The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
118
|
structure length |
118
|
Chain Sequence |
SGRFSIKAKNYFLTYPKCDLTKENALSQITNLQTPTNKLFIKICRELHENGEPHLHILIQFEGKYNCTNQRFFDLVSPTRSAHFHPNIQGAKSSSDVKSYIDKDGDVLEWGTFQIDGR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The structure of a replication initiator unites diverse aspects of nucleic acid metabolism
pubmed doi rcsb |
molecule tags |
Viral protein
|
source organism |
Tomato yellow leaf curl sardinia virus
|
molecule keywords |
Rep protein
|
total genus |
17
|
structure length |
118
|
sequence length |
118
|
ec nomenclature | |
pdb deposition date | 2002-03-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00799 | Gemini_AL1 | Geminivirus Rep catalytic domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Replication Protein E1; Chain: A, | Replication Protein E1; Chain: A, |
#chains in the Genus database with same CATH superfamily 1M55 A; 1Z1D B; 4ZO0 A; 4FGN A; 1L2M A; 4NBP A; 3QN2 A; 3QFQ A; 1UUT A; 4FB3 A; 2IPR A; 2IF9 A; 2ITL A; 2ITJ A; 2NTC A; 2NL8 A; 1L5I A; 4ZQ9 A; 2HW0 A; 5DCX A; 1RZ9 A; 1TBD A; 2FUF A; 5D9I A; 3QK2 A; 5CYN A; 2TBD A; 4GDF A; 5BYG A; 4LIF A; 4LMD A; #chains in the Genus database with same CATH topology 1M55 A; 1Z1D B; 4ZO0 A; 4FGN A; 1L2M A; 4NBP A; 3QN2 A; 3QFQ A; 1UUT A; 3DKX A; 4FB3 A; 2IPR A; 2IF9 A; 2ITL A; 1KSX A; 4U87 A; 1KSY A; 2ITJ A; 2NTC A; 2NL8 A; 1L5I A; 4ZQ9 A; 2HW0 A; 5DCX A; 1RZ9 A; 1TBD A; 1R9W A; 2FUF A; 1F08 A; 5D9I A; 4KW3 A; 3QK2 A; 5CYN A; 2TBD A; 3DKY A; 4GDF A; 5BYG A; 4LIF A; 4LMD A; #chains in the Genus database with same CATH homology 1M55 A; 1Z1D B; 4ZO0 A; 4FGN A; 1L2M A; 4NBP A; 3QN2 A; 3QFQ A; 1UUT A; 3DKX A; 4FB3 A; 2IPR A; 2IF9 A; 2ITL A; 1KSX A; 4U87 A; 1KSY A; 2ITJ A; 2NTC A; 2NL8 A; 1L5I A; 4ZQ9 A; 2HW0 A; 5DCX A; 1RZ9 A; 1TBD A; 1R9W A; 2FUF A; 1F08 A; 5D9I A; 4KW3 A; 3QK2 A; 5CYN A; 2TBD A; 3DKY A; 4GDF A; 5BYG A; 4LIF A; 4LMD A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...