2CUP A; 5FY1 A; 1X68 A; 1WYH A; 5LKT A; 4BHW A; 4EZ4 A; 3NIH A; 1IBI A; 1CXX A; 3ZPO A; 2D8X A; 3ZLI A; 1M3V A; 5LKZ A; 4HI8 B; 4UF0 A; 2CUQ A; 3NIM A; 1V6G A; 2O10 A; 1NYP A; 2IYB E; 2L6Z C; 5FXW A; 1B8T A; 3IXE B; 1X61 A; 5A1L A; 4JCJ A; 4ASK A; 3NIS A; 3NIL A; 2COR A; 1A7I A; 1X64 A; 2CUR A; 2MIU A; 2O13 A; 2CO8 A; 5FP3 A; 2DAR A; 5FYM A; 1RUT X; 3NIN A; 2LXD A; 3AVR A; 3NIJ A; 2CU8 A; 1X6A A; 3AVS A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...