3DKYA

Crystal structure of the replication initiator protein encoded on plasmid pmv158 (repb), tetragonal form, to 3.6 ang resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
b'EKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSSIKGQKYKKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHESKDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYDFIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein repB
publication title Plasmid replication initiator RepB forms a hexamer reminiscent of ring helicases and has mobile nuclease domains
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Replication
total genus 58
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01719 Rep_2 Plasmid replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dkyA02
3.40.1310.30 Alpha Beta 3-Layer(aba) Sandwich Replication Protein E1; Chain: A, Replication Protein E1; Chain: A, 3dkyA01
3DKXA 3DKYA 4U87A
chains in the Genus database with same CATH superfamily
2H09A 1D5VA 3S1MJ 3HIFA 3LSPA 1FMVA 5FLXK 3DTIA 2HTJA 4XSZF 2HVQA 1AU7A 4AD9A 4PFOA 1XSDA 1KU3A 1J09A 3A1YA 1U6GA 2QUFA 2VKHA 1ETXA 1TBXA 3PO3J 1L3LA 4O6JA 2KISA 5L3EA 4I99C 4EMSA 1MIJA 2VC0A 3T5XA 4NUBA 4ESBA 4UV9A 3BY6A 4XLEA 4E7SA 5LHHA 1UG0A 3AKZA 4D1QA 2CW0F 3D5RC 3L2WA 2XB0X 3KYDB 3FBNB 4I6ZA 2V26A 3JRFA 2KZGA 3U21A 1XN7A 4CZZA 5F0HA 1HKSA 2CW8A 3LAPA 2FUG2 1T39A 4J00A 2STWA 2E7WA 3BR0A 5CVRA 3LQRA 2CUZA 3K4BA 2IVMA 4LIUA 1TWFJ 5J8CA 5HVQC 4MIMA 2VE9A 2DFIA 3H9JA 1EA3A 3M07A 1FIAA 2EFPA 4BXUA 3BG9A 1WZ2A 3M8EA 1ZH5A 2VODA 4BEHA 2ESHA 2LD5A 2DDAA 5L3BA 3G1LA 5EZGA 1A36A 1QQIA 1A6QA 3H3ZA 3ZN0A 3FMRA 2DMUA 2MABA 5ICCA 1AA7A 3CDIA 4FTHA 1HW5A 4QPOA 3H35A 1SFOJ 4HA8A 4M3FA 3K70D 2QGUA 4C3JJ 4I2OA 3MKWB 1Y39A 2HU9A 3DKYA 3W6VA 2IGNA 3FMQA 3KP7A 4KJZA 2R7UA 1FWZA 2FRHA 4XBFA 2CS3A 1DU0A 2VI6A 3TBIA 1AHDP 5F08A 4EV0A 4HX4A 4JQFA 1YG2A 2GXAA 2JQ7A 1OCRH 2VC1A 5GPAA 3GFIA 1Z67A 3EPZA 3OYAA 4HLYA 1B8IA 2MYSA 2V6CA 3LSGA 2M8GX 3BCBA 4E7IA 3JSOA 2ZNZA 2GIZA 3HUGA 5E8IA 1HLVA 1HC8A 3BOQA 4DQ2A 4KA4A 1ZREA 1XS9A 1ON2A 4M9SA 1I27A 4LFUA 2D1HA 3K70C 4A93J 2DMPA 1IN8A 2L7KA 3KIOA 1S9HA 4L18B 2R92J 3BDDA 4KT6A 5EG0B 3SEQA 1FBQA 1N25A 2GA2A 3LSTA 2HOSA 1G3YA 1FOXA 4KIBA 5EYRA 4V2GA 2CMPA 5DCFA 4ESJA 1V5FA 4A6EA 3S1QJ 3ZQFA 2A07F 5EG0A 5JHUA 1ZRDA 4DNCA 3L2VA 4N4NB 4EJTA 3GBGA 4P5OA 4IXAA 2HKOA 4KW3A 3F8MA 3F6VA 2JZYA 2XPVA 2EV6A 5FD6A 5LBQA 5J1UA 2DO7A 1U3EM 1WKMA 1JKQC 3SZGA 3LA2A 1JKPC 1KU7A 4BJTA 4CSWA 4FGNA 3HB9A 1Z7UA 2KIQA 2L3DA 4LLGF 2FNAA 2AXTC 2V9KA 5M5YJ 1QHGA 1DGWY 5D6FA 3S14J 2XRNA 1B1BA 4GDFA 1O7LA 2HXOA 3OYNA 3RPUD 2O3FA 1RI7A 2TRTA 4BDZA 5HNHA 2FQ3A 3ZN1A 4PDKA 1J9IA 3HSFA 4BS9A 2QEXI 1XSXA 4G6TB 3HOZJ 3J7AO 2KP6A 4M9ZA 3WTZA 1B6AA 3QPSA 1QZZA 4P9FA 3ROUA 4IO9F 4YELA 3J80Z 1ENHA 1FOYA 4IHWA 4M3BA 3FWEA 2WWYA 2YPRA 2ESNA 3KZIC 1FZPB 4QSHA 3LFUA 2JRTA 4KMUX 1YYVA 1AKHA 3ZMUA 4XL9A 5IT9K 1GV2A 1BJZA 2JA2A 3PJRA 1G3TA 4XOPA 5H6QA 3CP2A 2DLLA 1ZR4A 2E1MB 1VQKI 3BG5A 2IPRA 1XDSA 3JRCA 2K27A 2Y9YA 4F55A 3VDXA 4DZJA 5HLGA 1KU9A 1T56A 1MJ9A 3Q9VA 5IOYA 1U9OA 2GOXB 3G6EI 2LNBA 2MH2A 2BXYA 2F5FA 3O8HA 4D5CA 1R23A 3GFLA 3E1SA 5BMZA 2R5ZB 2NNNA 2QA4I 5JFRA 4KN7X 1YI2I 2RAEA 2E2IJ 2DA6A 1HDPA 4MHGA 3OR1C 3HJEA 3DP7A 2PMZA 3HRSA 2CV1A 2LDUA 2KIFA 4XMYA 5AONA 1R4MB 3MFKA 1YITI 2XPUA 4G7HF 4GXOA 4RS8A 2H27A 4RGSA 2XROA 3CMEI 3S2WA 5LGTA 2STTA 2PJRA 3GEZA 2MD0A 2IEKA 4O5VA 1JT6A 4XRFA 1BBYA 2V1DA 4TV7A 3V42A 4AIJA 3JAMZ 3BJ6A 1VQ4I 3BQZA 3GTJJ 1BA5A 1KQ9A 3R0JA 4A3EJ 4ITVA 3JR9A 2W82A 4MO7A 2PFBA 2Z33A 4A3KJ 5JHFA 3MN2A 4MFEA 4PK4A 3WGHA 1TC3C 2VPRA 5FKKA 2DCEA 2EPFA 5IP6A 1ZGJA 4M3GA 2NVXJ 2KDOA 2P6SA 2E2HJ 5FLXZ 2ZB9A 5TGTA 1IV6A 2F2EA 2IS2A 3PIOF 3CO7C 4EGYA 3TW7A 3HPGA 4RDUA 5LRRA 1I39A 1WJFA 3KLNA 1U8RA 2XAJA 5E3OA 1FYKA 3F6OA 3OYHA 3LSMA 4IL6C 4LOCA 1VQMI 4WX9A 3SQNA 1LKXA 2FOKA 3GTQJ 2QYOA 2VKVA 3SXYA 1LQ1A 1ZYRF 1L0OC 4BYYA 4N9IA 1FTTA 4ENMA 5A2QK 2P5LC 2B7EA 4Y13A 2BW3A 2AQEA 2HQRA 2E60A 2MG4A 4ON0A 2FUFA 2VB6A 2Q0OA 4P55A 4UY8I 1WFXA 2VQGA 3GFMA 5E1WA 3LA7A 2V9VA 3RYPA 2OJED 1SMTA 1LVKA 1IRXA 2WBMA 1QGPA 4M72A 2FU4A 4M6VA 4BQOA 1I1SA 2BYVE 2ISYA 4LLLA 3BTJA 4DJAA 1XX5A 4HX7A 4BACA 1K7AA 1QVTA 2D5VA 3BP8A 2K9MA 2VQHA 3S8PA 1MMNA 3WTUC 5H6RA 4R8HA 2VJIA 2F5VA 2L5QA 1L2MA 2L4MA 4UUSB 1FNNA 1AOYA 1XMXA 2WB1A 2VOOA 2KDZA 2K7LA 5D5VB 2JMWA 5H20A 1MBGA 1BJAA 1UB9A 4IQJA 3I64A 4XLCA 3FXMA 4UUSA 3QOEA 1WH5A 2PBIA 3PUFA 4G6QA 1RIOH 4AM3A 1D0ZA 1R58A 4ENNA 4UVBA 5GTHC 2GA1A 4A5NA 2GXGA 2KHMA 4RM3A 4IHTA 1UCRA 2HTSA 4M73A 2M3AA 3FM5A 3TOAA 1JJ6C 1B4AA 4HNVA 2JUCA 2QQBA 4M74A 1W4MA 3VYRB 3ZMSA 3GZ5A 4S04A 1LEBA 2WA0A 3V4GA 5K1YA 3K7AJ 1R49A 2R4GA 3GVAA 3ABMH 3GWZA 1J2XA 1A35A 3UKGA 4ZZDA 2HNHA 3RSNA 5J1RA 3QQAA 3MZHA 1IXCA 1O57A 3AFHA 2NTCA 2X9DA 2EFQA 4IOAF 2K4BA 3AG1H 3ZMZA 3JTGA 3ERMA 4A2UA 1X58A 2GOMA 3B6CA 4ZDLA 2O61A 1U5TB 1X1CA 2CYYA 2V4JC 2GIVA 4A3FJ 4FB3A 3WTWC 3BPXA 1RZ4A 1XMKA 3OR2C 5J6XA 3IV5A 2W48A 5J47A 2FNPA 3FDYA 1U5TA 4ZYEA 1JUMA 2L01A 2BVMA 3CESA 5CLSA 1FX7A 4AVZA 5DD8A 4YRVA 1BOAA 4HDVA 3IRQA 3AG2H 3M8JA 5JI6A 5JLXA 1M55A 1OQYA 4C3IJ 1SFEA 4HF0A 1ZG3A 3IH4A 2PLYA 1ODDA 2JVGA 4DYCA 5DCMB 1J7KA 1ETOA 1OJLA 1ZELA 2W4SA 1JGSA 2MC4A 3ELKA 4PJNA 4P9UA 3JSPA 1RRJA 3R61A 4Y17A 4F3QA 2YU9J 2WV1A 3BWGA 1UUTA 3BR6A 3DFGA 1GXQA 1S7OA 2ITLA 4PGGA 2FA5A 2DA4A 5EEGA 1LDKB 3FXJA 1CGPA 3IWZA 1F9NA 2FOWA 3VPRA 1JJ8C 2H1KA 5IT9Z 4XLFA 2ZXJA 3FHZA 4U88A 3QK2A 5LHIA 1SEUA 1R9TJ 1MSFC 2KRHA 2HOAA 3VEPA 1NG6A 4ZYGA 2ZSIB 5CVJA 4RAFA 1B72B 3KX2A 2EA4A 3H3UA 4BNCA 3TO6A 5DM7F 2KJCA 2R3SA 2XV4S 4IJAA 1V5EA 1BOBA 2XIGA 1CQTA 3O3KA 1HKTA 2WAQA 1DDNA 1BI0A 3TQNA 3HPHA 1USSA 3V8LA 1G3WA 3F72A 3ECHA 4AC0A 3DTEA 2QQ8A 4G7ZF 2IA2A 1Z21A 3G1OA 4X6AJ 2ZMEA 4WWCA 2M0CA 2R5YB 2G7HA 1KSXA 1RKTA 3HL2A 1JUSA 5D8KB 2E2JJ 1H89C 1FP2A 1Q1HA 1SD7A 3DTKA 4IPAA 1GDTA 1J59A 5C44J 2H8RA 2HYFA 4BKXA 2R5YA 2M7AA 2O6GE 4B3XA 1EH8A 1WI9A 3NWSA 2ZSHB 2LC2A 2DOFA 4A69C 5EEAA 3CMMA 2M30A 4YFKF 1JKOC 3I55I 2P8TA 5IY5H 2G9WA 4BHPA 2JSPA 3DWLE 4ZZLA 1MD0A 1RC9A 2R7FA 2Z3YA 1LJ9A 1X4OA 3FF5A 4L5JA 4CCMA 2Y9ZA 5FJ8J 1C0WA 4A3GJ 2K5CA 2ME0A 5FLVA 4HNUA 4D5FA 2L4AA 2QLZA 1BI1A 3HGYA 4B1RA 5HLTA 2IT0A 1BR2A 2BOLA 2GZWA 2VJ5A 5E3LA 1MBJA 3BZ6A 2VBYA 4U7BA 3M9AA 5BNGA 4WXCA 5AIQA 2CV2A 4BL0B 5A2QZ 3GTMJ 4V2FA 4A3BJ 4OMYA 4X0GA 3LWFA 2H6CA 1OR7A 2VASA 2Y69H 2Q1ZB 2ZJ2A 1S72I 4LK0F 2BXZA 3HG9A 3PNVA 3HOXJ 2MW8A 1O4XA 1F1ZA 2GM4A 1NHAA 2V1XA 9ANTA 4XSXF 1JGGA 4Y15A 1TZLA 3PQKA 1ULYA 1H8AC 2BZTA 3R0AA 1Z77A 2VKDA 2ZCWA 1VQOI 1G3SA 2XAGA 5HLHA 3H92A 1J5YA 3MAJA 2LOOA 2F5EA 4BH9A 4JX5A 1D3YA 1MH3A 2HDDA 2HWVA 1KQ8A 5KCMA 3MMYB 3A03A 5CQGA 4G9YA 2W24A 1YQAA 1IRFA 3L9FA 5IP7J 4MQVA 2X51A 4F93B 1T38A 4DBRA 1HF0A 1E2XA 4D7NA 2F4IA 2PMHA 4R79A 3U1DA 2OUMA 1X1DA 5FFXA 4YIRX 1LUJB 1RR8C 1T98A 2VJJA 3DQVC 2A5WA 3GTOJ 2P4WA 2EINH 5B1BH 2HVSA 4GCVA 4BQNA 2P5KA 2X1EA 3OWTA 1SFXA 3HHHA 5HS8A 2CW7A 2LRDA 2GQQA 2DOAA 2EZLA 2KJBA 4KYWA 3CO6C 1WCMJ 1N75A 1IUFA 1F4KA 2F6CA 2ICWG 3CUOA 4YG2F 5J8FA 1YS6A 3CD6I 2OZ6A 3ZP5A 1QRYA 3HOTA 2XDVA 5KAFC 1J0RA 1UG2A 2DA2A 4RMNA 4Y52J 4DGWB 1SD5A 1MNDA 4UB6C 4NBPA 5BPDA 5CJ9A 1NH3A 3P9IA 1K4TA 4FASD 4EM0B 5KHDA 1BC7C 2RKHA 4PJJA 5IP9J 2DOEA 2P5VA 2NXNB 3ZQHA 4L9TA 3NWTA 3E5XA 1ERDA 1FOWA 4YEJA 1U5TC 4BQAA 4OIQF 2EFOA 2RVCA 3HRTA 4IHSA 2M4GA 2O8KA 3JRGA 4FETA 4BAYA 4UB8C 1X2MA 2DFFA 3OYDA 3E0JB 1HQCA 3D5SC 1FBSA 4A5MA 4UUVA 5FGMA 1SVLA 3P9CA 3SHFA 3E6DA 2ZJQF 4KT5C 2M4KA 5TJJA 4DYQA 5LHGA 2JA8J 2L7MP 2IF9A 3TL4X 1P7IA 1RNLA 4RA2A 1K61A 2I5UA 5EGOA 4GFBA 4M9XA 1YW8A 2VBZA 1U0JA 1SMYF 3VOEA 3L00A 4HNTA 3CCRI 2ITJA 2Z16A 4ZYAA 1KZHA 1K6OA 1JI8A 5B66C 1MJBA 1FT9A 3S93A 3ZGKA 1P6RA 2XF5A 3WTYC 4E7JA 3AL0B 1OYIA 2JT1A 4A0ZA 1I6XA 2KLOA 2Y75A 3KFWX 1G8XA 4UVAA 3E5QA 4PZJA 2YX7A 2LTPA 3IKTA 3BJOA 2E19A 3KP5A 1WQ2A 2E1NA 1TWHJ 1MJAA 2QKLB 4AYBN 2ID6A 2XF6A 3LSRA 4BEHB 3ASOH 3SJMA 1PYVA 1MKMA 3H36A 1LE8B 4LK1F 2XGXA 4IF4A 3ABKH 2M34A 3MWMA 3JRIA 3BPVA 1OCCH 3OYGA 1R36A 2LKXA 4LGWA 5DDGA 3E3VA 3W3CA 1LE8A 1R6RA 2K3PA 3JW4A 2ZMEC 2ELJA 3PUBA 1KYWA 4JP0A 4MLOA 1V3FA 2XGEA 1RR7A 2ZXHA 3KETA 5ILVA 3DPTA 1D0XA 3RI4A 2H8WA 2EB7A 2IW5A 1B9NA 2QSFX 3E97A 1WGXA 2R7RA 4KICA 1X4PA 3C18A 3W6KB 1B8IB 3CMAI 5IYCJ 1FPQA 4B09A 4DW6A 3S1RJ 1TL8A 4EEFG 3HUGB 3OL4A 2QZ8A 4IRGA 1Z7LA 4J01A 3W6JB 3EYYA 5D8LB 1SANA 4P1WA 4QTRA 4KITB 3CCMI 3ONQA 3B02A 1U8BA 3WTVC 2ZJRF 3C2GA 1LFPA 5BOXA 3HTUA 2I8DA 3GUDA 5J4YA 3HRUA 1FBUA 4CGZA 1X1BA 3S3MA 3T8RA 2VLAA 2PJPA 3DPUA 3A02A 3ASNH 3K0LA 2DAOA 5HDNA 2MBFA 4NQWA 2DPUA 4NNJA 2FMLA 4EJOA 1EH6A 3CJRB 3TEDA 2CWEA 4S05A 1LB2A 3CDHA 2FF4A 2JUGA 1APLC 2DBBA 3KZZA 5IOZA 3CLOA 4XNFA 1QNTA 3CUQA 2BV6A 3I4MJ 2LY2A 4XM3A 3QAHA 1TT0A 1E3OC 4X1EA 1X3WB 3ZMVA 4M6YA 2FSWA 1H9GA 1Y8QB 3FKJA 5FRNA 2FXAA 1SVOA 1VFCA 2DT6A 4KIGA 1H9TA 3S15J 4A3IJ 3BR3A 2DMQA 3Q3SA 2Q2EB 3GZ6A 1HCRA 1SVMA 1A04A 1ETKA 5FKMA 4M71A 1LVAA 1Y6IA 4CH7A 5F04A 4CYDA 3S17J 2UWMA 5K5QA 2LR8A 3BTCA 1YJNI 1ETWA 1FIPA 1YW7A 2BVLA 2KMUA 4LD5A 1LEAA 5DUKA 4ZTJA 2Q2EA 3KEOA 2IA0A 4CCLA 1X1AA 1VNDA 1OPCA 1U9NA 2E7XA 4KUMA 3ZQGA 1EJ9A 2KIUA 2ID3A 2KZVA 3ABUA 3I5UA 3H0DA 1R1VA 1AKHB 2CQKA 2KRFA 3AAFA 2QSHX 4B48A 1PUFB 2ZXWH 2Y2ZA 2VXZA 2E71A 1G6NA 3F0CA 3RYRA 2HZDA 4DYRA 1YW9A 2WV0A 1MZBA 5L3CA 3WG7H 5LEKA 1HW1A 5FLMJ 1PUFA 2QVOA 4F91B 2MC3A 3KZYA 3QP5A 2NOJB 1TQMA 4HSRA 4BXFA 2YSRA 1I1GA 2V7FA 2XRLA 2VONA 2VJ4A 3I0TA 2CFXA 2FMYA 2OTLI 5JVTA 3EUHC 1LDDA 2M7BA 2KFDA 3H5RA 2L2OA 5D5WB 4LIVA 1XG1A 2F5DA 1X1PA 2ZXIA 3ABLH 2A68F 3GO5A 3WHBA 2PEXA 1JE8A 2VT2A 2X6YA 4YIIA 4JBAA 2LKPA 1YJ9I 3I71A 3CQZJ 3QYBA 4XN0A 2PJRB 2ECBA 1D1CA 2PMUA 5D5XB 1WPKA 5F1RA 2V1NA 2C6YA 3ZQ7A 3HTSB 1ETQA 3OS0A 1IRZA 4KNYA 1Z0XA 4PGHA 3OIOA 2Y0MA 3OYIA 3Q0UA 2JA6J 4HSTA 3K4NA 2DJIA 3FM3A 3E6MA 2DYRH 2NAZA 3TW6A 2JWTA 4NDLA 3N97A 4HYEA 2OPTA 1GUUA 5JR3A 1XD7A 2COBA 4UUTA 2DN0A 1MBKA 2QBYA 2DODA 1BW6A 4HF2A 2IP2A 1GT0C 1TP4A 5FKOA 5E3MA 4CZCA 1BN5A 3LL7A 3A01A 4ENKA 3K4CA 2LVSA 2EBIA 2I10A 1PUEE 3KP4A 4WF2A 1WJ5A 2EWNA 4BJ5C 4KIFA 5CKTA 1KSYA 3ZMDA 1W5TA 2BW3B 2TCTA 2XB5A 3SYTA 1U78A 2L7ZA 4LITA 1TLHB 4E6KG 3H9QA 1BI2A 4YFNF 5DUIA 1R5GA 4RGUA 3S2HJ 3AL0C 4KN4X 4NB5A 4G6DA 2IA1A 4HDUA 1AWCA 4C2MJ 3AG4H 2BY3A 3FXQA 4BGDA 3LQQA 5F27A 4U7DA 3DLAA 2QM3A 4O3MA 4KMFA 4XKCA 1IRGA 1OISA 4ASNA 5J4VA 4S0HB 3EUAA 3WE2A 3TDZC 1E3PA 3M8FA 5L3DA 3TGNA 3L2RA 2J5PA 3DKXA 3QPLA 5CVUA 1KYZA 3OYJA 2CJJA 1R00A 2ZC2A 1Z1DB 5GTIC 3BG7A 4QLCU 2QQ9A 1QPIA 1ZLKA 1BL0A 3BQYA 4IZZA 1FY7A 2VL8A 5IPAA 2P7VB 3KP6A 4L9NA 2PMZN 5KNLA 1OKRA 3ZQQA 3HKZA 3TKYA 1Z1DA 2YX4A 2FBHA 3V7CA 3OSFA 2MH9A 3BLYA 2QSGX 3I3LA 4U0WA 2IGMA 4F92B 3CC7I 4IHVA 1TWGJ 2N8GA 3ZRGA 2HDCA 5GPCA 2LMDA 4A3JJ 3CZ6A 1OLTA 3FKIJ 3DKWA 3DEUA 4ZH4F 2RV8A 3GMEA 2OC6A 2O9LA 5CYVA 1XCBA 1WVRA 3JREA 2NOGA 3ZCOA 2FE3A 3BROA 3KCCA 4RAGA 3CC4I 1F43A 5DTDA 4CUGA 5ED4A 1JTYA 2OA4A 2HPIA 2FX0A 4XORA 1TWAJ 1RPWA 1R7JA 2VQLA 1ZN2A 2F4MB 2B9SA 3CDLA 1UAAA 2FEZA 5BS6A 3JRDA 3I4PA 4JYKA 3CMYA 3CCUI 3EDPA 4YIFA 2E5ZA 2OF7A 5CPRB 2OTJI 3MCZA 1XGMA 4ESFA 2G0EA 3SZPA 2E34A 1TT5B 3I56I 5ICGA 1X3UA 3IKVA 4I98B 1MMSA 3HYIA 2RREA 5IT3A 3PNYA 2V1UA 2MLKA 2H94A 5EZHA 4B47A 3QYFA 3NARA 3H0GJ 3ZXSA 3BJAA 2M0MA 1UFMA 3IUOA 1HA8A 3FXKA 2O03A 2OD5A 1DGRM 2IS4A 3OY9A 4MTEA 4FT8A 4I76A 5LLQA 3CF5F 4Q48A 2EIMH 1ZHFA 2HPMA 3L2CA 2O0YA 2EFWA 5FRMA 1KA8A 3KE2A 5GP9A 4CDGA 2KPMA 4RB0A 3J7YJ 4I01A 1KONA 2VKEA 2O7OA 2R0QC 2L9SA 2E1CA 4BDYA 1OCTC 1ONVA 1B9MA 3OV8A 2H6BA 1EF4A 1TWCJ 2AHQA 3DBRB 5HOOA 4XRMA 3CJNA 2UV1A 3CC2I 5C3EJ 1M1EB 1K6YA 5HS7A 3ML6A 1QZEA 1Y1WJ 2R7QA 3I58A 4QWQA 4OAYA 1K83J 2XKOA 2VBXA 1IAWA 1YX3A 2X1DA 1E3HA 3HDDA 2AXLA 3K4LA 1S7EA 3T1BA 1W36D 1S8NA 4HAMA 4XN3A 1B59A 1IN6A 1RESA 1W0TA 3FXLA 4BY7J 2ZJPF 3KPHA 4ZYHA 2IAIA 3LFKA 3Q0WA 4N4OB 4IX7A 3QPTA 3G71I 3OYKA 1K4SA 3FK7A 3K1NA 4BE2A 4HQEA 2VE8A 2Y30A 3V8JA 1TBDA 4MGRA 2HI3A 3A4CA 1FP1D 2HS5A 2COMA 3CCQI 3N4MA 2GBYA 3ERED 3VSKA 2DFEA 5E79C 2CQNA 4Y4RA 3TO9A 2NNYA 1UHWA 2ZMEB 1Y1VJ 2HKXA 1UZCA 3TP3A 4HOBA 3SFZA 5F0FA 1QBJA 5J40A 3HOSA 1Y8RB 3RTRA 2IGKA 3LAJA 2M87A 2CUJA 1W36C 3BG3A 3ZPLA 3J7ZI 3H1CA 2IGOA 5LRSA 2YR2A 4E7KA 1G2HA 4HV5A 4BHCA 2P6TA 3WTTC 4ZC3A 3DU5A 4NC6A 3KEQA 2HYJA 1IN7A 2XUBA 2DA1A 5CQEA 4CO8A 1R22A 5D4RA 1DP7P 1P4XA 4EJUA 1S7AA 5GAHJ 2BBYA 3KP3A 3RIRA 1ZRCA 3QYEA 5D4SA 4UNOA 3VWBA 3MKZA 3FBIB 1V54H 2PX9A 2HQNA 3JRAA 4ZTFA 3U2RA 1ZQ3P 2MSYA 3OS2A 1JTXA 4MEXF 4HF1A 4XK4A 3E6CC 2ECCA 1EV7A 3F9KA 1WJEA 1U2WA 2IPQX 2NS7A 2OZUA 3NEUA 3K69A 2V9PA 3M1CA 1QPMA 3NQOA 2OCCH 2JK3A 2JSCA 4IHYA 5ICEA 4XKBA 1WJAA 3M7GA 5E20A 1K78A 4CA0A 3Q0VA 1P4AA 2FQ4A 2E35A 2P81A 1SAXA 1MMGA 4ETSA 2BGCA 5E18F 1PP8F 2JVHA 3C2HA 1XB4A 2R7OA 4J19A 2D1VA 2DTZA 3CCVI 4ZO0A 1SD4A 2CU7A 2L7FP 3DPLC 5C4XJ 4HG2A 1YIJI 4PSWA 3GTLJ 1IW7F 1O3TA 3GLXA 2A5YB 3OIQA 4QPQA 5M3MJ 2HGCA 1YIOA 2UUZA 3QODA 3WGIA 2JPCA 2M1BA 2XVCA 3W2WA 2LY1A 1W7PB 1Z05A 5AIPA 1IGNA 2QENA 2WAQN 1ACIA 4BY1J 3MVPA 4GO1A 4UXNA 4B8XA 3V7RA 4ENJA 5FKLA 1XGNA 2FJ1A 2RNGA 4JK1X 4FX0A 3WTSC 5K7HA 4RB2C 1W7PA 4M3DA 3PSIA 1Q1VA 1VTNC 2UXXA 4K2EA 3BG6A 1XCVA 3BR5A 3I59B 3PFIA 3RZDJ 1L5IA 2XC7A 3HOYJ 3OYBA 1IXRC 2UXNA 4IEJA 1RZ9A 4B44A 1ZG1A 4WXDA 2X85A 5EJCA 3ISPA 5DM6F 3I59A 2F48A 3LA3A 4LG3A 2X1CA 3ULQB 4XIDA 4FISA 2Y0SN 3W2VA 2O5RA 4KISA 4LMYA 4AU7A 4I0BA 6PAXA 3H3VK 3P5JA 1VF9A 2LP0A 3ABTA 4OINF 1O7FA 1VZ0A 1ON1A 3OS1A 2MFZA 1FEXA 3F21A 3O6BB 4II3A 4AIKA 4PJMA 2DTRA 2EQRA 3SFIA 2HXIA 3LSJA 2LKSA 5BPIA 1ZAOA 1Z3YA 3K6GA 2IXSA 3KLOA 1IV8A 1VQLI 1SFKA 4IHXA 1JXSA 1X3ZB 3FXRA 4U87A 2CUFA 1VQPI 1WJCA 1MBHA 1OCZH 2M45A 3G73A 5DEQA 3I53A 3NAUA 1P7JA 1D5YA 1GXPA 3RCOA 4PFPA 4BHBA 2NS0A 2MLGA 1ZGWA 4AWXB 1O3QA 2LH9A 3LMMA 4C30A 1YJWI 1YFHA 4LJZF 5FO5A 5EGOB 4NC7A 2CO5A 1JT0A 2DU9A 3KEYA 4OWRB 4DBQA 3WTXC 1CF7B 2X48A 5F1JA 5M5XJ 1FOKA 4RLFA 5EF6A 3DLLF 4N9HA 3H5AA 3FIWA 2D2WA 2V79A 1CF7A 1A31A 3QWLA 3EETA 3R60A 1REPC 4RLQA 4GYIA 4BBRJ 2Z5UA 4FE4A 4M6XA 4RAZA 4CICA 4E70A 2AO9A 2PI0A 1IDZA 1VQ5I 4CYCA 2VUMJ 1TQIA 3G4SI 3DEEA 3EUKL 3VB2A 2Z9OA 4HZFA 2EH3A 4UVCA 3WGGA 1DP3A 1V5GA 4E7HA 4G8XA 1R71A 2IJLA 2MGQA 5EEHA 1H0MA 4HRIA 1DPUA 2ACJA 1IN4A 1MMDA 5E3NA 3WU1B 5CVVA 3RKXA 2TDXA 4NBQA 1ZTRA 1MBFA 1NTCA 2TBDA 3CCYA 5DYMA 1YX5A 1YTYA 1Y0NA 1IXSB 3K1MA 2ME6A 2L54A 2WY7Q 4ABZA 3I9V2 4FX4A 3V7SA 1VQ8I 1D8KA 2ADUA 2OAZA 3CLQA 3HC7A 4BXXJ 2WAFA 3P9KA 2O8XA 3PL8A 2YU3A 3CJTB 1R1UA 3FXOA 5M5WJ 4AIHA 1XDUA 2VOPA 2K40A 1V4RA 1WRJA 2K9QA 2JTVA 5TISC 1FLIA 3N05A 4G7OF 2X6WA 4PJ0C 2RNJA 2CRGA 1S29A 2VXDA 4CCJA 3HSRA 3F23A 2LF7A 4JOMA 2GWRA 5KK1A 1BW5A 2EV0A 1I3QJ 1TW3A 3REOA 4C2UA 3DU6A 2IRFG 2BY0A 3CCSI 1P2FA 1BR4A 3EQLF 4ZDPA 2Y31A 3BR2A 1Z91A 5BYGA 3C7JA 4IRHA 1RETA 1RKWA 4NQWB 2R7VA 1ZLJA 2LREA 5F6FA 1V55H 2K9NA 5D9IA 3PO2J 3J81K 1ZRFA 3VYSB 3ZOBA 5C4JJ 1T2KA 2ELKA 1SC7A 4XLNF 3IP4B 4F52A 3QRFF 4ZDOA 3CUQB 4GRIA 4CCOA 3JRBA 2CGPA 3PQJA 4H0EA 3X2QH 2EV5A 4D7MA 1WI3A 3HSEA 1W7PD 2A6HF 1X2NA 3MZ8A 3LSHA 1HSTA 4Z2YA 1OR7C 2B0LA 1DUXC 1TW2A 3DBHB 1Z6RA 4HQMA 3D0SA 3MKYB 1FMWA 3HGGA 2HDWA 2DDBA 1PVEA 3R6SA 2CUEA 2EZKA 3MQ0A 1G59A 2Z1DA 1IDYA 2K3FA 2K86A 1YE9A 2PG4A 2ZFWA 3G2BA 2W1OA 2EFNA 1LFUP 2HQAA 2DXIA 2OBPA 3FMSA 2KT0A 4E4HA 4WCGA 1MGTA 3IC7A 1N78A 5E8GA 3PM1A 1OYWA 3KP2A 2F4OB 2KQRA 2Y48A 3RKQA 3ZQIA 1MMAA 3ZQCA 3MZYA 3D5LA 4CCKA 4ZYDA 5HODA 5K7FA 1HOMA 3Q9SA 1JKRC 1MDMB 2GXBA 3QP6A 3GFJA 4II2A 2X6OA 2ZFUA 4XQFA 3S32A 4LLNA 1POGA 4U0YA 3HOVJ 1TQPA 4ANJA 2XASA 5HDGA 2OQGA 4U0VA 5JVGF 2KRCA 3DXJF 2IS1A 2W85A 3RKYA 4Q47A 1MDMA 1EH7A 3GW2A 2L9RA 1ZK8A 3HEFA 4LB5A 3GTGJ 5E1XA 2DYSH 2XSDC 3CCEI 2D45A 3HHGA 1VQ9I 2PN6A 3SDGA 5ILSA 2WTEA 4BE0A 3K1PA 2CFOA 3T0YA 3O8GA 3SEZA 3F8FA 5GADJ 3BTLA 3WU0A 1QA6A 2M2EA 1S5LC 1ZG5A 1GV5A 2P0WA 3S3OA 2GLOA 5L3FA 1UELB 3GYHX 4IOCF 3L09A 2K02A 4BQQA 5JLWA 2AQFA 2A3SA 1NK3P 1MNMC 3BR1A 3COAC 2AS5F 2EILH 3WU2C 4QIWN 3PSFA 2LK2A 4OMZA 3VSLA 5DD4A 3U9GA 4RM2A 5IYDJ 2EA2A 4CXFA 1OMIA 2XF7A 2BY2A 2JJ7A 3W2AA 2QBYB 2CQ7A 3PIPF 2LFBA 3QPHA 4PSXA 4NC8A 3A2KA 1Z3XA 4OIOF 2NYXA 4PUSA 2ETHA 3K2ZA 1Z9CA 3A01B 2B63J 5EDNA 2QQAA 2E1OA 4L9JA 3C3WA 3PNTA 1R4NB 3HZJA 2R7XA 3UNGC 2R5ZA 4Z6YA 3CTAA 5FKNA 4HLXA 5CYNA 1TTYA 4B43A 3VYTB 5GAGJ 4BJ6C 2R7ZJ 1T08B 5B5EC 2KKOA 3IAS2 1WJBA 2VPLA 3T8TA 2KL4A 4YFXF 4MEYF 3P7NA 3I4NJ 3NRVA 1YRNB 5LGUA 3FISA 3TDUC 1YOVB 3E7LA 3TOBA 4ZJZA 4GGGA 1XTAA 2FBKA 2EJRA 2XAUA 4HEA2 3GXOA 4PJLA 4JX4A 1XC5A 2CV0A 2FD5A 1YRNA 4L5EA 1NK2P 2HZTA 4Y3OA 2LY9A 4IKFA 4WXHA 2HVRA 2IS6A 4EQQA 5E17F 2L02A 3E6BA 3OMYA 2XAFA 1PDNC 1T8IA 2MD5A 3FK6A 2WC2A 4MNUA 3HBLA 1W0UA 3GLLA 4RBOA 1K79A 3LOCA 1I3AA 4RAYA 1JUPA 2RGVA 3S3NA 1I5ZA 3QFQA 1OFCX 3FHNA 2BEOA 1QHHD 1GHCA 1HSJA 2LYCA 3QN2A 4HBLA 3R4KA 3L7WA 1IC8A 1IO2A 1E0EA 2DPDA 3CCJI 1D0YA 4Y33A 2DFHA 2BHZA 2OCEA 3LSIA 1YO5C 2K9LA 4DIQA 2A61A 4F7ZA 1BI3A 5LD2C 2GAUA 1J75A 2DK8A 1FYLA 1XGSA 4XR6A 4AVPA 1F36A 3O2PE 2HEOA 4XONA 5LEJA 5IYBJ 2XPWA 3C2BA 1JHFA 3BC8A 4A0YA 2OQRA 5D5UB 1MW7A 4RB3C 3DCFA 1X19A 3J81Z 4DZPA 1PJRA 1BR1A 5LGNA 1IN5A 4R1HA 4XKVA 1ETYA 1ORKA 1W5CC 2LG4A 3VYUB 3OYEA 3CUQC 4OU0A 2EIKH 3HOWJ 4XKWA 2LF8A 2QF7A 4G12A 1LFBA 5BQTA 3Q5FA 1W5SA 1VQNI 1F5TA 3BZCA 4MFDA 3C1DA 1G4DA 1HXDA 2VN2A 1GLNA 3PFYA 4XICA 2HR3A 3CP8A 3K4MA 4BU2A 3GX4X 4V19K 4Q4ZF 1D8JA 4JX6A 2LBFB 1D1AA 5K5RA 3SZTA 3TO7A 2A69F 3OYMA 2Q8KA 4B3AA 1MH4A 2DI3A 4IVNA 2JRMA 2ELHA 1ZR2A 2CSOA 3BCAA 4NHJA 2PQ8A 4WK8F 1T0FA 4H4KC 4KDPA 2LBFA 2EK5A 1FYMA 4OIPF 3LSKA 3RKWA 2EZIA 1IJWC 1F08A 4CHUA 5D6EA 2DMNA 3HKZN 4IQ4A 5J3LA 2L0KA 2BHYA 1SD6A 3B73A 2ZKZA 4A3MJ 4HX8A 3H5NA 4EJVA 4EGZA 1H88C 1MBEA 3K4JA 2A6EF 2WB1N 2VQCA 5FFZA 5FROA 3MEXA 2K9SA 2X4HA 3UR3C 1XPXA 1YHQI 2ISZA 1TNSA 4EJWA 4UHTA 2OU2A 4XRSA 5GAEJ 4Y7NJ 5L3GA 3VFZA 1VI0A 2LSOA 1WJDA 3IL2A 3F8BA 3EYIA 1HKQA 3OSGA 2M5WA 1R9WA 4I0AA 1LNWA 3L2UA 3IH2A 3BZKA 2JN6A 2R7WA 2V6EA 2W00A 3I54A 3WE3A 2UZKA 3WHCA 1Y0UA 4BUPA 3RQIA 4L5IA 2A05A 3DF8A 1O3SA 4A3CJ 3FZVA 3IHUA 4OOIA 4PCQA 5B3SH 1ETVA 4XLHA 3IRRA 3WG9A 2P7CB 4E7LA 3F8CA 2ZBKA 1GVJA 3GCMA 1I6HJ 5DCMA 1DU6A 3DV8A 1R5ID 1QZYA 2VIXA 2W57A 2W84A 2YS9A 2XAQA 4MTDA 1PP7U 3GTPJ 4I09A 1WHUA 2WAEA 3DEWA 3D1NI 4BE1A 2LLKA 2WY8Q 3B6AA 1KQ0A 3IWFA 1STZA 2NVYJ 1ZARA 3K10A 3LNQA 2ZO4A 1VQ7I 2DA5A 1LDJA 3S2DJ 1Y56A 1MNEA 3JRHA 2E36A 3FXUA 5HDKA 2E1MC 3CJQB 1KU2A 1UMQA 3SDBA 1SFUA 3K9TA 3J7AY 3TMOA 3BT9A 2DQLA 1BC8C 1FSHA 4G94A 4HPQA 4Q5SF 1SAUA 3RPQA 5FB2A 1YS7A 1TNTA 3M3YJ 3IH3A 2HFHA 3ZR8X 1B72A 1XMAA 2DMTA 3H9GA 2QKMB 1WH7A 5F0CA 3RQ4A 1RUOA 3OYCA 3F22A 4EATA 4KFCA 1WWXA 2ZNYA 3QOPA 3QU3A 4AUXA 1FJLA 4A3LJ 3E5UA 1T6SA 4EVIA 2DW4A 2RQPA 3F8NA 3ZMTA 2DK5A 1IZ1A 2NVQJ 2M9HA 3G1MA 4RB1A 3L2QA 1K78B 2YUSA 3JTHA 3WODF 3CF2A 3HM5A 4P96A 1KGSA 2DT7B 4D9JA 2HW0A 1JHHA 2H1LA 1A6IA 1FTZA 2WADA 1N77A 1E17A 3DBLB 3RDIA 2L9VA 1D1BA 1S3JA 4BBSJ 2Y0SA 5DV5A 5M3FJ 2W7NA 2XAHA 1P9QC 1P92A 4C9YA 4ZQ9A 2CG4A 2EZHA 3KYCB 4N0BA 2BE5F 3GZNB 3ECOA 4HW0A 4XOTA 4FHTA 3K2AA 4UV8A 1LPQA 1ITYA 1Z6TA 5HS9A 2NRAC 4EM2A 1RUNA 5E1ZB 5K7ZA 5F64A 4FE7A 3G3ZA 2VBWA 4LB6B 4E7ZA 3M4OJ 4W1UA 1USTA 1OCPA 3HOUJ 2Z99A 1DQUA 3ZQLA 1MSEC 3A0HC 5ILUA 2DJNA 5KAIC 2HOTA 4OIRF 4AIDA 4RGXA 3S16J 1P4WA 2X6XA 1NG7A 2NVTJ 1S6LA 4B4CA 5LFAA 2EIJH 3RZOJ 1EKEA 2BY1A 2NS8A 3HXLA 5CVIA 5K5OA 2DA7A 3IAM2 2DT5A 2JA5J 1A5JA 4I02A 3CCLI 1I50J 3KYLA 2R7TA 3F3XA 3GTKJ 3OYLA 2R7DA 2W25A 1YLFA 5HLIA 4LMDA 2CQQA 4C2TA 1O3RA 2IBDA 4L0YB 3ESWB 3QU6A 1FC3A 2J5OA 2NL8A 2HOEA 4MQ9F 2G7UA 2XGDA 4M3EA 3OYFA 1DPRA 1R1TA 4D0PA 4A3DJ 3L1PA 2HQ5A 3MKLA 2JPBA 4RGRA 4A0XA 2OV7A 5DCXA 5B1AH 1HBXG 2JA7J 2NVUB 4GYGA 3OOUA 1HW2A 5KVRA 3FX3A 4LG0B 3J80K 3A0BC 1UJ8A 4IRIA 2XHKA 4XRSG 1QO0D 2RDPA 3JCUC 2CH0A 3TP0A 3K4KA 2R93J 1QVUA 2KIMA 4XLAA 3VODA 2QCOA 1R5HA 3OL3A 5ERIA 3M1EA 3V8KA 5J1YA 5HNFA 2HYGD 3RJPA 1UHMA 4I7HA 1BM9A 4LG0A 1T95A 1T33A 4CCNA 4A6DA 1OYYA 2M8EA 3BTIA 4W97A 5ICFA 1ZKGA 4AYBA 3S1NJ 1BIBA 2A6TA 1WSUA 1BIAA 3EUHA 3RPUA 4DOZA 2RC4A 2R7SA 1UHSA 1GVDA 2XKPA 4HV6A 3OOPA 4FCYA 1T0FC 1XSVA 4LIFA 3GF2A 3MD2A 5H2FC 2QWWA 2VT3A 4OAZA 3HRMA 2RN7A 4C3HJ 4L0ZB 2K4JA 2MA3A 1IF1A 4XLPF 2DA3A 2L9NA 1XGOA 4EM1A 2XSJC 1QU3A 1VQ6I 1OCOH 5TRDA 2DQRA 1IG7A 4L9VA 5DS9A 1ZGAA 1HDDC 2FBIA 1FSEA 1W1WE 2XGCA 2K85A 2CQXA 2E5NA 4FQGA 2RQQA 5FD5A 4CYCB 3OIPA 1IUYA 3JAMK 2X0LA 3AG3H 2Z2SB 4A12A 3U1KA 2F5CA
chains in the Genus database with same CATH topology
2OC6A 3CMMA 3ZCOA 1FMVA 3DTIA 2JSPA 2HVQA 3DWLE 4PFOA 4CUGA 4BE0A 1J09A 2CFOA 2HPIA 3A1YA 2VKHA 4XORA 1X4OA 3SEZA 4CCMA 2K5CA 4NUBA 4E7SA 4XLEA 4HNUA 2VQLA 1UG0A 3AKZA 4D1QA 1UAAA 2P0WA 5HLTA 3S3OA 1UELB 1BR2A 2BOLA 2VJ5A 2E5ZA 5CPRB 3D5RC 3L2WA 4BQQA 2AQFA 4U7BA 3FBNB 2V26A 2CV2A 3PSFA 3U21A 4BL0B 3VSLA 2CW8A 2FUG2 4X0GA 4RM2A 4J00A 2VASA 2RREA 3PNYA 2Q1ZB 3HG9A 4B47A 3PNVA 2XF7A 3QYFA 2CUZA 3K4BA 4LIUA 3W2AA 3ZXSA 5HVQC 2M0MA 3IUOA 1HA8A 1TZLA 3H9JA 1EA3A 1DGRM 2IS4A 3OY9A 4PSXA 4NC8A 3A2KA 2VKDA 1Z3XA 4PUSA 4BEHA 2LOOA 2HPMA 5FRMA 3PNTA 2MABA 1AA7A 3UNGC 2R7XA 2KPMA 5KCMA 3MMYB 5CQGA 1KONA 4QPOA 3H35A 2L9SA 3K70D 4BDYA 2X51A 5CYNA 4F93B 3MKWB 4B43A 4DBRA 2HU9A 3VYTB 3DKYA 4BJ6C 2F4IA 5HOOA 2IGNA 2UV1A 4R79A 4KJZA 2OUMA 2R7UA 1X1DA 1K6YA 3IAS2 2CS3A 1WJBA 2VPLA 2KL4A 2VJJA 3DQVC 2R7QA 3TBIA 2A5WA 4OAYA 4JQFA 2HVSA 1YX3A 2X1DA 3EPZA 4BQNA 3K4LA 4ZJZA 3OYAA 2X1EA 3OWTA 1W36D 2MYSA 4XN3A 3LSGA 3BCBA 4HEA2 2XAUA 4E7IA 4PJLA 2CV0A 2CW7A 2LRDA 4N4OB 2DOAA 4IX7A 1N75A 3OYKA 4BE2A 4Y3OA 4IKFA 3K70C 2F6CA 2HVRA 1TBDA 2IS6A 3A4CA 2L7KA 3OMYA 1S9HA 3VSKA 4KT6A 4Y4RA 3HOTA 3SEQA 2XDVA 4RMNA 2CMPA 4DGWB 1MNDA 3HOSA 4NBPA 1V5FA 3RTRA 2IGKA 4FASD 5KHDA 2CUJA 3S3NA 1W36C 4PJJA 3QFQA 2IGOA 3L2VA 4N4NB 4E7KA 3NWTA 3FHNA 3GBGA 1ERDA 1QHHD 4P5OA 4KW3A 2LYCA 4YEJA 4ZC3A 3DU5A 3QN2A 1E0EA 2M4GA 1D0YA 4Y33A 4FETA 3LSIA 5CQEA 3OYDA 2K9LA 3E0JB 3SZGA 4FGNA 3D5SC 4DIQA 4BJTA 4CSWA 5LD2C 3QYEA 2V9KA 1QHGA 1DGWY 2M4KA 2IF9A 3VWBA 3TL4X 3MKZA 3FBIB 4XR6A 4ZTFA 4GDFA 4XONA 3OYNA 3RPUD 1U0JA 4HNTA 3OS2A 4BDZA 2ITJA 3BC8A 5HNHA 2Z16A 4ZYAA 1JI8A 1MW7A 3F9KA 1WJEA 4BS9A 4G6TB 3S93A 1X19A 3ZGKA 2KP6A 1PJRA 2XF5A 3M1CA 4YELA 1BR1A 4XKVA 4E7JA 4XKBA 3AL0B 1WJAA 2KLOA 2LG4A 4CA0A 3VYUB 3LFUA 1G8XA 3OYEA 1MMGA 4XKWA 4XL9A 2JA2A 3PJRA 4XOPA 2JVHA 3C2HA 3CP2A 2R7OA 2E1MB 2IPRA 2QKLB 4F55A 4ZO0A 1GLNA 3DPLC 3VDXA 3PFYA 4HG2A 2XF6A 3CP8A 3K4MA 4PSWA 4BEHB 4BU2A 1PYVA 2LBFB 2GOXB 1D1AA 3OIQA 4QPQA 2UUZA 3QODA 3OYMA 3OYGA 3E1SA 3W2WA 2LY1A 3BCAA 4H4KC 3W3CA 2LBFA 3OR1C 1R6RA 2K3PA 2PMZA 3PUBA 2ELJA 3LSKA 2CV1A 1F08A 4MLOA 4XMYA 2RNGA 2ZXHA 4IQ4A 3DPTA 1D0XA 3PSIA 3H5NA 3BG6A 2R7RA 2PJRA 1X4PA 3K4JA 2XC7A 1L5IA 2MD0A 2VQCA 3OYBA 5FROA 3UR3C 3V42A 1RZ9A 4B44A 2X85A 4ITVA 2W82A 3HUGB 3OL4A 5JHFA 1WJDA 4PK4A 4J01A 1Z7LA 4LG3A 2X1CA 2DCEA 4P1WA 4KITB 3ONQA 2KDOA 1R9WA 3W2VA 3L2UA 5TGTA 2O5RA 4KISA 2IS2A 4AU7A 2R7WA 2V6EA 2W00A 3HPGA 4BUPA 3C2GA 1LFPA 2I8DA 3OS1A 1VZ0A 1WJFA 2MFZA 4II3A 1X1BA 3S3MA 4PJMA 4XLHA 2VLAA 3OYHA 4E7LA 3DPUA 3LSMA 1Z3YA 3K6GA 2VIXA 4NNJA 2IXSA 1LKXA 3CJRB 1SFKA 2WAEA 2JUGA 4XNFA 4BE1A 2WY8Q 4U87A 2BW3A 2LY2A 1WJCA 2AQEA 4XM3A 3K10A 2E60A 2FUFA 2VB6A 1TT0A 1Y56A 1MNEA 3FKJA 1WFXA 2VQGA 5FRNA 3RCOA 4PFPA 2DT6A 2E1MC 3CJQB 3SDBA 3J7AY 1LVKA 1IRXA 2WBMA 3TMOA 2LH9A 3LMMA 4C30A 2Q2EB 4HPQA 1SAUA 4NC7A 4BQOA 4DJAA 1Y6IA 3KEYA 4OWRB 3ZR8X 4CH7A 4DBQA 4BACA 2UWMA 2K9MA 3H9GA 2QKMB 2VQHA 2KMUA 2BVLA 3RQ4A 3OYCA 3S8PA 4ZTJA 1MMNA 4RLFA 4EATA 2VJIA 4CCLA 3H5AA 2F5VA 2L5QA 1L2MA 1X1AA 2WB1A 2KZVA 3L2QA 3H0DA 4RLQA 3CF2A 2DT7B 4IQJA 4B48A 4XLCA 4D9JA 2VXZA 3QOEA 2HW0A 2WADA 1N77A 2HZDA 1D1BA 3DEEA 1D0ZA 2Y0SA 3EUKL 2W7NA 4F91B 2KHMA 2NOJB 4HSRA 1P9QC 4RM3A 4C9YA 4ZQ9A 4BXFA 1V5GA 2V7FA 4E7HA 2M3AA 1DP3A 2VJ4A 4HRIA 4XOTA 3EUHC 1MMDA 2M7BA 3VYRB 3H5RA 2L2OA 2WA0A 4LIVA 2TBDA 1YX5A 2ZXIA 2R4GA 2WY7Q 2HNHA 3I9V2 3RSNA 2X6YA 3AFHA 3HC7A 4E7ZA 2NTCA 2WAFA 3QYBA 4XN0A 3PL8A 2PJRB 1DQUA 1D1CA 2GOMA 4ZDLA 2V1NA 1X1CA 2V4JC 2X6XA 1NG7A 3OS0A 4FB3A 5LFAA 3OYIA 3N05A 2X6WA 4HSTA 3HXLA 3K4NA 3OR2C 2DJIA 3IAM2 3FDYA 2VXDA 4CCJA 2BVMA 3CESA 3KYLA 2R7TA 4AVZA 4YRVA 3OYLA 4JOMA 4LMDA 4C2TA 3M8JA 4C2UA 1M55A 3DU6A 1BR4A 4CZCA 4ZDPA 2NL8A 2JVGA 3LL7A 5BYGA 3K4CA 3OYFA 4NQWB 2R7VA 5DCXA 2OV7A 2LREA 5D9IA 1ZELA 2W4SA 2MC4A 4PJNA 3VYSB 3OOUA 4F3QA 1WJ5A 4BJ5C 3IP4B 4F52A 5CKTA 4ZDOA 1KSYA 1UUTA 4GRIA 2BW3B 4CCOA 2ITLA 2CH0A 3SYTA 3K4KA 4LITA 4XLAA 4E6KG 3H9QA 1LDKB 3OL3A 5HNFA 3LSHA 3AL0C 1OR7C 4XLFA 1T95A 4CCNA 3QK2A 3MKYB 1FMWA 2HDWA 2KRHA 4AYBA 4BGDA 1G59A 2A6TA 2Z1DA 1NG6A 3DLAA 2ZSIB 4XKCA 1YE9A 3EUAA 3KX2A 4DOZA 3G2BA 2W1OA 2DXIA 2R7SA 2HQAA 3L2RA 3DKXA 1V5EA 3OYJA 1BOBA 1T0FC 4E4HA 1Z1DB 4LIFA 3BG7A 1N78A 3MD2A 2WAQA 3HPHA 4OAZA 2VL8A 4IZZA 2KQRA 3DTEA 5KNLA 2L9NA 1MMAA 3ZQQA 1Z21A 2XSJC 3HKZA 1QU3A 3D5LA 4CCKA 1KSXA 3HL2A 3BLYA 3I3LA 4II2A 2IGMA 4F92B 2ZFUA 3DTKA 3S32A 4XQFA 2E5NA 2RQQA 3OIPA 3ZRGA 4ANJA 2M7AA 1OLTA 2Z2SB 2KRCA 3CZ6A 4B3XA 2IS1A 3NWSA 2ZSHB 2LC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKX A;  3DKY A;  4U87 A; 
#chains in the Genus database with same CATH topology
 2H09 A;  1D5V A;  3S1M J;  3HIF A;  3LSP A;  1FMV A;  5FLX K;  3DTI A;  2HTJ A;  4XSZ F;  2HVQ A;  1AU7 A;  4AD9 A;  4PFO A;  1XSD A;  1KU3 A;  1J09 A;  3A1Y A;  1U6G A;  2QUF A;  2VKH A;  1ETX A;  1TBX A;  3PO3 J;  1L3L A;  4O6J A;  2KIS A;  5L3E A;  4I99 C;  4EMS A;  1MIJ A;  2VC0 A;  3T5X A;  4NUB A;  4ESB A;  4UV9 A;  3BY6 A;  4XLE A;  4E7S A;  5LHH A;  1UG0 A;  3AKZ A;  4D1Q A;  2CW0 F;  3D5R C;  3L2W A;  2XB0 X;  3KYD B;  3FBN B;  4I6Z A;  2V26 A;  3JRF A;  2KZG A;  3U21 A;  1XN7 A;  4CZZ A;  5F0H A;  1HKS A;  2CW8 A;  3LAP A;  2FUG 2;  1T39 A;  4J00 A;  2STW A;  2E7W A;  3BR0 A;  5CVR A;  3LQR A;  2CUZ A;  3K4B A;  2IVM A;  4LIU A;  1TWF J;  5J8C A;  5HVQ C;  4MIM A;  2VE9 A;  2DFI A;  3H9J A;  1EA3 A;  3M07 A;  1FIA A;  2EFP A;  4BXU A;  3BG9 A;  1WZ2 A;  3M8E A;  1ZH5 A;  2VOD A;  4BEH A;  2ESH A;  2LD5 A;  2DDA A;  5L3B A;  3G1L A;  5EZG A;  1A36 A;  1QQI A;  1A6Q A;  3H3Z A;  3ZN0 A;  3FMR A;  2DMU A;  2MAB A;  5ICC A;  1AA7 A;  3CDI A;  4FTH A;  1HW5 A;  4QPO A;  3H35 A;  1SFO J;  4HA8 A;  4M3F A;  3K70 D;  2QGU A;  4C3J J;  4I2O A;  3MKW B;  1Y39 A;  2HU9 A;  3DKY A;  3W6V A;  2IGN A;  3FMQ A;  3KP7 A;  4KJZ A;  2R7U A;  1FWZ A;  2FRH A;  4XBF A;  2CS3 A;  1DU0 A;  2VI6 A;  3TBI A;  1AHD P;  5F08 A;  4EV0 A;  4HX4 A;  4JQF A;  1YG2 A;  2GXA A;  2JQ7 A;  1OCR H;  2VC1 A;  5GPA A;  3GFI A;  1Z67 A;  3EPZ A;  3OYA A;  4HLY A;  1B8I A;  2MYS A;  2V6C A;  3LSG A;  2M8G X;  3BCB A;  4E7I A;  3JSO A;  2ZNZ A;  2GIZ A;  3HUG A;  5E8I A;  1HLV A;  1HC8 A;  3BOQ A;  4DQ2 A;  4KA4 A;  1ZRE A;  1XS9 A;  1ON2 A;  4M9S A;  1I27 A;  4LFU A;  2D1H A;  3K70 C;  4A93 J;  2DMP A;  1IN8 A;  2L7K A;  3KIO A;  1S9H A;  4L18 B;  2R92 J;  3BDD A;  4KT6 A;  5EG0 B;  3SEQ A;  1FBQ A;  1N25 A;  2GA2 A;  3LST A;  2HOS A;  1G3Y A;  1FOX A;  4KIB A;  5EYR A;  4V2G A;  2CMP A;  5DCF A;  4ESJ A;  1V5F A;  4A6E A;  3S1Q J;  3ZQF A;  2A07 F;  5EG0 A;  5JHU A;  1ZRD A;  4DNC A;  3L2V A;  4N4N B;  4EJT A;  3GBG A;  4P5O A;  4IXA A;  2HKO A;  4KW3 A;  3F8M A;  3F6V A;  2JZY A;  2XPV A;  2EV6 A;  5FD6 A;  5LBQ A;  5J1U A;  2DO7 A;  1U3E M;  1WKM A;  1JKQ C;  3SZG A;  3LA2 A;  1JKP C;  1KU7 A;  4BJT A;  4CSW A;  4FGN A;  3HB9 A;  1Z7U A;  2KIQ A;  2L3D A;  4LLG F;  2FNA A;  2AXT C;  2V9K A;  5M5Y J;  1QHG A;  1DGW Y;  5D6F A;  3S14 J;  2XRN A;  1B1B A;  4GDF A;  1O7L A;  2HXO A;  3OYN A;  3RPU D;  2O3F A;  1RI7 A;  2TRT A;  4BDZ A;  5HNH A;  2FQ3 A;  3ZN1 A;  4PDK A;  1J9I A;  3HSF A;  4BS9 A;  2QEX I;  1XSX A;  4G6T B;  3HOZ J;  3J7A O;  2KP6 A;  4M9Z A;  3WTZ A;  1B6A A;  3QPS A;  1QZZ A;  4P9F A;  3ROU A;  4IO9 F;  4YEL A;  3J80 Z;  1ENH A;  1FOY A;  4IHW A;  4M3B A;  3FWE A;  2WWY A;  2YPR A;  2ESN A;  3KZI C;  1FZP B;  4QSH A;  3LFU A;  2JRT A;  4KMU X;  1YYV A;  1AKH A;  3ZMU A;  4XL9 A;  5IT9 K;  1GV2 A;  1BJZ A;  2JA2 A;  3PJR A;  1G3T A;  4XOP A;  5H6Q A;  3CP2 A;  2DLL A;  1ZR4 A;  2E1M B;  1VQK I;  3BG5 A;  2IPR A;  1XDS A;  3JRC A;  2K27 A;  2Y9Y A;  4F55 A;  3VDX A;  4DZJ A;  5HLG A;  1KU9 A;  1T56 A;  1MJ9 A;  3Q9V A;  5IOY A;  1U9O A;  2GOX B;  3G6E I;  2LNB A;  2MH2 A;  2BXY A;  2F5F A;  3O8H A;  4D5C A;  1R23 A;  3GFL A;  3E1S A;  5BMZ A;  2R5Z B;  2NNN A;  2QA4 I;  5JFR A;  4KN7 X;  1YI2 I;  2RAE A;  2E2I J;  2DA6 A;  1HDP A;  4MHG A;  3OR1 C;  3HJE A;  3DP7 A;  2PMZ A;  3HRS A;  2CV1 A;  2LDU A;  2KIF A;  4XMY A;  5AON A;  1R4M B;  3MFK A;  1YIT I;  2XPU A;  4G7H F;  4GXO A;  4RS8 A;  2H27 A;  4RGS A;  2XRO A;  3CME I;  3S2W A;  5LGT A;  2STT A;  2PJR A;  3GEZ A;  2MD0 A;  2IEK A;  4O5V A;  1JT6 A;  4XRF A;  1BBY A;  2V1D A;  4TV7 A;  3V42 A;  4AIJ A;  3JAM Z;  3BJ6 A;  1VQ4 I;  3BQZ A;  3GTJ J;  1BA5 A;  1KQ9 A;  3R0J A;  4A3E J;  4ITV A;  3JR9 A;  2W82 A;  4MO7 A;  2PFB A;  2Z33 A;  4A3K J;  5JHF A;  3MN2 A;  4MFE A;  4PK4 A;  3WGH A;  1TC3 C;  2VPR A;  5FKK A;  2DCE A;  2EPF A;  5IP6 A;  1ZGJ A;  4M3G A;  2NVX J;  2KDO A;  2P6S A;  2E2H J;  5FLX Z;  2ZB9 A;  5TGT A;  1IV6 A;  2F2E A;  2IS2 A;  3PIO F;  3CO7 C;  4EGY A;  3TW7 A;  3HPG A;  4RDU A;  5LRR A;  1I39 A;  1WJF A;  3KLN A;  1U8R A;  2XAJ A;  5E3O A;  1FYK A;  3F6O A;  3OYH A;  3LSM A;  4IL6 C;  4LOC A;  1VQM I;  4WX9 A;  3SQN A;  1LKX A;  2FOK A;  3GTQ J;  2QYO A;  2VKV A;  3SXY A;  1LQ1 A;  1ZYR F;  1L0O C;  4BYY A;  4N9I A;  1FTT A;  4ENM A;  5A2Q K;  2P5L C;  2B7E A;  4Y13 A;  2BW3 A;  2AQE A;  2HQR A;  2E60 A;  2MG4 A;  4ON0 A;  2FUF A;  2VB6 A;  2Q0O A;  4P55 A;  4UY8 I;  1WFX A;  2VQG A;  3GFM A;  5E1W A;  3LA7 A;  2V9V A;  3RYP A;  2OJE D;  1SMT A;  1LVK A;  1IRX A;  2WBM A;  1QGP A;  4M72 A;  2FU4 A;  4M6V A;  4BQO A;  1I1S A;  2BYV E;  2ISY A;  4LLL A;  3BTJ A;  4DJA A;  1XX5 A;  4HX7 A;  4BAC A;  1K7A A;  1QVT A;  2D5V A;  3BP8 A;  2K9M A;  2VQH A;  3S8P A;  1MMN A;  3WTU C;  5H6R A;  4R8H A;  2VJI A;  2F5V A;  2L5Q A;  1L2M A;  2L4M A;  4UUS B;  1FNN A;  1AOY A;  1XMX A;  2WB1 A;  2VOO A;  2KDZ A;  2K7L A;  5D5V B;  2JMW A;  5H20 A;  1MBG A;  1BJA A;  1UB9 A;  4IQJ A;  3I64 A;  4XLC A;  3FXM A;  4UUS A;  3QOE A;  1WH5 A;  2PBI A;  3PUF A;  4G6Q A;  1RIO H;  4AM3 A;  1D0Z A;  1R58 A;  4ENN A;  4UVB A;  5GTH C;  2GA1 A;  4A5N A;  2GXG A;  2KHM A;  4RM3 A;  4IHT A;  1UCR A;  2HTS A;  4M73 A;  2M3A A;  3FM5 A;  3TOA A;  1JJ6 C;  1B4A A;  4HNV A;  2JUC A;  2QQB A;  4M74 A;  1W4M A;  3VYR B;  3ZMS A;  3GZ5 A;  4S04 A;  1LEB A;  2WA0 A;  3V4G A;  5K1Y A;  3K7A J;  1R49 A;  2R4G A;  3GVA A;  3ABM H;  3GWZ A;  1J2X A;  1A35 A;  3UKG A;  4ZZD A;  2HNH A;  3RSN A;  5J1R A;  3QQA A;  3MZH A;  1IXC A;  1O57 A;  3AFH A;  2NTC A;  2X9D A;  2EFQ A;  4IOA F;  2K4B A;  3AG1 H;  3ZMZ A;  3JTG A;  3ERM A;  4A2U A;  1X58 A;  2GOM A;  3B6C A;  4ZDL A;  2O61 A;  1U5T B;  1X1C A;  2CYY A;  2V4J C;  2GIV A;  4A3F J;  4FB3 A;  3WTW C;  3BPX A;  1RZ4 A;  1XMK A;  3OR2 C;  5J6X A;  3IV5 A;  2W48 A;  5J47 A;  2FNP A;  3FDY A;  1U5T A;  4ZYE A;  1JUM A;  2L01 A;  2BVM A;  3CES A;  5CLS A;  1FX7 A;  4AVZ A;  5DD8 A;  4YRV A;  1BOA A;  4HDV A;  3IRQ A;  3AG2 H;  3M8J A;  5JI6 A;  5JLX A;  1M55 A;  1OQY A;  4C3I J;  1SFE A;  4HF0 A;  1ZG3 A;  3IH4 A;  2PLY A;  1ODD A;  2JVG A;  4DYC A;  5DCM B;  1J7K A;  1ETO A;  1OJL A;  1ZEL A;  2W4S A;  1JGS A;  2MC4 A;  3ELK A;  4PJN A;  4P9U A;  3JSP A;  1RRJ A;  3R61 A;  4Y17 A;  4F3Q A;  2YU9 J;  2WV1 A;  3BWG A;  1UUT A;  3BR6 A;  3DFG A;  1GXQ A;  1S7O A;  2ITL A;  4PGG A;  2FA5 A;  2DA4 A;  5EEG A;  1LDK B;  3FXJ A;  1CGP A;  3IWZ A;  1F9N A;  2FOW A;  3VPR A;  1JJ8 C;  2H1K A;  5IT9 Z;  4XLF A;  2ZXJ A;  3FHZ A;  4U88 A;  3QK2 A;  5LHI A;  1SEU A;  1R9T J;  1MSF C;  2KRH A;  2HOA A;  3VEP A;  1NG6 A;  4ZYG A;  2ZSI B;  5CVJ A;  4RAF A;  1B72 B;  3KX2 A;  2EA4 A;  3H3U A;  4BNC A;  3TO6 A;  5DM7 F;  2KJC A;  2R3S A;  2XV4 S;  4IJA A;  1V5E A;  1BOB A;  2XIG A;  1CQT A;  3O3K A;  1HKT A;  2WAQ A;  1DDN A;  1BI0 A;  3TQN A;  3HPH A;  1USS A;  3V8L A;  1G3W A;  3F72 A;  3ECH A;  4AC0 A;  3DTE A;  2QQ8 A;  4G7Z F;  2IA2 A;  1Z21 A;  3G1O A;  4X6A J;  2ZME A;  4WWC A;  2M0C A;  2R5Y B;  2G7H A;  1KSX A;  1RKT A;  3HL2 A;  1JUS A;  5D8K B;  2E2J J;  1H89 C;  1FP2 A;  1Q1H A;  1SD7 A;  3DTK A;  4IPA A;  1GDT A;  1J59 A;  5C44 J;  2H8R A;  2HYF A;  4BKX A;  2R5Y A;  2M7A A;  2O6G E;  4B3X A;  1EH8 A;  1WI9 A;  3NWS A;  2ZSH B;  2LC2 A;  2DOF A;  4A69 C;  5EEA A;  3CMM A;  2M30 A;  4YFK F;  1JKO C;  3I55 I;  2P8T A;  5IY5 H;  2G9W A;  4BHP A;  2JSP A;  3DWL E;  4ZZL A;  1MD0 A;  1RC9 A;  2R7F A;  2Z3Y A;  1LJ9 A;  1X4O A;  3FF5 A;  4L5J A;  4CCM A;  2Y9Z A;  5FJ8 J;  1C0W A;  4A3G J;  2K5C A;  2ME0 A;  5FLV A;  4HNU A;  4D5F A;  2L4A A;  2QLZ A;  1BI1 A;  3HGY A;  4B1R A;  5HLT A;  2IT0 A;  1BR2 A;  2BOL A;  2GZW A;  2VJ5 A;  5E3L A;  1MBJ A;  3BZ6 A;  2VBY A;  4U7B A;  3M9A A;  5BNG A;  4WXC A;  5AIQ A;  2CV2 A;  4BL0 B;  5A2Q Z;  3GTM J;  4V2F A;  4A3B J;  4OMY A;  4X0G A;  3LWF A;  2H6C A;  1OR7 A;  2VAS A;  2Y69 H;  2Q1Z B;  2ZJ2 A;  1S72 I;  4LK0 F;  2BXZ A;  3HG9 A;  3PNV A;  3HOX J;  2MW8 A;  1O4X A;  1F1Z A;  2GM4 A;  1NHA A;  2V1X A;  9ANT A;  4XSX F;  1JGG A;  4Y15 A;  1TZL A;  3PQK A;  1ULY A;  1H8A C;  2BZT A;  3R0A A;  1Z77 A;  2VKD A;  2ZCW A;  1VQO I;  1G3S A;  2XAG A;  5HLH A;  3H92 A;  1J5Y A;  3MAJ A;  2LOO A;  2F5E A;  4BH9 A;  4JX5 A;  1D3Y A;  1MH3 A;  2HDD A;  2HWV A;  1KQ8 A;  5KCM A;  3MMY B;  3A03 A;  5CQG A;  4G9Y A;  2W24 A;  1YQA A;  1IRF A;  3L9F A;  5IP7 J;  4MQV A;  2X51 A;  4F93 B;  1T38 A;  4DBR A;  1HF0 A;  1E2X A;  4D7N A;  2F4I A;  2PMH A;  4R79 A;  3U1D A;  2OUM A;  1X1D A;  5FFX A;  4YIR X;  1LUJ B;  1RR8 C;  1T98 A;  2VJJ A;  3DQV C;  2A5W A;  3GTO J;  2P4W A;  2EIN H;  5B1B H;  2HVS A;  4GCV A;  4BQN A;  2P5K A;  2X1E A;  3OWT A;  1SFX A;  3HHH A;  5HS8 A;  2CW7 A;  2LRD A;  2GQQ A;  2DOA A;  2EZL A;  2KJB A;  4KYW A;  3CO6 C;  1WCM J;  1N75 A;  1IUF A;  1F4K A;  2F6C A;  2ICW G;  3CUO A;  4YG2 F;  5J8F A;  1YS6 A;  3CD6 I;  2OZ6 A;  3ZP5 A;  1QRY A;  3HOT A;  2XDV A;  5KAF C;  1J0R A;  1UG2 A;  2DA2 A;  4RMN A;  4Y52 J;  4DGW B;  1SD5 A;  1MND A;  4UB6 C;  4NBP A;  5BPD A;  5CJ9 A;  1NH3 A;  3P9I A;  1K4T A;  4FAS D;  4EM0 B;  5KHD A;  1BC7 C;  2RKH A;  4PJJ A;  5IP9 J;  2DOE A;  2P5V A;  2NXN B;  3ZQH A;  4L9T A;  3NWT A;  3E5X A;  1ERD A;  1FOW A;  4YEJ A;  1U5T C;  4BQA A;  4OIQ F;  2EFO A;  2RVC A;  3HRT A;  4IHS A;  2M4G A;  2O8K A;  3JRG A;  4FET A;  4BAY A;  4UB8 C;  1X2M A;  2DFF A;  3OYD A;  3E0J B;  1HQC A;  3D5S C;  1FBS A;  4A5M A;  4UUV A;  5FGM A;  1SVL A;  3P9C A;  3SHF A;  3E6D A;  2ZJQ F;  4KT5 C;  2M4K A;  5TJJ A;  4DYQ A;  5LHG A;  2JA8 J;  2L7M P;  2IF9 A;  3TL4 X;  1P7I A;  1RNL A;  4RA2 A;  1K61 A;  2I5U A;  5EGO A;  4GFB A;  4M9X A;  1YW8 A;  2VBZ A;  1U0J A;  1SMY F;  3VOE A;  3L00 A;  4HNT A;  3CCR I;  2ITJ A;  2Z16 A;  4ZYA A;  1KZH A;  1K6O A;  1JI8 A;  5B66 C;  1MJB A;  1FT9 A;  3S93 A;  3ZGK A;  1P6R A;  2XF5 A;  3WTY C;  4E7J A;  3AL0 B;  1OYI A;  2JT1 A;  4A0Z A;  1I6X A;  2KLO A;  2Y75 A;  3KFW X;  1G8X A;  4UVA A;  3E5Q A;  4PZJ A;  2YX7 A;  2LTP A;  3IKT A;  3BJO A;  2E19 A;  3KP5 A;  1WQ2 A;  2E1N A;  1TWH J;  1MJA A;  2QKL B;  4AYB N;  2ID6 A;  2XF6 A;  3LSR A;  4BEH B;  3ASO H;  3SJM A;  1PYV A;  1MKM A;  3H36 A;  1LE8 B;  4LK1 F;  2XGX A;  4IF4 A;  3ABK H;  2M34 A;  3MWM A;  3JRI A;  3BPV A;  1OCC H;  3OYG A;  1R36 A;  2LKX A;  4LGW A;  5DDG A;  3E3V A;  3W3C A;  1LE8 A;  1R6R A;  2K3P A;  3JW4 A;  2ZME C;  2ELJ A;  3PUB A;  1KYW A;  4JP0 A;  4MLO A;  1V3F A;  2XGE A;  1RR7 A;  2ZXH A;  3KET A;  5ILV A;  3DPT A;  1D0X A;  3RI4 A;  2H8W A;  2EB7 A;  2IW5 A;  1B9N A;  2QSF X;  3E97 A;  1WGX A;  2R7R A;  4KIC A;  1X4P A;  3C18 A;  3W6K B;  1B8I B;  3CMA I;  5IYC J;  1FPQ A;  4B09 A;  4DW6 A;  3S1R J;  1TL8 A;  4EEF G;  3HUG B;  3OL4 A;  2QZ8 A;  4IRG A;  1Z7L A;  4J01 A;  3W6J B;  3EYY A;  5D8L B;  1SAN A;  4P1W A;  4QTR A;  4KIT B;  3CCM I;  3ONQ A;  3B02 A;  1U8B A;  3WTV C;  2ZJR F;  3C2G A;  1LFP A;  5BOX A;  3HTU A;  2I8D A;  3GUD A;  5J4Y A;  3HRU A;  1FBU A;  4CGZ A;  1X1B A;  3S3M A;  3T8R A;  2VLA A;  2PJP A;  3DPU A;  3A02 A;  3ASN H;  3K0L A;  2DAO A;  5HDN A;  2MBF A;  4NQW A;  2DPU A;  4NNJ A;  2FML A;  4EJO A;  1EH6 A;  3CJR B;  3TED A;  2CWE A;  4S05 A;  1LB2 A;  3CDH A;  2FF4 A;  2JUG A;  1APL C;  2DBB A;  3KZZ A;  5IOZ A;  3CLO A;  4XNF A;  1QNT A;  3CUQ A;  2BV6 A;  3I4M J;  2LY2 A;  4XM3 A;  3QAH A;  1TT0 A;  1E3O C;  4X1E A;  1X3W B;  3ZMV A;  4M6Y A;  2FSW A;  1H9G A;  1Y8Q B;  3FKJ A;  5FRN A;  2FXA A;  1SVO A;  1VFC A;  2DT6 A;  4KIG A;  1H9T A;  3S15 J;  4A3I J;  3BR3 A;  2DMQ A;  3Q3S A;  2Q2E B;  3GZ6 A;  1HCR A;  1SVM A;  1A04 A;  1ETK A;  5FKM A;  4M71 A;  1LVA A;  1Y6I A;  4CH7 A;  5F04 A;  4CYD A;  3S17 J;  2UWM A;  5K5Q A;  2LR8 A;  3BTC A;  1YJN I;  1ETW A;  1FIP A;  1YW7 A;  2BVL A;  2KMU A;  4LD5 A;  1LEA A;  5DUK A;  4ZTJ A;  2Q2E A;  3KEO A;  2IA0 A;  4CCL A;  1X1A A;  1VND A;  1OPC A;  1U9N A;  2E7X A;  4KUM A;  3ZQG A;  1EJ9 A;  2KIU A;  2ID3 A;  2KZV A;  3ABU A;  3I5U A;  3H0D A;  1R1V A;  1AKH B;  2CQK A;  2KRF A;  3AAF A;  2QSH X;  4B48 A;  1PUF B;  2ZXW H;  2Y2Z A;  2VXZ A;  2E71 A;  1G6N A;  3F0C A;  3RYR A;  2HZD A;  4DYR A;  1YW9 A;  2WV0 A;  1MZB A;  5L3C A;  3WG7 H;  5LEK A;  1HW1 A;  5FLM J;  1PUF A;  2QVO A;  4F91 B;  2MC3 A;  3KZY A;  3QP5 A;  2NOJ B;  1TQM A;  4HSR A;  4BXF A;  2YSR A;  1I1G A;  2V7F A;  2XRL A;  2VON A;  2VJ4 A;  3I0T A;  2CFX A;  2FMY A;  2OTL I;  5JVT A;  3EUH C;  1LDD A;  2M7B A;  2KFD A;  3H5R A;  2L2O A;  5D5W B;  4LIV A;  1XG1 A;  2F5D A;  1X1P A;  2ZXI A;  3ABL H;  2A68 F;  3GO5 A;  3WHB A;  2PEX A;  1JE8 A;  2VT2 A;  2X6Y A;  4YII A;  4JBA A;  2LKP A;  1YJ9 I;  3I71 A;  3CQZ J;  3QYB A;  4XN0 A;  2PJR B;  2ECB A;  1D1C A;  2PMU A;  5D5X B;  1WPK A;  5F1R A;  2V1N A;  2C6Y A;  3ZQ7 A;  3HTS B;  1ETQ A;  3OS0 A;  1IRZ A;  4KNY A;  1Z0X A;  4PGH A;  3OIO A;  2Y0M A;  3OYI A;  3Q0U A;  2JA6 J;  4HST A;  3K4N A;  2DJI A;  3FM3 A;  3E6M A;  2DYR H;  2NAZ A;  3TW6 A;  2JWT A;  4NDL A;  3N97 A;  4HYE A;  2OPT A;  1GUU A;  5JR3 A;  1XD7 A;  2COB A;  4UUT A;  2DN0 A;  1MBK A;  2QBY A;  2DOD A;  1BW6 A;  4HF2 A;  2IP2 A;  1GT0 C;  1TP4 A;  5FKO A;  5E3M A;  4CZC A;  1BN5 A;  3LL7 A;  3A01 A;  4ENK A;  3K4C A;  2LVS A;  2EBI A;  2I10 A;  1PUE E;  3KP4 A;  4WF2 A;  1WJ5 A;  2EWN A;  4BJ5 C;  4KIF A;  5CKT A;  1KSY A;  3ZMD A;  1W5T A;  2BW3 B;  2TCT A;  2XB5 A;  3SYT A;  1U78 A;  2L7Z A;  4LIT A;  1TLH B;  4E6K G;  3H9Q A;  1BI2 A;  4YFN F;  5DUI A;  1R5G A;  4RGU A;  3S2H J;  3AL0 C;  4KN4 X;  4NB5 A;  4G6D A;  2IA1 A;  4HDU A;  1AWC A;  4C2M J;  3AG4 H;  2BY3 A;  3FXQ A;  4BGD A;  3LQQ A;  5F27 A;  4U7D A;  3DLA A;  2QM3 A;  4O3M A;  4KMF A;  4XKC A;  1IRG A;  1OIS A;  4ASN A;  5J4V A;  4S0H B;  3EUA A;  3WE2 A;  3TDZ C;  1E3P A;  3M8F A;  5L3D A;  3TGN A;  3L2R A;  2J5P A;  3DKX A;  3QPL A;  5CVU A;  1KYZ A;  3OYJ A;  2CJJ A;  1R00 A;  2ZC2 A;  1Z1D B;  5GTI C;  3BG7 A;  4QLC U;  2QQ9 A;  1QPI A;  1ZLK A;  1BL0 A;  3BQY A;  4IZZ A;  1FY7 A;  2VL8 A;  5IPA A;  2P7V B;  3KP6 A;  4L9N A;  2PMZ N;  5KNL A;  1OKR A;  3ZQQ A;  3HKZ A;  3TKY A;  1Z1D A;  2YX4 A;  2FBH A;  3V7C A;  3OSF A;  2MH9 A;  3BLY A;  2QSG X;  3I3L A;  4U0W A;  2IGM A;  4F92 B;  3CC7 I;  4IHV A;  1TWG J;  2N8G A;  3ZRG A;  2HDC A;  5GPC A;  2LMD A;  4A3J J;  3CZ6 A;  1OLT A;  3FKI J;  3DKW A;  3DEU A;  4ZH4 F;  2RV8 A;  3GME A;  2OC6 A;  2O9L A;  5CYV A;  1XCB A;  1WVR A;  3JRE A;  2NOG A;  3ZCO A;  2FE3 A;  3BRO A;  3KCC A;  4RAG A;  3CC4 I;  1F43 A;  5DTD A;  4CUG A;  5ED4 A;  1JTY A;  2OA4 A;  2HPI A;  2FX0 A;  4XOR A;  1TWA J;  1RPW A;  1R7J A;  2VQL A;  1ZN2 A;  2F4M B;  2B9S A;  3CDL A;  1UAA A;  2FEZ A;  5BS6 A;  3JRD A;  3I4P A;  4JYK A;  3CMY A;  3CCU I;  3EDP A;  4YIF A;  2E5Z A;  2OF7 A;  5CPR B;  2OTJ I;  3MCZ A;  1XGM A;  4ESF A;  2G0E A;  3SZP A;  2E34 A;  1TT5 B;  3I56 I;  5ICG A;  1X3U A;  3IKV A;  4I98 B;  1MMS A;  3HYI A;  2RRE A;  5IT3 A;  3PNY A;  2V1U A;  2MLK A;  2H94 A;  5EZH A;  4B47 A;  3QYF A;  3NAR A;  3H0G J;  3ZXS A;  3BJA A;  2M0M A;  1UFM A;  3IUO A;  1HA8 A;  3FXK A;  2O03 A;  2OD5 A;  1DGR M;  2IS4 A;  3OY9 A;  4MTE A;  4FT8 A;  4I76 A;  5LLQ A;  3CF5 F;  4Q48 A;  2EIM H;  1ZHF A;  2HPM A;  3L2C A;  2O0Y A;  2EFW A;  5FRM A;  1KA8 A;  3KE2 A;  5GP9 A;  4CDG A;  2KPM A;  4RB0 A;  3J7Y J;  4I01 A;  1KON A;  2VKE A;  2O7O A;  2R0Q C;  2L9S A;  2E1C A;  4BDY A;  1OCT C;  1ONV A;  1B9M A;  3OV8 A;  2H6B A;  1EF4 A;  1TWC J;  2AHQ A;  3DBR B;  5HOO A;  4XRM A;  3CJN A;  2UV1 A;  3CC2 I;  5C3E J;  1M1E B;  1K6Y A;  5HS7 A;  3ML6 A;  1QZE A;  1Y1W J;  2R7Q A;  3I58 A;  4QWQ A;  4OAY A;  1K83 J;  2XKO A;  2VBX A;  1IAW A;  1YX3 A;  2X1D A;  1E3H A;  3HDD A;  2AXL A;  3K4L A;  1S7E A;  3T1B A;  1W36 D;  1S8N A;  4HAM A;  4XN3 A;  1B59 A;  1IN6 A;  1RES A;  1W0T A;  3FXL A;  4BY7 J;  2ZJP F;  3KPH A;  4ZYH A;  2IAI A;  3LFK A;  3Q0W A;  4N4O B;  4IX7 A;  3QPT A;  3G71 I;  3OYK A;  1K4S A;  3FK7 A;  3K1N A;  4BE2 A;  4HQE A;  2VE8 A;  2Y30 A;  3V8J A;  1TBD A;  4MGR A;  2HI3 A;  3A4C A;  1FP1 D;  2HS5 A;  2COM A;  3CCQ I;  3N4M A;  2GBY A;  3ERE D;  3VSK A;  2DFE A;  5E79 C;  2CQN A;  4Y4R A;  3TO9 A;  2NNY A;  1UHW A;  2ZME B;  1Y1V J;  2HKX A;  1UZC A;  3TP3 A;  4HOB A;  3SFZ A;  5F0F A;  1QBJ A;  5J40 A;  3HOS A;  1Y8R B;  3RTR A;  2IGK A;  3LAJ A;  2M87 A;  2CUJ A;  1W36 C;  3BG3 A;  3ZPL A;  3J7Z I;  3H1C A;  2IGO A;  5LRS A;  2YR2 A;  4E7K A;  1G2H A;  4HV5 A;  4BHC A;  2P6T A;  3WTT C;  4ZC3 A;  3DU5 A;  4NC6 A;  3KEQ A;  2HYJ A;  1IN7 A;  2XUB A;  2DA1 A;  5CQE A;  4CO8 A;  1R22 A;  5D4R A;  1DP7 P;  1P4X A;  4EJU A;  1S7A A;  5GAH J;  2BBY A;  3KP3 A;  3RIR A;  1ZRC A;  3QYE A;  5D4S A;  4UNO A;  3VWB A;  3MKZ A;  3FBI B;  1V54 H;  2PX9 A;  2HQN A;  3JRA A;  4ZTF A;  3U2R A;  1ZQ3 P;  2MSY A;  3OS2 A;  1JTX A;  4MEX F;  4HF1 A;  4XK4 A;  3E6C C;  2ECC A;  1EV7 A;  3F9K A;  1WJE A;  1U2W A;  2IPQ X;  2NS7 A;  2OZU A;  3NEU A;  3K69 A;  2V9P A;  3M1C A;  1QPM A;  3NQO A;  2OCC H;  2JK3 A;  2JSC A;  4IHY A;  5ICE A;  4XKB A;  1WJA A;  3M7G A;  5E20 A;  1K78 A;  4CA0 A;  3Q0V A;  1P4A A;  2FQ4 A;  2E35 A;  2P81 A;  1SAX A;  1MMG A;  4ETS A;  2BGC A;  5E18 F;  1PP8 F;  2JVH A;  3C2H A;  1XB4 A;  2R7O A;  4J19 A;  2D1V A;  2DTZ A;  3CCV I;  4ZO0 A;  1SD4 A;  2CU7 A;  2L7F P;  3DPL C;  5C4X J;  4HG2 A;  1YIJ I;  4PSW A;  3GTL J;  1IW7 F;  1O3T A;  3GLX A;  2A5Y B;  3OIQ A;  4QPQ A;  5M3M J;  2HGC A;  1YIO A;  2UUZ A;  3QOD A;  3WGI A;  2JPC A;  2M1B A;  2XVC A;  3W2W A;  2LY1 A;  1W7P B;  1Z05 A;  5AIP A;  1IGN A;  2QEN A;  2WAQ N;  1ACI A;  4BY1 J;  3MVP A;  4GO1 A;  4UXN A;  4B8X A;  3V7R A;  4ENJ A;  5FKL A;  1XGN A;  2FJ1 A;  2RNG A;  4JK1 X;  4FX0 A;  3WTS C;  5K7H A;  4RB2 C;  1W7P A;  4M3D A;  3PSI A;  1Q1V A;  1VTN C;  2UXX A;  4K2E A;  3BG6 A;  1XCV A;  3BR5 A;  3I59 B;  3PFI A;  3RZD J;  1L5I A;  2XC7 A;  3HOY J;  3OYB A;  1IXR C;  2UXN A;  4IEJ A;  1RZ9 A;  4B44 A;  1ZG1 A;  4WXD A;  2X85 A;  5EJC A;  3ISP A;  5DM6 F;  3I59 A;  2F48 A;  3LA3 A;  4LG3 A;  2X1C A;  3ULQ B;  4XID A;  4FIS A;  2Y0S N;  3W2V A;  2O5R A;  4KIS A;  4LMY A;  4AU7 A;  4I0B A;  6PAX A;  3H3V K;  3P5J A;  1VF9 A;  2LP0 A;  3ABT A;  4OIN F;  1O7F A;  1VZ0 A;  1ON1 A;  3OS1 A;  2MFZ A;  1FEX A;  3F21 A;  3O6B B;  4II3 A;  4AIK A;  4PJM A;  2DTR A;  2EQR A;  3SFI A;  2HXI A;  3LSJ A;  2LKS A;  5BPI A;  1ZAO A;  1Z3Y A;  3K6G A;  2IXS A;  3KLO A;  1IV8 A;  1VQL I;  1SFK A;  4IHX A;  1JXS A;  1X3Z B;  3FXR A;  4U87 A;  2CUF A;  1VQP I;  1WJC A;  1MBH A;  1OCZ H;  2M45 A;  3G73 A;  5DEQ A;  3I53 A;  3NAU A;  1P7J A;  1D5Y A;  1GXP A;  3RCO A;  4PFP A;  4BHB A;  2NS0 A;  2MLG A;  1ZGW A;  4AWX B;  1O3Q A;  2LH9 A;  3LMM A;  4C30 A;  1YJW I;  1YFH A;  4LJZ F;  5FO5 A;  5EGO B;  4NC7 A;  2CO5 A;  1JT0 A;  2DU9 A;  3KEY A;  4OWR B;  4DBQ A;  3WTX C;  1CF7 B;  2X48 A;  5F1J A;  5M5X J;  1FOK A;  4RLF A;  5EF6 A;  3DLL F;  4N9H A;  3H5A A;  3FIW A;  2D2W A;  2V79 A;  1CF7 A;  1A31 A;  3QWL A;  3EET A;  3R60 A;  1REP C;  4RLQ A;  4GYI A;  4BBR J;  2Z5U A;  4FE4 A;  4M6X A;  4RAZ A;  4CIC A;  4E70 A;  2AO9 A;  2PI0 A;  1IDZ A;  1VQ5 I;  4CYC A;  2VUM J;  1TQI A;  3G4S I;  3DEE A;  3EUK L;  3VB2 A;  2Z9O A;  4HZF A;  2EH3 A;  4UVC A;  3WGG A;  1DP3 A;  1V5G A;  4E7H A;  4G8X A;  1R71 A;  2IJL A;  2MGQ A;  5EEH A;  1H0M A;  4HRI A;  1DPU A;  2ACJ A;  1IN4 A;  1MMD A;  5E3N A;  3WU1 B;  5CVV A;  3RKX A;  2TDX A;  4NBQ A;  1ZTR A;  1MBF A;  1NTC A;  2TBD A;  3CCY A;  5DYM A;  1YX5 A;  1YTY A;  1Y0N A;  1IXS B;  3K1M A;  2ME6 A;  2L54 A;  2WY7 Q;  4ABZ A;  3I9V 2;  4FX4 A;  3V7S A;  1VQ8 I;  1D8K A;  2ADU A;  2OAZ A;  3CLQ A;  3HC7 A;  4BXX J;  2WAF A;  3P9K A;  2O8X A;  3PL8 A;  2YU3 A;  3CJT B;  1R1U A;  3FXO A;  5M5W J;  4AIH A;  1XDU A;  2VOP A;  2K40 A;  1V4R A;  1WRJ A;  2K9Q A;  2JTV A;  5TIS C;  1FLI A;  3N05 A;  4G7O F;  2X6W A;  4PJ0 C;  2RNJ A;  2CRG A;  1S29 A;  2VXD A;  4CCJ A;  3HSR A;  3F23 A;  2LF7 A;  4JOM A;  2GWR A;  5KK1 A;  1BW5 A;  2EV0 A;  1I3Q J;  1TW3 A;  3REO A;  4C2U A;  3DU6 A;  2IRF G;  2BY0 A;  3CCS I;  1P2F A;  1BR4 A;  3EQL F;  4ZDP A;  2Y31 A;  3BR2 A;  1Z91 A;  5BYG A;  3C7J A;  4IRH A;  1RET A;  1RKW A;  4NQW B;  2R7V A;  1ZLJ A;  2LRE A;  5F6F A;  1V55 H;  2K9N A;  5D9I A;  3PO2 J;  3J81 K;  1ZRF A;  3VYS B;  3ZOB A;  5C4J J;  1T2K A;  2ELK A;  1SC7 A;  4XLN F;  3IP4 B;  4F52 A;  3QRF F;  4ZDO A;  3CUQ B;  4GRI A;  4CCO A;  3JRB A;  2CGP A;  3PQJ A;  4H0E A;  3X2Q H;  2EV5 A;  4D7M A;  1WI3 A;  3HSE A;  1W7P D;  2A6H F;  1X2N A;  3MZ8 A;  3LSH A;  1HST A;  4Z2Y A;  1OR7 C;  2B0L A;  1DUX C;  1TW2 A;  3DBH B;  1Z6R A;  4HQM A;  3D0S A;  3MKY B;  1FMW A;  3HGG A;  2HDW A;  2DDB A;  1PVE A;  3R6S A;  2CUE A;  2EZK A;  3MQ0 A;  1G59 A;  2Z1D A;  1IDY A;  2K3F A;  2K86 A;  1YE9 A;  2PG4 A;  2ZFW A;  3G2B A;  2W1O A;  2EFN A;  1LFU P;  2HQA A;  2DXI A;  2OBP A;  3FMS A;  2KT0 A;  4E4H A;  4WCG A;  1MGT A;  3IC7 A;  1N78 A;  5E8G A;  3PM1 A;  1OYW A;  3KP2 A;  2F4O B;  2KQR A;  2Y48 A;  3RKQ A;  3ZQI A;  1MMA A;  3ZQC A;  3MZY A;  3D5L A;  4CCK A;  4ZYD A;  5HOD A;  5K7F A;  1HOM A;  3Q9S A;  1JKR C;  1MDM B;  2GXB A;  3QP6 A;  3GFJ A;  4II2 A;  2X6O A;  2ZFU A;  4XQF A;  3S32 A;  4LLN A;  1POG A;  4U0Y A;  3HOV J;  1TQP A;  4ANJ A;  2XAS A;  5HDG A;  2OQG A;  4U0V A;  5JVG F;  2KRC A;  3DXJ F;  2IS1 A;  2W85 A;  3RKY A;  4Q47 A;  1MDM A;  1EH7 A;  3GW2 A;  2L9R A;  1ZK8 A;  3HEF A;  4LB5 A;  3GTG J;  5E1X A;  2DYS H;  2XSD C;  3CCE I;  2D45 A;  3HHG A;  1VQ9 I;  2PN6 A;  3SDG A;  5ILS A;  2WTE A;  4BE0 A;  3K1P A;  2CFO A;  3T0Y A;  3O8G A;  3SEZ A;  3F8F A;  5GAD J;  3BTL A;  3WU0 A;  1QA6 A;  2M2E A;  1S5L C;  1ZG5 A;  1GV5 A;  2P0W A;  3S3O A;  2GLO A;  5L3F A;  1UEL B;  3GYH X;  4IOC F;  3L09 A;  2K02 A;  4BQQ A;  5JLW A;  2AQF A;  2A3S A;  1NK3 P;  1MNM C;  3BR1 A;  3COA C;  2AS5 F;  2EIL H;  3WU2 C;  4QIW N;  3PSF A;  2LK2 A;  4OMZ A;  3VSL A;  5DD4 A;  3U9G A;  4RM2 A;  5IYD J;  2EA2 A;  4CXF A;  1OMI A;  2XF7 A;  2BY2 A;  2JJ7 A;  3W2A A;  2QBY B;  2CQ7 A;  3PIP F;  2LFB A;  3QPH A;  4PSX A;  4NC8 A;  3A2K A;  1Z3X A;  4OIO F;  2NYX A;  4PUS A;  2ETH A;  3K2Z A;  1Z9C A;  3A01 B;  2B63 J;  5EDN A;  2QQA A;  2E1O A;  4L9J A;  3C3W A;  3PNT A;  1R4N B;  3HZJ A;  2R7X A;  3UNG C;  2R5Z A;  4Z6Y A;  3CTA A;  5FKN A;  4HLX A;  5CYN A;  1TTY A;  4B43 A;  3VYT B;  5GAG J;  4BJ6 C;  2R7Z J;  1T08 B;  5B5E C;  2KKO A;  3IAS 2;  1WJB A;  2VPL A;  3T8T A;  2KL4 A;  4YFX F;  4MEY F;  3P7N A;  3I4N J;  3NRV A;  1YRN B;  5LGU A;  3FIS A;  3TDU C;  1YOV B;  3E7L A;  3TOB A;  4ZJZ A;  4GGG A;  1XTA A;  2FBK A;  2EJR A;  2XAU A;  4HEA 2;  3GXO A;  4PJL A;  4JX4 A;  1XC5 A;  2CV0 A;  2FD5 A;  1YRN A;  4L5E A;  1NK2 P;  2HZT A;  4Y3O A;  2LY9 A;  4IKF A;  4WXH A;  2HVR A;  2IS6 A;  4EQQ A;  5E17 F;  2L02 A;  3E6B A;  3OMY A;  2XAF A;  1PDN C;  1T8I A;  2MD5 A;  3FK6 A;  2WC2 A;  4MNU A;  3HBL A;  1W0U A;  3GLL A;  4RBO A;  1K79 A;  3LOC A;  1I3A A;  4RAY A;  1JUP A;  2RGV A;  3S3N A;  1I5Z A;  3QFQ A;  1OFC X;  3FHN A;  2BEO A;  1QHH D;  1GHC A;  1HSJ A;  2LYC A;  3QN2 A;  4HBL A;  3R4K A;  3L7W A;  1IC8 A;  1IO2 A;  1E0E A;  2DPD A;  3CCJ I;  1D0Y A;  4Y33 A;  2DFH A;  2BHZ A;  2OCE A;  3LSI A;  1YO5 C;  2K9L A;  4DIQ A;  2A61 A;  4F7Z A;  1BI3 A;  5LD2 C;  2GAU A;  1J75 A;  2DK8 A;  1FYL A;  1XGS A;  4XR6 A;  4AVP A;  1F36 A;  3O2P E;  2HEO A;  4XON A;  5LEJ A;  5IYB J;  2XPW A;  3C2B A;  1JHF A;  3BC8 A;  4A0Y A;  2OQR A;  5D5U B;  1MW7 A;  4RB3 C;  3DCF A;  1X19 A;  3J81 Z;  4DZP A;  1PJR A;  1BR1 A;  5LGN A;  1IN5 A;  4R1H A;  4XKV A;  1ETY A;  1ORK A;  1W5C C;  2LG4 A;  3VYU B;  3OYE A;  3CUQ C;  4OU0 A;  2EIK H;  3HOW J;  4XKW A;  2LF8 A;  2QF7 A;  4G12 A;  1LFB A;  5BQT A;  3Q5F A;  1W5S A;  1VQN I;  1F5T A;  3BZC A;  4MFD A;  3C1D A;  1G4D A;  1HXD A;  2VN2 A;  1GLN A;  3PFY A;  4XIC A;  2HR3 A;  3CP8 A;  3K4M A;  4BU2 A;  3GX4 X;  4V19 K;  4Q4Z F;  1D8J A;  4JX6 A;  2LBF B;  1D1A A;  5K5R A;  3SZT A;  3TO7 A;  2A69 F;  3OYM A;  2Q8K A;  4B3A A;  1MH4 A;  2DI3 A;  4IVN A;  2JRM A;  2ELH A;  1ZR2 A;  2CSO A;  3BCA A;  4NHJ A;  2PQ8 A;  4WK8 F;  1T0F A;  4H4K C;  4KDP A;  2LBF A;  2EK5 A;  1FYM A;  4OIP F;  3LSK A;  3RKW A;  2EZI A;  1IJW C;  1F08 A;  4CHU A;  5D6E A;  2DMN A;  3HKZ N;  4IQ4 A;  5J3L A;  2L0K A;  2BHY A;  1SD6 A;  3B73 A;  2ZKZ A;  4A3M J;  4HX8 A;  3H5N A;  4EJV A;  4EGZ A;  1H88 C;  1MBE A;  3K4J A;  2A6E F;  2WB1 N;  2VQC A;  5FFZ A;  5FRO A;  3MEX A;  2K9S A;  2X4H A;  3UR3 C;  1XPX A;  1YHQ I;  2ISZ A;  1TNS A;  4EJW A;  4UHT A;  2OU2 A;  4XRS A;  5GAE J;  4Y7N J;  5L3G A;  3VFZ A;  1VI0 A;  2LSO A;  1WJD A;  3IL2 A;  3F8B A;  3EYI A;  1HKQ A;  3OSG A;  2M5W A;  1R9W A;  4I0A A;  1LNW A;  3L2U A;  3IH2 A;  3BZK A;  2JN6 A;  2R7W A;  2V6E A;  2W00 A;  3I54 A;  3WE3 A;  2UZK A;  3WHC A;  1Y0U A;  4BUP A;  3RQI A;  4L5I A;  2A05 A;  3DF8 A;  1O3S A;  4A3C J;  3FZV A;  3IHU A;  4OOI A;  4PCQ A;  5B3S H;  1ETV A;  4XLH A;  3IRR A;  3WG9 A;  2P7C B;  4E7L A;  3F8C A;  2ZBK A;  1GVJ A;  3GCM A;  1I6H J;  5DCM A;  1DU6 A;  3DV8 A;  1R5I D;  1QZY A;  2VIX A;  2W57 A;  2W84 A;  2YS9 A;  2XAQ A;  4MTD A;  1PP7 U;  3GTP J;  4I09 A;  1WHU A;  2WAE A;  3DEW A;  3D1N I;  4BE1 A;  2LLK A;  2WY8 Q;  3B6A A;  1KQ0 A;  3IWF A;  1STZ A;  2NVY J;  1ZAR A;  3K10 A;  3LNQ A;  2ZO4 A;  1VQ7 I;  2DA5 A;  1LDJ A;  3S2D J;  1Y56 A;  1MNE A;  3JRH A;  2E36 A;  3FXU A;  5HDK A;  2E1M C;  3CJQ B;  1KU2 A;  1UMQ A;  3SDB A;  1SFU A;  3K9T A;  3J7A Y;  3TMO A;  3BT9 A;  2DQL A;  1BC8 C;  1FSH A;  4G94 A;  4HPQ A;  4Q5S F;  1SAU A;  3RPQ A;  5FB2 A;  1YS7 A;  1TNT A;  3M3Y J;  3IH3 A;  2HFH A;  3ZR8 X;  1B72 A;  1XMA A;  2DMT A;  3H9G A;  2QKM B;  1WH7 A;  5F0C A;  3RQ4 A;  1RUO A;  3OYC A;  3F22 A;  4EAT A;  4KFC A;  1WWX A;  2ZNY A;  3QOP A;  3QU3 A;  4AUX A;  1FJL A;  4A3L J;  3E5U A;  1T6S A;  4EVI A;  2DW4 A;  2RQP A;  3F8N A;  3ZMT A;  2DK5 A;  1IZ1 A;  2NVQ J;  2M9H A;  3G1M A;  4RB1 A;  3L2Q A;  1K78 B;  2YUS A;  3JTH A;  3WOD F;  3CF2 A;  3HM5 A;  4P96 A;  1KGS A;  2DT7 B;  4D9J A;  2HW0 A;  1JHH A;  2H1L A;  1A6I A;  1FTZ A;  2WAD A;  1N77 A;  1E17 A;  3DBL B;  3RDI A;  2L9V A;  1D1B A;  1S3J A;  4BBS J;  2Y0S A;  5DV5 A;  5M3F J;  2W7N A;  2XAH A;  1P9Q C;  1P92 A;  4C9Y A;  4ZQ9 A;  2CG4 A;  2EZH A;  3KYC B;  4N0B A;  2BE5 F;  3GZN B;  3ECO A;  4HW0 A;  4XOT A;  4FHT A;  3K2A A;  4UV8 A;  1LPQ A;  1ITY A;  1Z6T A;  5HS9 A;  2NRA C;  4EM2 A;  1RUN A;  5E1Z B;  5K7Z A;  5F64 A;  4FE7 A;  3G3Z A;  2VBW A;  4LB6 B;  4E7Z A;  3M4O J;  4W1U A;  1UST A;  1OCP A;  3HOU J;  2Z99 A;  1DQU A;  3ZQL A;  1MSE C;  3A0H C;  5ILU A;  2DJN A;  5KAI C;  2HOT A;  4OIR F;  4AID A;  4RGX A;  3S16 J;  1P4W A;  2X6X A;  1NG7 A;  2NVT J;  1S6L A;  4B4C A;  5LFA A;  2EIJ H;  3RZO J;  1EKE A;  2BY1 A;  2NS8 A;  3HXL A;  5CVI A;  5K5O A;  2DA7 A;  3IAM 2;  2DT5 A;  2JA5 J;  1A5J A;  4I02 A;  3CCL I;  1I50 J;  3KYL A;  2R7T A;  3F3X A;  3GTK J;  3OYL A;  2R7D A;  2W25 A;  1YLF A;  5HLI A;  4LMD A;  2CQQ A;  4C2T A;  1O3R A;  2IBD A;  4L0Y B;  3ESW B;  3QU6 A;  1FC3 A;  2J5O A;  2NL8 A;  2HOE A;  4MQ9 F;  2G7U A;  2XGD A;  4M3E A;  3OYF A;  1DPR A;  1R1T A;  4D0P A;  4A3D J;  3L1P A;  2HQ5 A;  3MKL A;  2JPB A;  4RGR A;  4A0X A;  2OV7 A;  5DCX A;  5B1A H;  1HBX G;  2JA7 J;  2NVU B;  4GYG A;  3OOU A;  1HW2 A;  5KVR A;  3FX3 A;  4LG0 B;  3J80 K;  3A0B C;  1UJ8 A;  4IRI A;  2XHK A;  4XRS G;  1QO0 D;  2RDP A;  3JCU C;  2CH0 A;  3TP0 A;  3K4K A;  2R93 J;  1QVU A;  2KIM A;  4XLA A;  3VOD A;  2QCO A;  1R5H A;  3OL3 A;  5ERI A;  3M1E A;  3V8K A;  5J1Y A;  5HNF A;  2HYG D;  3RJP A;  1UHM A;  4I7H A;  1BM9 A;  4LG0 A;  1T95 A;  1T33 A;  4CCN A;  4A6D A;  1OYY A;  2M8E A;  3BTI A;  4W97 A;  5ICF A;  1ZKG A;  4AYB A;  3S1N J;  1BIB A;  2A6T A;  1WSU A;  1BIA A;  3EUH A;  3RPU A;  4DOZ A;  2RC4 A;  2R7S A;  1UHS A;  1GVD A;  2XKP A;  4HV6 A;  3OOP A;  4FCY A;  1T0F C;  1XSV A;  4LIF A;  3GF2 A;  3MD2 A;  5H2F C;  2QWW A;  2VT3 A;  4OAZ A;  3HRM A;  2RN7 A;  4C3H J;  4L0Z B;  2K4J A;  2MA3 A;  1IF1 A;  4XLP F;  2DA3 A;  2L9N A;  1XGO A;  4EM1 A;  2XSJ C;  1QU3 A;  1VQ6 I;  1OCO H;  5TRD A;  2DQR A;  1IG7 A;  4L9V A;  5DS9 A;  1ZGA A;  1HDD C;  2FBI A;  1FSE A;  1W1W E;  2XGC A;  2K85 A;  2CQX A;  2E5N A;  4FQG A;  2RQQ A;  5FD5 A;  4CYC B;  3OIP A;  1IUY A;  3JAM K;  2X0L A;  3AG3 H;  2Z2S B;  4A12 A;  3U1K A;  2F5C A; 
#chains in the Genus database with same CATH homology
 2OC6 A;  3CMM A;  3ZCO A;  1FMV A;  3DTI A;  2JSP A;  2HVQ A;  3DWL E;  4PFO A;  4CUG A;  4BE0 A;  1J09 A;  2CFO A;  2HPI A;  3A1Y A;  2VKH A;  4XOR A;  1X4O A;  3SEZ A;  4CCM A;  2K5C A;  4NUB A;  4E7S A;  4XLE A;  4HNU A;  2VQL A;  1UG0 A;  3AKZ A;  4D1Q A;  1UAA A;  2P0W A;  5HLT A;  3S3O A;  1UEL B;  1BR2 A;  2BOL A;  2VJ5 A;  2E5Z A;  5CPR B;  3D5R C;  3L2W A;  4BQQ A;  2AQF A;  4U7B A;  3FBN B;  2V26 A;  2CV2 A;  3PSF A;  3U21 A;  4BL0 B;  3VSL A;  2CW8 A;  2FUG 2;  4X0G A;  4RM2 A;  4J00 A;  2VAS A;  2RRE A;  3PNY A;  2Q1Z B;  3HG9 A;  4B47 A;  3PNV A;  2XF7 A;  3QYF A;  2CUZ A;  3K4B A;  4LIU A;  3W2A A;  3ZXS A;  5HVQ C;  2M0M A;  3IUO A;  1HA8 A;  1TZL A;  3H9J A;  1EA3 A;  1DGR M;  2IS4 A;  3OY9 A;  4PSX A;  4NC8 A;  3A2K A;  2VKD A;  1Z3X A;  4PUS A;  4BEH A;  2LOO A;  2HPM A;  5FRM A;  3PNT A;  2MAB A;  1AA7 A;  3UNG C;  2R7X A;  2KPM A;  5KCM A;  3MMY B;  5CQG A;  1KON A;  4QPO A;  3H35 A;  2L9S A;  3K70 D;  4BDY A;  2X51 A;  5CYN A;  4F93 B;  3MKW B;  4B43 A;  4DBR A;  2HU9 A;  3VYT B;  3DKY A;  4BJ6 C;  2F4I A;  5HOO A;  2IGN A;  2UV1 A;  4R79 A;  4KJZ A;  2OUM A;  2R7U A;  1X1D A;  1K6Y A;  3IAS 2;  2CS3 A;  1WJB A;  2VPL A;  2KL4 A;  2VJJ A;  3DQV C;  2R7Q A;  3TBI A;  2A5W A;  4OAY A;  4JQF A;  2HVS A;  1YX3 A;  2X1D A;  3EPZ A;  4BQN A;  3K4L A;  4ZJZ A;  3OYA A;  2X1E A;  3OWT A;  1W36 D;  2MYS A;  4XN3 A;  3LSG A;  3BCB A;  4HEA 2;  2XAU A;  4E7I A;  4PJL A;  2CV0 A;  2CW7 A;  2LRD A;  4N4O B;  2DOA A;  4IX7 A;  1N75 A;  3OYK A;  4BE2 A;  4Y3O A;  4IKF A;  3K70 C;  2F6C A;  2HVR A;  1TBD A;  2IS6 A;  3A4C A;  2L7K A;  3OMY A;  1S9H A;  3VSK A;  4KT6 A;  4Y4R A;  3HOT A;  3SEQ A;  2XDV A;  4RMN A;  2CMP A;  4DGW B;  1MND A;  3HOS A;  4NBP A;  1V5F A;  3RTR A;  2IGK A;  4FAS D;  5KHD A;  2CUJ A;  3S3N A;  1W36 C;  4PJJ A;  3QFQ A;  2IGO A;  3L2V A;  4N4N B;  4E7K A;  3NWT A;  3FHN A;  3GBG A;  1ERD A;  1QHH D;  4P5O A;  4KW3 A;  2LYC A;  4YEJ A;  4ZC3 A;  3DU5 A;  3QN2 A;  1E0E A;  2M4G A;  1D0Y A;  4Y33 A;  4FET A;  3LSI A;  5CQE A;  3OYD A;  2K9L A;  3E0J B;  3SZG A;  4FGN A;  3D5S C;  4DIQ A;  4BJT A;  4CSW A;  5LD2 C;  3QYE A;  2V9K A;  1QHG A;  1DGW Y;  2M4K A;  2IF9 A;  3VWB A;  3TL4 X;  3MKZ A;  3FBI B;  4XR6 A;  4ZTF A;  4GDF A;  4XON A;  3OYN A;  3RPU D;  1U0J A;  4HNT A;  3OS2 A;  4BDZ A;  2ITJ A;  3BC8 A;  5HNH A;  2Z16 A;  4ZYA A;  1JI8 A;  1MW7 A;  3F9K A;  1WJE A;  4BS9 A;  4G6T B;  3S93 A;  1X19 A;  3ZGK A;  2KP6 A;  1PJR A;  2XF5 A;  3M1C A;  4YEL A;  1BR1 A;  4XKV A;  4E7J A;  4XKB A;  3AL0 B;  1WJA A;  2KLO A;  2LG4 A;  4CA0 A;  3VYU B;  3LFU A;  1G8X A;  3OYE A;  1MMG A;  4XKW A;  4XL9 A;  2JA2 A;  3PJR A;  4XOP A;  2JVH A;  3C2H A;  3CP2 A;  2R7O A;  2E1M B;  2IPR A;  2QKL B;  4F55 A;  4ZO0 A;  1GLN A;  3DPL C;  3VDX A;  3PFY A;  4HG2 A;  2XF6 A;  3CP8 A;  3K4M A;  4PSW A;  4BEH B;  4BU2 A;  1PYV A;  2LBF B;  2GOX B;  1D1A A;  3OIQ A;  4QPQ A;  2UUZ A;  3QOD A;  3OYM A;  3OYG A;  3E1S A;  3W2W A;  2LY1 A;  3BCA A;  4H4K C;  3W3C A;  2LBF A;  3OR1 C;  1R6R A;  2K3P A;  2PMZ A;  3PUB A;  2ELJ A;  3LSK A;  2CV1 A;  1F08 A;  4MLO A;  4XMY A;  2RNG A;  2ZXH A;  4IQ4 A;  3DPT A;  1D0X A;  3PSI A;  3H5N A;  3BG6 A;  2R7R A;  2PJR A;  1X4P A;  3K4J A;  2XC7 A;  1L5I A;  2MD0 A;  2VQC A;  3OYB A;  5FRO A;  3UR3 C;  3V42 A;  1RZ9 A;  4B44 A;  2X85 A;  4ITV A;  2W82 A;  3HUG B;  3OL4 A;  5JHF A;  1WJD A;  4PK4 A;  4J01 A;  1Z7L A;  4LG3 A;  2X1C A;  2DCE A;  4P1W A;  4KIT B;  3ONQ A;  2KDO A;  1R9W A;  3W2V A;  3L2U A;  5TGT A;  2O5R A;  4KIS A;  2IS2 A;  4AU7 A;  2R7W A;  2V6E A;  2W00 A;  3HPG A;  4BUP A;  3C2G A;  1LFP A;  2I8D A;  3OS1 A;  1VZ0 A;  1WJF A;  2MFZ A;  4II3 A;  1X1B A;  3S3M A;  4PJM A;  4XLH A;  2VLA A;  3OYH A;  4E7L A;  3DPU A;  3LSM A;  1Z3Y A;  3K6G A;  2VIX A;  4NNJ A;  2IXS A;  1LKX A;  3CJR B;  1SFK A;  2WAE A;  2JUG A;  4XNF A;  4BE1 A;  2WY8 Q;  4U87 A;  2BW3 A;  2LY2 A;  1WJC A;  2AQE A;  4XM3 A;  3K10 A;  2E60 A;  2FUF A;  2VB6 A;  1TT0 A;  1Y56 A;  1MNE A;  3FKJ A;  1WFX A;  2VQG A;  5FRN A;  3RCO A;  4PFP A;  2DT6 A;  2E1M C;  3CJQ B;  3SDB A;  3J7A Y;  1LVK A;  1IRX A;  2WBM A;  3TMO A;  2LH9 A;  3LMM A;  4C30 A;  2Q2E B;  4HPQ A;  1SAU A;  4NC7 A;  4BQO A;  4DJA A;  1Y6I A;  3KEY A;  4OWR B;  3ZR8 X;  4CH7 A;  4DBQ A;  4BAC A;  2UWM A;  2K9M A;  3H9G A;  2QKM B;  2VQH A;  2KMU A;  2BVL A;  3RQ4 A;  3OYC A;  3S8P A;  4ZTJ A;  1MMN A;  4RLF A;  4EAT A;  2VJI A;  4CCL A;  3H5A A;  2F5V A;  2L5Q A;  1L2M A;  1X1A A;  2WB1 A;  2KZV A;  3L2Q A;  3H0D A;  4RLQ A;  3CF2 A;  2DT7 B;  4IQJ A;  4B48 A;  4XLC A;  4D9J A;  2VXZ A;  3QOE A;  2HW0 A;  2WAD A;  1N77 A;  2HZD A;  1D1B A;  3DEE A;  1D0Z A;  2Y0S A;  3EUK L;  2W7N A;  4F91 B;  2KHM A;  2NOJ B;  4HSR A;  1P9Q C;  4RM3 A;  4C9Y A;  4ZQ9 A;  4BXF A;  1V5G A;  2V7F A;  4E7H A;  2M3A A;  1DP3 A;  2VJ4 A;  4HRI A;  4XOT A;  3EUH C;  1MMD A;  2M7B A;  3VYR B;  3H5R A;  2L2O A;  2WA0 A;  4LIV A;  2TBD A;  1YX5 A;  2ZXI A;  2R4G A;  2WY7 Q;  2HNH A;  3I9V 2;  3RSN A;  2X6Y A;  3AFH A;  3HC7 A;  4E7Z A;  2NTC A;  2WAF A;  3QYB A;  4XN0 A;  3PL8 A;  2PJR B;  1DQU A;  1D1C A;  2GOM A;  4ZDL A;  2V1N A;  1X1C A;  2V4J C;  2X6X A;  1NG7 A;  3OS0 A;  4FB3 A;  5LFA A;  3OYI A;  3N05 A;  2X6W A;  4HST A;  3HXL A;  3K4N A;  3OR2 C;  2DJI A;  3IAM 2;  3FDY A;  2VXD A;  4CCJ A;  2BVM A;  3CES A;  3KYL A;  2R7T A;  4AVZ A;  4YRV A;  3OYL A;  4JOM A;  4LMD A;  4C2T A;  3M8J A;  4C2U A;  1M55 A;  3DU6 A;  1BR4 A;  4CZC A;  4ZDP A;  2NL8 A;  2JVG A;  3LL7 A;  5BYG A;  3K4C A;  3OYF A;  4NQW B;  2R7V A;  5DCX A;  2OV7 A;  2LRE A;  5D9I A;  1ZEL A;  2W4S A;  2MC4 A;  4PJN A;  3VYS B;  3OOU A;  4F3Q A;  1WJ5 A;  4BJ5 C;  3IP4 B;  4F52 A;  5CKT A;  4ZDO A;  1KSY A;  1UUT A;  4GRI A;  2BW3 B;  4CCO A;  2ITL A;  2CH0 A;  3SYT A;  3K4K A;  4LIT A;  4XLA A;  4E6K G;  3H9Q A;  1LDK B;  3OL3 A;  5HNF A;  3LSH A;  3AL0 C;  1OR7 C;  4XLF A;  1T95 A;  4CCN A;  3QK2 A;  3MKY B;  1FMW A;  2HDW A;  2KRH A;  4AYB A;  4BGD A;  1G59 A;  2A6T A;  2Z1D A;  1NG6 A;  3DLA A;  2ZSI B;  4XKC A;  1YE9 A;  3EUA A;  3KX2 A;  4DOZ A;  3G2B A;  2W1O A;  2DXI A;  2R7S A;  2HQA A;  3L2R A;  3DKX A;  1V5E A;  3OYJ A;  1BOB A;  1T0F C;  4E4H A;  1Z1D B;  4LIF A;  3BG7 A;  1N78 A;  3MD2 A;  2WAQ A;  3HPH A;  4OAZ A;  2VL8 A;  4IZZ A;  2KQR A;  3DTE A;  5KNL A;  2L9N A;  1MMA A;  3ZQQ A;  1Z21 A;  2XSJ C;  3HKZ A;  1QU3 A;  3D5L A;  4CCK A;  1KSX A;  3HL2 A;  3BLY A;  3I3L A;  4II2 A;  2IGM A;  4F92 B;  2ZFU A;  3DTK A;  3S32 A;  4XQF A;  2E5N A;  2RQQ A;  3OIP A;  3ZRG A;  4ANJ A;  2M7A A;  1OLT A;  2Z2S B;  2KRC A;  3CZ6 A;  4B3X A;  2IS1 A;  3NWS A;  2ZSH B;  2LC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...