The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
133
|
structure length |
132
|
Chain Sequence |
GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPES
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Replication/dna
|
molecule keywords |
Large T antigen
|
publication title |
Structure-based analysis of the interaction between the simian virus 40 T-antigen origin binding domain and single-stranded DNA.
pubmed doi rcsb |
source organism |
Simian virus 40
|
total genus |
39
|
structure length |
132
|
sequence length |
133
|
chains with identical sequence |
B
|
ec nomenclature |
ec
3.6.4.-: |
pdb deposition date | 2015-08-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02217 | T_Ag_DNA_bind | Origin of replication binding protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Replication Protein E1; Chain: A, | Replication Protein E1; Chain: A, |
#chains in the Genus database with same CATH superfamily 2FUF A; 4GDF A; 3QN2 A; 4LMD A; 2IF9 A; 1M55 A; 2ITJ A; 4FB3 A; 4ZQ9 A; 3QK2 A; 1RZ9 A; 2ITL A; 2TBD A; 4ZO0 A; 5BYG A; 3QFQ A; 1TBD A; 2NTC A; 2HW0 A; 5DCX A; 1UUT A; 1L5I A; 2NL8 A; 2IPR A; 4NBP A; 5CYN A; 1Z1D B; 4FGN A; 5D9I A; 1L2M A; 4LIF A; #chains in the Genus database with same CATH topology 2FUF A; 4GDF A; 3QN2 A; 1KSY A; 4LMD A; 3DKX A; 2IF9 A; 1M55 A; 2ITJ A; 4FB3 A; 4ZQ9 A; 3QK2 A; 1RZ9 A; 2ITL A; 4KW3 A; 2TBD A; 4U87 A; 1R9W A; 4ZO0 A; 5BYG A; 3QFQ A; 1TBD A; 2NTC A; 2HW0 A; 1F08 A; 5DCX A; 1UUT A; 1L5I A; 2NL8 A; 2IPR A; 3DKY A; 4NBP A; 5CYN A; 1KSX A; 1Z1D B; 4FGN A; 5D9I A; 1L2M A; 4LIF A; #chains in the Genus database with same CATH homology 2FUF A; 4GDF A; 3QN2 A; 1KSY A; 4LMD A; 3DKX A; 2IF9 A; 1M55 A; 2ITJ A; 4FB3 A; 4ZQ9 A; 3QK2 A; 1RZ9 A; 2ITL A; 4KW3 A; 2TBD A; 4U87 A; 1R9W A; 4ZO0 A; 5BYG A; 3QFQ A; 1TBD A; 2NTC A; 2HW0 A; 1F08 A; 5DCX A; 1UUT A; 1L5I A; 2NL8 A; 2IPR A; 3DKY A; 4NBP A; 5CYN A; 1KSX A; 1Z1D B; 4FGN A; 5D9I A; 1L2M A; 4LIF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...