3DKYA

Crystal structure of the replication initiator protein encoded on plasmid pmv158 (repb), tetragonal form, to 3.6 ang resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
EKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSSIKGQKYKKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHESKDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYDFIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein repB
publication title Plasmid replication initiator RepB forms a hexamer reminiscent of ring helicases and has mobile nuclease domains
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Replication
total genus 58
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01719 Rep_2 Plasmid replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dkyA02
3.40.1310.30 Alpha Beta 3-Layer(aba) Sandwich Replication Protein E1; Chain: A, Replication Protein E1; Chain: A, 3dkyA01
3DKXA 4U87A 3DKYA
chains in the Genus database with same CATH superfamily
5E3NA 1MGTA 3JRFA 1JKOC 2BY2A 3IKTA 3K2AA 1X1BA 4MQVA 3OS2A 1A31A 3JR9A 1FOWA 2Q8KA 2CRGA 1J0RA 1VQOI 4G6DA 2HVRA 1MNEA 1IO2A 1WFXA 2IEKA 3BR6A 1EH8A 4MTEA 3BZ6A 1SFOJ 3QFQA 2W48A 3KP7A 5B1BH 2RNGA 3QQAA 5M5WJ 4IOAF 4WCGA 3ZP5A 4Y4RA 5H20A 3VOEA 1N77A 4A3IJ 2QCOA 3JREA 1JKQC 3IHUA 1ETYA 2BGCA 2DOFA 2EIMH 2IGMA 4EJUA 2XB0X 3BZCA 4GO1A 3GFMA 2KDZA 2QQ9A 4PJLA 3BG5A 5BS6A 4RB2C 3MQ0A 3OR1C 3VFZA 2YPRA 2NNNA 2IGOA 2F5FA 2FQ4A 4EGZA 1ZQ3P 3MZYA 1B9NA 3ASNH 2RC4A 4CICA 3ESWB 2EIKH 1FSHA 1BI3A 2K02A 2JJ7A 2E35A 2QWWA 4M6VA 1RZ4A 1JHFA 2E1MC 4IL6C 1PUEE 2CGPA 3AG3H 3EQLF 2Z99A 2VI6A 3GTQJ 2YX4A 2BOLA 1BC8C 3GWZA 1B9MA 5E18F 2NS0A 3CDIA 1WJDA 3GF2A 5E8IA 3HOVJ 3RYRA 1ZR2A 3T8RA 1IZ1A 3LSGA 2F4OB 3EUAA 3REOA 2GA2A 4HDVA 5E1ZB 3RQIA 4AWXB 2WTEA 3SZPA 4B1RA 2M2EA 2VODA 2J5OA 2X6XA 2DO7A 3LMMA 3RQ4A 2A5WA 4D5FA 5L3BA 4I2OA 5LEJA 1BA5A 2GAUA 3KPHA 3GTLJ 5KNLA 2R5YA 1LNWA 3OV8A 1RUOA 3OYNA 1MJBA 2HDWA 1WSUA 5EZHA 3OIOA 4N4OB 4OMZA 2L9NA 3E5UA 3HHHA 4HF0A 3JTGA 4U0VA 1OCPA 3BY6A 3MD2A 1R7JA 4DBRA 2A3SA 2OV7A 4XRSA 1XG1A 1WZ2A 4BJTA 2K3FA 3W6VA 1LFPA 3J7ZI 1JE8A 2ZKZA 2OF7A 2QM3A 4PJJA 5HDNA 2JWTA 2G7UA 1Y1VJ 2FE3A 1OPCA 4HBLA 1Y39A 1BR2A 1WJEA 2FBIA 3CJRB 2H94A 3GCMA 2FF4A 2E34A 1Z91A 3Q9VA 4ZZDA 2M45A 2O03A 3ABLH 2GZWA 2RKHA 5KHDA 4JX5A 1J75A 3F8MA 4JK1X 4RBOA 2HEOA 2CQXA 5E3MA 1PYVA 1R5HA 3FMRA 5FKOA 3I4NJ 2DCEA 2D5VA 5LFAA 2XV4S 2LYCA 5BPDA 3RZDJ 2EV6A 3GFIA 5IT9K 2OCEA 3JW4A 4EVIA 3IC7A 1ULYA 2XRNA 4RB1A 1TBDA 2LG4A 4KIBA 2HS5A 5F6FA 4HF2A 5IP6A 1I1SA 3Q3SA 3COAC 4AVPA 5E17F 3MEXA 3B02A 4KDPA 2X1CA 3DKYA 4HYEA 5TRDA 2EZHA 1PUFA 4XLPF 3CQZJ 2HVSA 2OBPA 1GXQA 4I01A 4BXUA 4D1QA 3IUOA 4RGUA 1A6IA 3H5RA 5LD2C 2MD5A 2LK2A 1KQ9A 3ZQLA 1ITYA 4CO8A 1G3WA 1F36A 2F48A 3VPRA 3D5SC 2M30A 2DAOA 2PFBA 3ELKA 3Q0WA 5D4SA 4OINF 2E1CA 1Z05A 2ELJA 5K5QA 3OYFA 2HWVA 4FX4A 1G3TA 3LFKA 4QWQA 2KRFA 2P6TA 3KP2A 4A5MA 4A3DJ 2VOPA 3HM5A 4XKCA 3ERMA 2EZKA 1ZTRA 5CVVA 4B3XA 3JRCA 3L7WA 3CCMI 4FHTA 1X1DA 3FXRA 2R7UA 3HKZA 2O8KA 1QPIA 1XGOA 1FZPB 3QPHA 2VN2A 3DFGA 2EINH 2VBXA 3FK7A 1DQUA 1MD0A 3G6EI 1E0EA 2OZUA 2FMYA 1YI2I 4HSRA 2EFOA 3ZN0A 2AQFA 3HHGA 1FNNA 3IH2A 1ZG1A 4FETA 2KKOA 3T5XA 4W97A 2E1OA 1Z7UA 2V7FA 3CJQB 1LE8B 5EEAA 1UELB 4XRFA 5B1AH 4FX0A 2ZXHA 1E3OC 2H8RA 1M1EB 2W4SA 1OJLA 3BR5A 4BS9A 3R0AA 4BXFA 1IV8A 3BLYA 5E1XA 2IPRA 2Z1DA 5FROA 2XROA 3CDHA 4DIQA 3LAJA 4G7OF 3OOPA 4XNFA 2A61A 3ABKH 4EM2A 2ZBKA 1TQIA 3GTGJ 2O61A 4BAYA 2R93J 3H3VK 1HW5A 2ID3A 1XSXA 2WADA 3GZNB 2RNJA 5DS9A 5ICFA 1D0XA 4RGXA 4Y7NJ 2GXBA 1U5TB 3ZMDA 4EQQA 3CCRI 1GUUA 3L2WA 4TV7A 2HYJA 4OMYA 4AVZA 4JQFA 2LBFA 2R7DA 3H92A 1J5YA 5CVRA 1RZ9A 4KNYA 3EYYA 1BIBA 2JMWA 3MWMA 3HOSA 4E7ZA 1BL0A 1X1PA 2KIQA 3EETA 1ZG3A 2HKXA 3RJPA 2VKVA 3G1OA 4Q4ZF 3GZ5A 1DP7P 1FBSA 2IW5A 1QBJA 4M3FA 1YX5A 1KU7A 4XSZF 4NUBA 4PK4A 4BQQA 4GFBA 1ON2A 4WXDA 5L3DA 4DYRA 2XGXA 5BNGA 3E3VA 1R6RA 2BEOA 3K4MA 2JA5J 3PIPF 4P55A 4Y15A 1JGSA 3FX3A 5KAFC 2CO5A 3S32A 2FOWA 1IRFA 1R4MB 4IVNA 2LDUA 4MQ9F 3TDUC 1HC8A 2P4WA 3I55I 2QA4I 4X6AJ 2DU9A 2XGEA 3TOBA 5L3EA 4IZZA 1ERDA 1F08A 1R1TA 4LGWA 2M4KA 5EF6A 4B48A 2A69F 1V55H 2V6CA 1GLNA 2EFWA 1FIAA 4M3BA 2WAQA 2Y0SA 2QVOA 2LKXA 4NQWA 2Y9ZA 2V1UA 4KT5C 3CCLI 1V54H 2IJLA 2DODA 2W25A 3U9GA 1VQKI 2PBIA 4PSWA 3WTXC 1OCRH 3ZQQA 5LHIA 2LFBA 1T2KA 2XAJA 5E3OA 2HPMA 3LFUA 2LH9A 4M73A 3J7AY 1QO0D 2AXTC 1RETA 3M07A 3BR3A 2HQNA 1M55A 2DJNA 3FKJA 2NTCA 1FIPA 4KMUX 3DPUA 3HEFA 1GVDA 1B6AA 2XGCA 3FM3A 4NC6A 2A07F 3ZQFA 1YS6A 3CMMA 5JVGF 1HBXG 1G8XA 2DYSH 2MYSA 1IN5A 3LQRA 1F5TA 2K4JA 1UG0A 3N05A 4V19K 3A2KA 4WK8F 4HLYA 3O8GA 2CS3A 5J1RA 1FX7A 1A36A 4E7HA 5FD5A 3HXLA 2PMHA 3V8LA 4HEA2 2CUJA 3CLQA 2O9LA 3FXKA 4CZZA 1USSA 2HQRA 2KDOA 1YJ9I 3F3XA 4GYIA 3ECOA 3QWLA 3AKZA 1UHWA 1IN8A 3S3NA 3W3CA 1K6OA 1AKHA 2IAIA 1Y8RB 1FBUA 4XKVA 1S7OA 3BQYA 3HOZJ 4P1WA 3BDDA 5IOYA 1I5ZA 2HVQA 3HOTA 2LY2A 2K9NA 3Q5FA 2R7XA 2H6CA 3I58A 1CGPA 4QLCU 2KPMA 5J1YA 3QN2A 3RTRA 3M8JA 1BM9A 3ZMTA 4P9UA 2HXIA 4A3LJ 3S3MA 3BG6A 2IS2A 4E7IA 4F91B 5D8KB 3OYKA 1ZELA 2Y30A 3DWLE 2PG4A 3HOYJ 1O3RA 2MLKA 3CCEI 4EJWA 3E6DA 3K1PA 3K4LA 4ESFA 4QPOA 2NRAC 2R4GA 3NARA 2DT6A 2X1EA 3RPUD 4PZJA 3HB9A 5LEKA 1WJAA 4RLFA 3CCSI 1P4WA 4CCOA 4BQOA 2VJ5A 5IY5H 3FHZA 3FXUA 2VQLA 5DCXA 2R7FA 2DN0A 3BJ6A 4Z2YA 3MZHA 1N25A 3CCYA 2XVCA 4Y13A 2DXIA 3TP3A 5DM7F 3CMYA 3MAJA 5CQGA 5D6EA 2QYOA 4HG2A 1JUMA 4CCLA 5H6QA 2A6TA 5BOXA 1YTYA 1B4AA 2WWYA 3I4MJ 2DOAA 1HLVA 2Q0OA 2M0CA 4KMFA 2WC2A 3I5UA 5EGOB 1EA3A 3PSIA 4U88A 3KYCB 4RMNA 3W6JB 2ID6A 2M7BA 4IQ4A 4C30A 1IUYA 3V8JA 5FGMA 4AIDA 4UVCA 3X2QH 3ZMZA 2P8TA 2PEXA 2RN7A 2OQRA 1VI0A 2AS5F 2XPUA 1ZH5A 3BP8A 2L54A 4I7HA 4E7JA 1P4XA 4M9ZA 3ML6A 2FRHA 2KHMA 2CW7A 2JN6A 4RS8A 4BJ5C 3KE2A 3OYHA 4KISA 1STZA 2W57A 2IRFG 3L2CA 2NS7A 4H4KC 3TW6A 1JKPC 3LL7A 2XASA 1OKRA 3H9JA 4D9JA 4ZYHA 4A3FJ 3VYRB 3CF2A 4NC7A 5AONA 1O4XA 1Y1WJ 4J01A 1GHCA 2NVXJ 1TBXA 3HZJA 4KJZA 2EQRA 5HDKA 2ADUA 1WJ5A 3QPTA 5CVIA 3C2GA 4YRVA 4UUSA 5DM6F 1TWCJ 1O7FA 4EM0B 2OZ6A 2PJPA 2XF7A 2ZSIB 2HFHA 4ANJA 2ZMEC 3DF8A 2L7FP 4EEFG 3VYTB 1H9GA 1HOMA 5FFZA 3LQQA 3QYEA 1K83J 1SAUA 4HV6A 4XN3A 2DMTA 4EMSA 4JYKA 2EILH 1NHAA 4LIVA 5JVTA 3HRTA 2R7WA 1UHMA 1X19A 1OCCH 3CO6C 3CUQC 2R92J 2ACJA 1XGMA 2HQ5A 4I0BA 4G94A 4PUSA 2ZFUA 5C3EJ 4BE2A 1YJNI 1RC9A 2DFEA 2X85A 1J9IA 1VTNC 1AU7A 2FNAA 1X3UA 3WG7H 3WHCA 2TBDA 2CWEA 1OYYA 2P81A 3D5RC 2HDDA 4P96A 2ME0A 2RREA 2XIGA 1DUXC 5FLVA 4H0EA 1P7JA 1P92A 1K4TA 2STTA 5CJ9A 1L0OC 3G73A 4AIJA 3KLNA 4XICA 1FOXA 1Z6RA 5CPRB 1YW8A 3PL8A 4LB6B 4ZYEA 3MZ8A 2EPFA 3FZVA 3R4KA 3HRUA 1ZLKA 3KFWX 4XRSG 1S72I 2CW0F 2W24A 3PFYA 3ZCOA 4ZO0A 1HKQA 2KZGA 2P5KA 3CC4I 4CUGA 2DPDA 1ZG5A 2K9SA 1V3FA 1B1BA 3C18A 3RKYA 3KEOA 4HX4A 3P5JA 1X1CA 4HA8A 4CDGA 4JX4A 2OD5A 2OAZA 2R7VA 4JOMA 4PJMA 2V1NA 1MDMB 1HDPA 1XX5A 2ISYA 3OYCA 3PUBA 3NWSA 1ZR4A 1Z9CA 1BW5A 3SDGA 2ZXWH 1ZGJA 1IJWC 1WWXA 4KW3A 3CF5F 5EG0B 2DT7B 5HODA 5D8LB 4U0WA 2KIFA 2HYGD 4A6EA 1GDTA 1VZ0A 2EB7A 3AAFA 2QBYB 3E0JB 3AFHA 1OR7C 1UHSA 4Q48A 4A93J 1YOVB 5FRNA 2E2HJ 3F72A 3I4PA 4XN0A 2E2IJ 5EEHA 4G7HF 2ZXIA 1PP7U 1YS7A 3VSKA 4N9HA 1W7PB 2ZMEB 2UZKA 5LBQA 3PM1A 2Z2SB 4OU0A 3RKWA 3ZPLA 2WB1A 2LLKA 1RRJA 1VQ9I 2H09A 2MA3A 2PMUA 3GZ6A 2PN6A 3CUQB 5K7HA 2K4BA 4RM3A 1YO5C 1JHHA 4M3GA 2N8GA 2ZXJA 2FU4A 1Z77A 1TWFJ 1NG7A 4FGNA 2CQKA 4P5OA 1TQMA 1A35A 3H0GJ 5J6XA 4U0YA 1XC5A 2KJBA 3GYHX 4A5NA 1C0WA 2CUEA 1MNDA 1U9OA 2V9PA 3A01B 1IUFA 3CMEI 2BVLA 1OYWA 5FJ8J 1XB4A 1Z3XA 3K0LA 5D5UB 3DU6A 3LSJA 1R00A 1S5LC 3KX2A 3U2RA 2B63J 3S1MJ 1AA7A 1J2XA 2P6SA 3V7RA 9ANTA 2ZJQF 2NL8A 1T0FC 1SMYF 2M7AA 2DFIA 3N97A 3PNVA 5DEQA 5DUIA 2J5PA 2ZJ2A 4HQMA 2R7RA 1I6HJ 1QZEA 2W1OA 5E8GA 4NDLA 1K78B 4MIMA 3L9FA 1KSYA 3IL2A 1K79A 3BC8A 2F5EA 1YHQI 3WGIA 2LTPA 4LJZF 3M9AA 4M9XA 4MLOA 5H6RA 2XDVA 3EDPA 3PQKA 4V2FA 3E1SA 4M71A 2HI3A 5K7FA 4ZYGA 5E1WA 3IV5A 1BN5A 4HNVA 1HSJA 2P5LC 2FEZA 2L4AA 3JAMZ 3FXOA 1IDYA 4XM3A 5LGNA 2R7ZJ 3TKYA 2FMLA 1E3PA 2ESHA 1IN4A 2G9WA 5FKKA 1WJFA 2AXLA 2VE9A 1TWHJ 3ZQIA 4WXHA 5AIQA 1FYLA 2MG4A 3FXMA 3CCQI 3HKZN 3H0DA 2ZNYA 3TOAA 3A02A 2I10A 2JRMA 1JI8A 3OSGA 2KMUA 2MH2A 4N0BA 2E7WA 2DYRH 1IV6A 4ZYAA 1MBEA 1QU3A 3KP4A 3B6AA 3ZXSA 5GTIC 5J1UA 1LFUP 3WHBA 4CYCA 1J09A 3S16J 2P7VB 3RYPA 1RR8C 1XS9A 1OISA 2V1DA 3V7CA 1EF4A 1FY7A 2BY1A 3N4MA 5EGOA 1LEAA 4KUMA 1B8IB 2BY0A 2DTZA 2C6YA 4BJ6C 3RDIA 3DXJF 5KAIC 1JUPA 2DMPA 3LA2A 4S04A 2JK3A 3QRFF 2RV8A 2HOTA 4IHWA 1RKTA 2DDAA 3IWFA 5HLGA 2XAQA 2LR8A 4Q47A 4W1UA 1KU9A 1XTAA 2KIUA 3MMYB 4MHGA 4AC0A 2STWA 5DUKA 1O57A 3FWEA 1B72A 1LKXA 3S15J 1FTZA 2ECCA 2DLLA 1BOAA 1W5CC 2YU3A 2XAFA 1JKRC 1POGA 4RGRA 1F4KA 5CVJA 3A4CA 2XKPA 1WI9A 3PNYA 4N9IA 5HOOA 4A3KJ 2V79A 2NOJB 3WTZA 5DD4A 3K70D 2XSDC 4LG0B 2VONA 2H1LA 3SQNA 1IXCA 1L5IA 3O3KA 4OIRF 4AU7A 4KA4A 3HUGB 4G9YA 3LAPA 1S3JA 2FD5A 2EK5A 3C3WA 1H9TA 1EH6A 1UJ8A 3OOUA 3F6VA 2CFXA 3H9QA 4M6XA 3BG9A 1WJBA 1ETQA 2AHQA 5IYCJ 5IT9Z 3U1KA 3KIOA 2ZCWA 5L3GA 3BTCA 2L7KA 2EWNA 2E1MB 3E7LA 3M4OJ 1RNLA 3JRHA 1S7AA 1S7EA 2A68F 4FQGA 1R49A 1J59A 1KA8A 4PSXA 1V4RA 4RB0A 2DMNA 4XLCA 5GADJ 1W36D 3JRBA 3S3OA 2Z5UA 2PI0A 1T8IA 4AD9A 3OYLA 2LC2A 4ZH4F 2OQGA 2LREA 3B73A 4FISA 1D1BA 2UXNA 2L9SA 2QQAA 3ECHA 4L0ZB 1WRJA 3U1DA 2HR3A 2FX0A 3ABTA 3E5QA 4CCJA 5FO5A 2CU7A 4FB3A 5IT3A 2WAQN 2MSYA 2Y0SN 2VXDA 3K4NA 3FHNA 1O7LA 5CKTA 5HLIA 1BOBA 3WTTC 5LGTA 3T8TA 1ACIA 3BT9A 3SFZA 2RAEA 3H3UA 5DV5A 4HNUA 1XMXA 5F0HA 4CHUA 2KQRA 2D45A 1YW9A 4ZQ9A 1KQ8A 1RKWA 3CZ6A 4UV8A 1FJLA 4NBQA 1X3WB 3TGNA 4ITVA 4A12A 1TC3C 3WGGA 2Y31A 1MH3A 3QOEA 4AYBA 2HPIA 4XLFA 1KZHA 2TCTA 3L2VA 2EIJH 5C4JJ 3J81Z 1GT0C 2O6GE 3M3YJ 2UWMA 3VB2A 3PJRA 1MJAA 2V9KA 2UUZA 2F4IA 2W00A 3CJTB 1NG6A 2AQEA 1AWCA 2E36A 2VQGA 5EG0A 2DFFA 4A2UA 4BE1A 4FTHA 2FJ1A 4LLLA 1PJRA 4B3AA 3BQZA 1E3HA 3TQNA 3HG9A 3SJMA 2CSOA 2V9VA 1IXSB 2DFHA 4XBFA 3F0CA 4PGHA 4BYYA 2HTSA 3K7AJ 1BBYA 3E5XA 1CF7A 4Y52J 4YFKF 3I71A 1LVKA 1N75A 4A6DA 3GFJA 2BVMA 1W7PA 4XL9A 4ESJA 4QPQA 1P4AA 2XPWA 5J3LA 2BW3B 2JSPA 2K85A 1YQAA 4BHCA 3TW7A 5J40A 4HDUA 5CVUA 3HOUJ 4X0GA 3BROA 3LWFA 1FOYA 1XN7A 4D7NA 1QQIA 1R4NB 3AL0C 3T0YA 1L2MA 4CYDA 3ZQGA 1TZLA 3G1LA 1BW6A 1W5TA 4M6YA 2EZIA 4HRIA 3ZMVA 1OQYA 1LUJB 3CP2A 3OIQA 1SVLA 2R0QC 4EATA 2JVGA 2E60A 1VFCA 5JHFA 3S2HJ 1Z67A 2HOSA 2K9LA 3ONQA 2A05A 2B0LA 3H3ZA 3A01A 2X0LA 1MMDA 4F55A 1D5VA 3JRIA 1REPC 1G59A 1EKEA 2LNBA 5EDNA 1IW7F 2DDBA 3FIWA 3HRSA 4C3IJ 1ZRCA 2K3PA 4M3DA 4CCMA 1KU3A 1MJ9A 3F8FA 3GX4X 4BY1J 2FUG2 2VL8A 4RAZA 2GWRA 3JTHA 3SFIA 2A6EF 2LOOA 2MW8A 1WPKA 3K1NA 4O6JA 1LVAA 2VLAA 3VYUB 5BYGA 1FLIA 2DQRA 2L7MP 3RZOJ 1AOYA 3I3LA 3S1NJ 1XCVA 3FXQA 3G71I 3HGGA 2VB6A 3CO7C 2JPCA 3CJNA 4HX8A 5TGTA 2Z33A 1VQ5I 1KYWA 3HJEA 1MZBA 2DMQA 5DCFA 5AIPA 2LKSA 4PDKA 1R36A 3BR2A 2VXZA 3KLOA 1QZYA 1SVMA 1HA8A 2IXSA 4XLNF 3E6CC 2L7ZA 2JA7J 2EFQA 1BIAA 3FMQA 4NC8A 2ICWG 4RGSA 4PFOA 4M3EA 2M8GX 1BR1A 3DPLC 4IF4A 3HIFA 1APLC 2GXGA 3EUHA 4S05A 3JCUC 1YLFA 4DZPA 2DT5A 2R5ZB 3WU1B 5GP9A 3MN2A 1MBHA 1D1CA 4I02A 1JXSA 2L4MA 1FOKA 2ELHA 1X2MA 2YSRA 1FMVA 1RI7A 2P0WA 3S1RJ 4BHPA 4G7ZF 5M3FJ 4L18B 4IPAA 3CESA 3I64A 4XLHA 3FK6A 4NHJA 3ZQHA 4CSWA 4M9SA 4RDUA 3V8KA 2WY7Q 1Q1HA 2V26A 1VNDA 3CCVI 1FWZA 4K2EA 3WGHA 3LSRA 5KVRA 3R0JA 1HKSA 1B8IA 4DNCA 4OAYA 3BR0A 1WI3A 3GUDA 3JSOA 1AHDP 1IRGA 3BPVA 1A5JA 3L2UA 5IYDJ 1S9HA 2XUBA 1A6QA 1SD6A 3S2DJ 2JT1A 2DJIA 2F5CA 2L9RA 3BG7A 3J80K 1VQ6I 3IH3A 1ETOA 3FMSA 1MBJA 1WGXA 1IC8A 3OMYA 4WWCA 3KZIC 4L9JA 4KIGA 1MMAA 3R6SA 5FB2A 4UUVA 3KEYA 3F21A 3OSFA 4LK1F 1YRNB 4ENMA 2QQ8A 2XB5A 3BOQA 2JPBA 2IPQX 2OJED 4LG0A 2K7LA 3H5NA 1ETXA 3H35A 3IAM2 2IA1A 2VE8A 1OCTC 3I54A 3DEUA 4CA0A 2MBFA 4DYCA 1HKTA 2ZB9A 2WAEA 1XD7A 3BTLA 5JHUA 5F27A 2EBIA 3U21A 1MSFC 2K40A 4LMYA 3A1YA 2VT2A 1H89C 4CH7A 3GFLA 4M72A 2FSWA 3OY9A 3UKGA 1YIOA 4CGZA 2K5CA 4RAGA 1XDUA 3NQOA 3P9KA 3O8HA 4RB3C 3GLLA 2WBMA 2ZC2A 3MVPA 4YELA 1JT0A 1F43A 2CQNA 1RPWA 1RUNA 1LQ1A 2UV1A 3K70C 1SVOA 5CYVA 2X9DA 1R23A 2NVYJ 2O5RA 2BHYA 2ZNZA 5ILVA 2OU2A 2HDCA 2O0YA 2Q2EB 1YE9A 3F22A 1TTYA 4MTDA 3DLAA 1J7KA 2BV6A 2X48A 1OMIA 4GDFA 2ITLA 1XMAA 4I76A 5DTDA 2LRDA 4AUXA 3O2PE 4LOCA 2DBBA 2JQ7A 1Y6IA 1OLTA 1T08B 2ISZA 1LB2A 2R3SA 5IPAA 2BBYA 5LHGA 3OYJA 1MSEC 5EEGA 3BWGA 3LSKA 4Z6YA 4LIFA 1Z0XA 5EJCA 2VBWA 4ESBA 4IHSA 4IHYA 4A3CJ 5CQEA 1MW7A 1W36C 2JVHA 2IA0A 2X51A 5ICCA 4BL0B 1NTCA 1LE8A 4ZDOA 3FM5A 2BXZA 4CXFA 1I1GA 2VBYA 3OYMA 2WB1N 2IT0A 1ZAOA 1ZHFA 3WTSC 4XONA 1ONVA 2PJRB 4BUPA 5J4VA 2XHKA 4RLQA 3ZMSA 2BXYA 3L2RA 3KEQA 2QUFA 2DA3A 3GMEA 3K6GA 4HOBA 1Y0NA 2FA5A 3K1MA 2ZJRF 4CCKA 2QLZA 4E70A 1MKMA 2A6HF 2FOKA 1TNTA 1O3QA 1KU2A 1R1VA 1BI1A 5TISC 1I3AA 2M87A 1VQ8I 4Q5SF 3EYIA 2GA1A 4N4NB 5LRSA 3OL3A 1U5TA 3L2QA 4A0YA 5D5WB 3GTOJ 2MABA 4BGDA 4X1EA 1PUFB 3G2BA 1X4OA 1XPXA 3TMOA 3M7GA 4LITA 2O7OA 4EJVA 2LF8A 3NEUA 3MKYB 1ON1A 4ENJA 2EV0A 3AG2H 1IF1A 1YIJI 2CV0A 2VPLA 3FBNB 4XQFA 2BY3A 2XAUA 3PO2J 2PMZA 3WU2C 5H2FC 1DP3A 1W4MA 5J4YA 3DQVC 3KYLA 4V2GA 2EH3A 1PP8F 5HS9A 4E7KA 3C2HA 4IRIA 2KIMA 1MBFA 3GXOA 3K69A 4ETSA 4A0ZA 2XRLA 4UVAA 2W85A 3HL2A 5JR3A 1QHGA 1YW7A 1QGPA 1U0JA 1R5ID 1R58A 4EV0A 1FBQA 2F5DA 1H8AC 3HTUA 1X1AA 2VPRA 4L5JA 2OPTA 3SHFA 3LNQA 1TP4A 1SD7A 2EZLA 3PQJA 3NWTA 2H8WA 2IS1A 1U8RA 1Z21A 2D1HA 5HLTA 1WVRA 1DU6A 4IX7A 3HOWJ 2OTLI 1LFBA 2HYFA 1IGNA 4UB8C 4O3MA 1PVEA 2VQHA 1JTYA 2H27A 2L2OA 2HU9A 1SD4A 1SMTA 5HS8A 4MEXF 3DLLF 2Y9YA 1LPQA 1FTTA 1HQCA 3I53A 5ICGA 1IXRC 4B09A 4D0PA 2OCCH 4HX7A 4BHBA 2HTJA 5A2QZ 1I27A 4YIIA 3EUHC 1B59A 2K9MA 4I98B 3RI4A 4HSTA 2F6CA 2QGUA 2VIXA 4ON0A 4ZDPA 4WF2A 4HAMA 1IG7A 4A3EJ 1P6RA 4I6ZA 4F52A 1WQ2A 1W1WE 3WG9A 4J19A 2VC1A 3HSFA 4XIDA 3QPLA 1D0YA 2YX7A 1Z6TA 3DBRB 3CUOA 3KYDB 4ASNA 1Z1DB 3H1CA 4R79A 5GPAA 4G6QA 4IOCF 1DPUA 4GCVA 2LBFB 3QU3A 3RSNA 2L0KA 4OIPF 2W82A 3RKXA 4IRHA 3S8PA 1UMQA 4IO9F 5FLXZ 2I5UA 2IGNA 1HW2A 4RAFA 2CYYA 1ZARA 3K10A 4XKWA 5F0FA 3QK2A 2E1NA 3WE2A 1ZRDA 3D1NI 4UY8I 5JLWA 3K4KA 1DPRA 3BPXA 2HOAA 2MFZA 4JP0A 3UNGC 3MKLA 4PCQA 1VF9A 3J7AO 2VUMJ 1TWGJ 3HYIA 1KYZA 3DCFA 2KL4A 5KCMA 4AIKA 1SFXA 3RKQA 2Y48A 4HLXA 1I39A 1VQLI 1JJ8C 4G12A 3RPQA 3B6CA 2JZYA 1D3YA 2L01A 4QSHA 5DCMB 3ABUA 1K4SA 1OCOH 4A3MJ 2K9QA 4KYWA 1QPMA 3GBGA 1R1UA 1K6YA 1TLHB 1LDDA 5HDGA 1LJ9A 4M74A 1YRNA 3JAMK 3CMAI 1WKMA 3W2VA 3C2BA 3M1CA 1T33A 3CP8A 3ISPA 2Q1ZB 4B43A 5ICEA 2IS4A 4NQWB 4R1HA 3GTMJ 3KZZA 2DA1A 5FKNA 3Q0VA 2E19A 3OYBA 3ROUA 3OWTA 1KSXA 3UR3C 4XKBA 2QZ8A 1K61A 3GTKJ 5J8FA 3GTPJ 2X4HA 3CD6I 4U87A 4DYQA 1YFHA 3NRVA 4ABZA 1TT0A 3QPSA 2XAGA 3IH4A 2DK8A 4LB5A 2B7EA 4CZCA 2XSJC 4JX6A 4UUTA 2CW8A 1TNSA 1P2FA 5K7ZA 2E71A 3LA3A 2FNPA 3A0HC 3LOCA 2PQ8A 1MBKA 4ZDLA 2JTVA 3ZN1A 2JRTA 2O3FA 1ETKA 4B47A 5D4RA 1HCRA 1F9NA 2ITJA 3L00A 1I3QJ 4AYBN 3ULQB 1XDSA 1IN6A 4ZC3A 4BQAA 5C4XJ 2Q2EA 1ETVA 2MC3A 2M1BA 3VSLA 5K1YA 2R7OA 3DKXA 1E2XA 2ECBA 5KK1A 2YS9A 3BG3A 1HW1A 4XOPA 4OIOF 3MKZA 3I56I 1MH4A 1PDNC 1Y0UA 3R61A 4Y3OA 1T6SA 1KQ0A 2WA0A 1Y8QB 2NS8A 3SYTA 3LSMA 1X58A 5M5YJ 2COMA 2CUZA 4C2TA 1AKHB 2HZDA 5F64A 1LDJA 5GAEJ 3OYGA 3HOXJ 4A0XA 5JI6A 3S1QJ 2L02A 4FCYA 2R7TA 3MCZA 3FDYA 2GOXB 4LG3A 4UXNA 2XAHA 2ELKA 5JLXA 4RA2A 3IP4B 2VC0A 1YYVA 2KJCA 2CFOA 4BEHB 1X2NA 2F2EA 2IGKA 2DTRA 5L3FA 2PJRA 3F6OA 2Y69H 3KETA 2ME6A 3E6BA 2MGQA 2OTJI 4ZYDA 5B66C 2HKOA 3SXYA 5F1JA 3TO7A 2NOGA 3KCCA 1NK2P 2WV1A 4J00A 1U5TC 3P9IA 2PLYA 3VYSB 2NVQJ 2M0MA 2M34A 3IWZA 2KP6A 3ZMUA 3F9KA 2RGVA 3ZQCA 2TDXA 2RQPA 1RESA 4LFUA 4BBRJ 2QKLB 3FXLA 1LDKB 1G4DA 1XCBA 1FYKA 3K9TA 1ZREA 4BY7J 2JUGA 4BH9A 4IHTA 1ZRFA 1TWAJ 3BCAA 2GM4A 3I59B 2IF9A 4HV5A 3I9V2 2V1XA 3GLXA 1ZLJA 1MIJA 4I09A 1TL8A 3F8BA 1BC7C 4HZFA 2KT0A 3RIRA 5ERIA 4O5VA 4EM1A 3S2WA 4C2UA 2BZTA 2QQBA 3PSFA 4MGRA 3PFIA 2K86A 2LKPA 5M5XJ 5IP9J 2LD5A 1W7PD 1IN7A 2DQLA 2HOEA 5HNFA 1UUTA 3BTJA 2L5QA 2LY1A 4OWRB 3LSPA 1MDMA 4MEYF 1ZK8A 3TDZC 2UXXA 5F0CA 3J81K 4FASD 4XLEA 4E7LA 4BU2A 1D0ZA 4BQNA 2BHZA 2TRTA 3S93A 1G2HA 1HSTA 2RQQA 3JRAA 4YFNF 2X6WA 1V5GA 2JA2A 2K27A 2EA2A 4LLNA 4UUSB 4BDZA 2E2JJ 3FBIB 4HPQA 3BCBA 2QBYA 1SANA 2IS6A 1FSEA 4F3QA 2W7NA 2X6OA 4L0YB 1YJWI 4YEJA 2Z3YA 3DU5A 3GVAA 1JT6A 4C2MJ 1UG2A 2GIVA 2KFDA 2ZMEA 4C9YA 4BE0A 4B4CA 2E5NA 2X6YA 2BE5F 2Y75A 3IRRA 3WTWC 2V4JC 4UVBA 4JBAA 2DA7A 2GOMA 4KT6A 5J47A 2VT3A 3WODF 2VBZA 5DYMA 4IQJA 4XMYA 1R9WA 3PO3J 3Q0UA 1UZCA 5HNHA 3CUQA 2QSGX 2KRCA 2GQQA 2LP0A 1Z1DA 2ESNA 4L9NA 4ENKA 3FF5A 1JJ6C 1FEXA 3OYIA 1VQ4I 2W84A 3HPHA 1U3EM 1VQPI 2VKHA 2X1DA 5DDGA 5FLMJ 1H88C 2HQAA 2PX9A 2XKOA 2DMUA 3D0SA 1RR7A 2M4GA 1WH7A 2XGDA 2NYXA 3OL4A 4RM2A 3K4CA 2VKDA 2VJIA 1OYIA 2NVTJ 3S14J 3NAUA 2H1KA 5FKMA 5D5XB 1SAXA 3SEZA 3JRGA 4IHVA 2NXNB 4OIQF 3CCJI 2WY8Q 4A69C 2Y0MA 2Z16A 4LLGF 3M8FA 2JUCA 4MNUA 1K78A 2VOOA 1S8NA 4YFXF 2ZJPF 1D1AA 4Y33A 1I50J 3VEPA 4F93B 2YR2A 1DGWY 1SD5A 4PFPA 2OA4A 1IAWA 1YX3A 3LSHA 5DCMA 4E4HA 4I0AA 2VKEA 2HXOA 1R71A 1HDDC 2M3AA 1R22A 3LSIA 4AM3A 3GO5A 4G8XA 1JTXA 1Y56A 1EJ9A 1RIOH 3MKWB 2G0EA 2B9SA 1LEBA 4FE4A 3O6BB 4XORA 4L5EA 4IJAA 3PUFA 4ZTFA 1W0UA 3F23A 3OR2C 5F04A 2KRHA 3HSRA 4BXXJ 3T1BA 5FFXA 1OR7A 2I8DA 5F08A 4YIRX 1FT9A 5FKLA 4U7BA 3K4BA 3WTYC 1EV7A 1JGGA 1G3SA 1BR4A 2HW0A 1TQPA 3W2WA 1ETWA 1FYMA 1SFEA 4MO7A 1ZKGA 5F1RA 2G7HA 2Z9OA 5GAGJ 2ZSHB 2EJRA 4L9VA 5E20A 4XSXF 2A5YB 5FD6A 2GBYA 3IKVA 2DK5A 2M9HA 5L3CA 1U9NA 5K5OA 2FQ3A 1NK3P 4NNJA 5J8CA 1BJZA 4KN7X 3AL0B 3OIPA 3HGYA 1O3SA 4BNCA 1FP1D 3R60A 1ORKA 1U8BA 2NVUB 2P5VA 5IP7J 1BJAA 5GAHJ 3LA7A 3CDLA 5IOZA 3QOPA 1D5YA 1F1ZA 4G6TB 2L3DA 4LIUA 3TO6A 3H36A 3WTUC 2XF6A 5ILSA 3TEDA 5LRRA 5D6FA 1MMNA 2QF7A 2F5VA 3QP6A 5HVQC 4HNTA 2EA4A 3J80Z 3SZTA 4II3A 5EYRA 3VDXA 1UB9A 4QIWN 1T0FA 2VASA 3BZKA 1P9QC 3HDDA 3FXJA 5CYNA 3PIOF 2IBDA 3C7JA 2FXAA 4P9FA 3M8EA 3HUGA 4C3HJ 3HC7A 4BEHA 4KIFA 2DPUA 4D7MA 1BI2A 1G6NA 1T56A 2DA4A 2PMZN 3VODA 3K2ZA 5JFRA 4BDYA 1UCRA 3TL4X 3H5AA 1S6LA 3ZGKA 2KLOA 4KITB 3KP5A 2QSHX 2HZTA 2XPVA 1OCZH 3D5LA 1QZZA 2MLGA 2F4MB 4DQ2A 3G3ZA 3AG4H 2ETHA 4PJ0C 3K4JA 4E6KG 3OS0A 2DA2A 5E79C 5CLSA 3HRMA 3QODA 1T38A 4WXCA 1XGSA 2FBHA 5GPCA 3ZRGA 3EUKL 2FUFA 1MMSA 5FRMA 1T95A 1O3TA 3CCUI 1SFKA 2D1VA 3C1DA 1N78A 5BQTA 1P7IA 2QEXI 1IDZA 4UB6C 2M5WA 3DKWA 4HQEA 1QVTA 3S17J 1WHUA 2DW4A 2OC6A 3P7NA 4II2A 5HS7A 1R5GA 3L09A 2ZFWA 4F7ZA 2WV0A 5LLQA 4L9TA 4IXAA 4CYCB 5IYBJ 3GW2A 4EGYA 2R5YB 3OYDA 3I59A 1U2WA 3DTKA 1VQ7I 2CH0A 3L1PA 2GXAA 2R7QA 1IRZA 1IRXA 3V42A 4XK4A 2GLOA 3GTJJ 3KZYA 1UAAA 3QYBA 3V7SA 2VJJA 4XRMA 2RDPA 3DPTA 1I6XA 3KP3A 1GV5A 1UFMA 4YG2F 1WCMJ 1X3ZB 1E17A 1FP2A 5D9IA 3MFKA 3RPUA 2JA8J 4UV9A 2H6BA 3BJOA 3SEQA 1FMWA 2EFPA 2LY9A 1B72B 4FE7A 2DOEA 2CQ7A 4IEJA 4XR6A 3ZQ7A 2CG4A 4OOIA 3DTEA 3SZGA 3CC2I 3FISA 2ZO4A 3HSEA 4GGGA 4MFEA 3DBLB 3DBHB 2EV5A 1TT5B 1NH3A 3QP5A 3J7YJ 2AO9A 2KZVA 1DU0A 1MNMC 2D2WA 4FT8A 1FPQA 3HPGA 2LMDA 3CTAA 4UNOA 1SEUA 3H9GA 3OS1A 3OYEA 1DDNA 1Q1VA 1QVUA 1VQNI 1XMKA 4KFCA 4RAYA 2VQCA 4GXOA 4KN4X 4A3BJ 3M1EA 3A03A 1XGNA 2IA2A 4NB5A 2FBKA 3AG1H 5ILUA 1Z7LA 3QAHA 5LHHA 2MD0A 3ZR8X 4DGWB 1TW2A 5BPIA 5B3SH 2CV2A 2BW3A 4D5CA 4MFDA 3CLOA 3F8NA 4ENNA 3LSTA 1GXPA 1OFCX 2QKMB 2P7CB 2QENA 2DI3A 1W0TA 3SDBA 3DEEA 3W2AA 2CJJA 2RVCA 2MC4A 4EJOA 3E6MA 4XLAA 6PAXA 4OAZA 4ZTJA 4F92B 4AIHA 3DTIA 4Y17A 2BYVE 2HGCA 2VJ4A 3ERED 1GVJA 2V6EA 4L5IA 5GTHC 1WH5A 1ZGWA 4A3GJ 1KGSA 5C44J 4CCNA 5ED4A 4U7DA 4HW0A 2GIZA 1H0MA 2E7XA 2MH9A 3F8CA 2JSCA 3BTIA 4LMDA 1TW3A 1HF0A 1XSDA 3QU6A 4YIFA 2XC7A 3HBLA 3OYAA 3WTVC 1XSVA 4E7SA 3G4SI 1ODDA 1USTA 2YUSA 1EH7A 2KISA 1KONA 4I99C 4KICA 4XOTA 5EZGA 4DBQA 1JUSA 2JA6J 3ASOH 1SC7A 1V5FA 1ZYRF 3BJAA 4IRGA 1MMGA 1WJCA 1X4PA 3JRDA 2EFNA 2WAFA 4B8XA 3E97A 4LK0F 1YITI 3I0TA 1ZN2A 4DOZA 1YG2A 2IVMA 1D8JA 4A3JJ 3TP0A 1A04A 3G1MA 4PJNA 5LGUA 1SFUA 3ZOBA 1QNTA 4R8HA 4LD5A 3WU0A 4C3JJ 4B44A 4BBSJ 3DEWA 5HLHA 2OUMA 3VWBA 2IP2A 1QA6A 1Z3YA 1W5SA 3KP6A 3TO9A 4ZJZA 1ENHA 1D8KA 2E5ZA 3HTSB 1DGRM 5A2QK 3CC7I 2Y2ZA 1VQMI 4IKFA 3IAS2 5BMZA 4DW6A 2DA6A 3A0BC 3JSPA 1R9TJ 1V5EA 3V4GA 3EPZA 4PGGA 1QHHD 3WE3A 4GYGA 1T39A 1U78A 4IHXA 3DV8A 3FKIJ 5B5EC 3GEZA 2QSFX 2R5ZA 4NBPA 1HXDA 2CQQA 1CF7B 3BR1A 3W6KB 4DZJA 2CUFA 2L9VA 2LF7A 2NAZA 3DP7A 3QYFA 5D5VB 4EJTA 2CV1A 5E3LA 1MBGA 2O8XA 1BI0A 2HNHA 1K7AA 4WX9A 4UHTA 1ZGAA 3Q9SA 3TBIA 1T98A 3P9CA 3RCOA 5M3MJ 4DJAA 3ABMH 1S29A 4QTRA 2XF5A 2CMPA 5DD8A 2R7SA 2YU9J 1GV2A 2LSOA 1U6GA 1QRYA 1L3LA 2M8EA 2DA5A 3PNTA 4S0HB 3IRQA 5TJJA 5FLXK 2LVSA 5K5RA 4BACA 4GRIA 4BKXA 4HF1A 1G3YA 1CQTA 2COBA 2NNYA 4ZZLA 1FC3A
chains in the Genus database with same CATH topology
3H9JA 1LDKB 4D9JA 1HA8A 3VYRB 2IXSA 3CF2A 4NC7A 4J01A 4NC8A 2JUGA 4KJZA 1WJ5A 3BCAA 4PFOA 3C2GA 4YRVA 1BR1A 3DPLC 2IF9A 1X1BA 3OS2A 3I9V2 2HVRA 1MNEA 1WFXA 2XF7A 2ZSIB 4ANJA 3QFQA 3VYTB 1D1CA 2RNGA 3QYEA 1SAUA 4Y4RA 4XN3A 4C2UA 1N77A 3PSFA 4LIVA 2R7WA 1FMVA 1X19A 2P0WA 2IGMA 3CESA 5HNFA 1UUTA 4XLHA 4PJLA 4CSWA 2L5QA 4PUSA 2LY1A 2ZFUA 2WY7Q 3OR1C 4OWRB 4BE2A 2V26A 2IGOA 2X85A 4FASD 4XLEA 4E7LA 2TBDA 4BU2A 1D0ZA 4BQNA 4OAYA 3D5RC 2RREA 3S93A 3L2UA 2E1MC 2RQQA 1S9HA 2X6WA 1V5GA 2JA2A 2BOLA 2DJIA 4BDZA 5CPRB 3FBIB 4HPQA 3BG7A 3PL8A 1WJDA 3BCBA 2IS6A 4F3QA 2W7NA 3OMYA 3LSGA 4YEJA 3EUAA 3PFYA 3DU5A 3ZCOA 4ZO0A 1MMAA 3KEYA 2X6XA 3LMMA 4CUGA 4C9YA 3RQ4A 2A5WA 4BE0A 2E5NA 2X6YA 1X1CA 2V4JC 2GOMA 4KT6A 5KNLA 4IQJA 2R7VA 4JOMA 4PJMA 2V1NA 2HDWA 3OYNA 4XMYA 1R9WA 3H5NA 3H35A 3IAM2 4N4OB 4CA0A 2L9NA 2WAEA 5HNHA 3OYCA 3PUBA 3U21A 2KRCA 3NWSA 3A1YA 3MD2A 4DBRA 4KW3A 2OV7A 4CH7A 3OY9A 3OYIA 2DT7B 3HPHA 4BJTA 2VKHA 2X1DA 1LFPA 2K5CA 2HQAA 4PJJA 1VZ0A 2M4GA 3E0JB 2WBMA 3AFHA 3OL4A 1OR7C 1BR2A 1WJEA 4RM2A 4YELA 3CJRB 3K4CA 2VKDA 5KHDA 2VJIA 5FRNA 2UV1A 4XN0A 3K70C 2ZXIA 3SEZA 2O5RA 3VSKA 1PYVA 2Q2EB 2WY8Q 2DCEA 2Z2SB 1YE9A 5LFAA 2Z16A 2LYCA 3DLAA 2WB1A 2ITLA 4GDFA 1D1AA 4Y33A 2LRDA 1TBDA 2LG4A 4F93B 1DGWY 4PFPA 1YX3A 3LSHA 1Y6IA 1OLTA 4RM3A 4E4HA 2X1CA 3DKYA 3OYJA 4LIFA 3LSKA 1NG7A 2HVSA 2M3AA 4FGNA 4P5OA 3LSIA 4D1QA 3IUOA 5CQEA 1MW7A 3H5RA 5LD2C 1W36C 2JVHA 2X51A 4BL0B 1MNDA 1Y56A 4ZDOA 2BVLA 3MKWB 1Z3XA 4XORA 3DU6A 4ZTFA 3OYMA 3KX2A 3D5SC 3OR2C 1AA7A 2ELJA 2KRHA 2PJRB 2NL8A 4XONA 3OYFA 4BUPA 1T0FC 2M7AA 2I8DA 4RLQA 3PNVA 3L2RA 4U7BA 3K4BA 4XKCA 3K6GA 4B3XA 2R7RA 1BR4A 2W1OA 4CCKA 2HW0A 3W2WA 1X1DA 1KSYA 2R7UA 3BC8A 3HKZA 2ZSHB 4MLOA 2XDVA 1DQUA 4N4NB 3E1SA 1E0EA 3OL3A 3L2QA 4HSRA 2MABA 4BGDA 2AQFA 3G2BA 1X4OA 4NNJA 4XM3A 3TMOA 4LITA 3AL0B 3OIPA 3MKYB 4FETA 2V7FA 3CJQB 1WJFA 2CV0A 2VPLA 1UELB 3FBNB 4XQFA 2ZXHA 2XAUA 2W4SA 2PMZA 4BS9A 1DP3A 4G6TB 4BXFA 3BLYA 3DQVC 4LIUA 2IPRA 3KYLA 2Z1DA 5FROA 3H0DA 2XF6A 4E7KA 4DIQA 3C2HA 1MMNA 4XNFA 2F5VA 5HVQC 1JI8A 2KMUA 4HNTA 4ZYAA 3HL2A 1QU3A 4II3A 3VDXA 3ZXSA 2VASA 2WADA 1P9QC 1QHGA 1U0JA 1J09A 5CYNA 1D0XA 1X1AA 3HC7A 4BEHA 3NWTA 3L2WA 2IS1A 4BJ6C 1Z21A 5HLTA 4AVZA 4JQFA 4BDYA 2LBFA 4IX7A 3TL4X 3H5AA 3ZGKA 2KLOA 1RZ9A 4KITB 3D5LA 2VQHA 3HOSA 2L2OA 4E7ZA 2HU9A 3K4JA 4E6KG 3MMYB 3OS0A 3QODA 3ZRGA 1LKXA 3EUKL 2FUFA 5FRMA 1T95A 1YX5A 1SFKA 1N78A 4NUBA 4PK4A 4BQQA 3EUHC 2K9MA 2OC6A 4II2A 3A4CA 4HSTA 3PNYA 5HOOA 1R6RA 2F6CA 2VIXA 3K4MA 2NOJB 4ZDPA 3OYDA 3DTKA 3K70D 4F52A 3S32A 2CH0A 2R7QA 1L5IA 1IRXA 3V42A 4AU7A 3HUGB 1D0YA 1UAAA 3QYBA 1Z1DB 2VJJA 4R79A 3DPTA 4IZZA 1ERDA 1F08A 2LBFB 3OOUA 3H9QA 3RSNA 2M4KA 1WJBA 4B48A 5D9IA 1GLNA 2W82A 3S8PA 2L7KA 2WAQA 2IGNA 2Y0SA 2E1MB 3SEQA 1FMWA 3K10A 4XKWA 3QK2A 4PSXA 4PSWA 4XR6A 3ZQQA 4XLCA 3DTEA 3K4KA 3S3OA 3SZGA 1W36D 2MFZA 2HPMA 3UNGC 3LFUA 2LH9A 3J7AY 3OYLA 2LC2A 1M55A 2KZVA 2LREA 3FKJA 1D1BA 2L9SA 5KCMA 2KL4A 2NTCA 3HPGA 3DPUA 3H9GA 4CCJA 3OS1A 3OYEA 4FB3A 3CMMA 2VXDA 3K4NA 1G8XA 2VQCA 3FHNA 2MYSA 5CKTA 1BOBA 3GBGA 1UG0A 3N05A 1K6YA 4HNUA 1Z7LA 3A2KA 2KQRA 2MD0A 3ZR8X 4DGWB 2CS3A 4ZQ9A 2CV2A 3W2VA 2BW3A 3CZ6A 4E7HA 3M1CA 3HXLA 3CP8A 4ITVA 4B43A 2Q1ZB 2CUJA 4HEA2 2IS4A 4NQWB 2KDOA 2QKMB 3QOEA 4AYBA 2HPIA 4XLFA 3SDBA 3OYBA 3L2VA 2UWMA 3OWTA 3DEEA 1KSXA 3W2AA 3UR3C 3PJRA 3AKZA 2V9KA 2UUZA 4XKBA 2F4IA 2MC4A 2W00A 3S3NA 1NG6A 3W3CA 4XLAA 4OAZA 4U87A 2AQEA 4F92B 4ZTJA 3DTIA 2VQGA 2VJ4A 4XKVA 1TT0A 2V6EA 4BE1A 4P1WA 4CZCA 2HVQA 4CCNA 3HOTA 1PJRA 2XSJC 2CW8A 2LY2A 2R7XA 3HG9A 4LMDA 2XC7A 4ZDLA 3OYAA 2KPMA 3QN2A 3RTRA 3M8JA 4E7SA 4B47A 4DBQA 1KONA 3S3MA 4XOTA 3BG6A 2IS2A 4E7IA 4F91B 2ITJA 1LVKA 1N75A 1ZELA 1V5FA 3OYKA 3DWLE 2BVMA 1MMGA 4XL9A 4ZC3A 4QPQA 1WJCA 1X4PA 2BW3B 3K4LA 3VSLA 2WAFA 2JSPA 2R7OA 3DKXA 4QPOA 4DOZA 2R4GA 2DT6A 4XOPA 4X0GA 2X1EA 3RPUD 3MKZA 4PJNA 1WJAA 4RLFA 4Y3OA 3AL0C 1L2MA 2WA0A 4CCOA 4B44A 4BQOA 2VJ5A 2OUMA 2VQLA 3LSMA 1TZLA 3SYTA 5DCXA 3VWBA 2CUZA 4C2TA 1Z3YA 4HRIA 2HZDA 4ZJZA 2E5ZA 3OYGA 3CP2A 1DGRM 3OIQA 4EATA 2JVGA 2DXIA 2E60A 4IKFA 3IAS2 5CQGA 2R7TA 5JHFA 3FDYA 2GOXB 4HG2A 4LG3A 4CCLA 1V5EA 2A6TA 2K9LA 3EPZA 3ONQA 1QHHD 2DOAA 1MMDA 4F55A 1G59A 3IP4B 2CFOA 4NBPA 4BEHB 2IGKA 1EA3A 3PSIA 4RMNA 2PJRA 2K3PA 4CCMA 2M7BA 3QYFA 4IQ4A 4C30A 2FUG2 2VL8A 2CV1A 2LOOA 2VLAA 2HNHA 3VYUB 5BYGA 4J00A 3TBIA 3VYSB 3RCOA 4E7JA 4DJAA 2XF5A 2CMPA 2M0MA 3I3LA 2R7SA 2KP6A 2KHMA 2CW7A 3F9KA 3PNTA 2VB6A 4BJ5C 5TGTA 4BACA 4GRIA 3OYHA 4KISA 2QKLB 4H4KC 2VXZA 3LL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKX A;  4U87 A;  3DKY A; 
#chains in the Genus database with same CATH topology
 5E3N A;  1MGT A;  3JRF A;  1JKO C;  2BY2 A;  3IKT A;  3K2A A;  1X1B A;  4MQV A;  3OS2 A;  1A31 A;  3JR9 A;  1FOW A;  2Q8K A;  2CRG A;  1J0R A;  1VQO I;  4G6D A;  2HVR A;  1MNE A;  1IO2 A;  1WFX A;  2IEK A;  3BR6 A;  1EH8 A;  4MTE A;  3BZ6 A;  1SFO J;  3QFQ A;  2W48 A;  3KP7 A;  5B1B H;  2RNG A;  3QQA A;  5M5W J;  4IOA F;  4WCG A;  3ZP5 A;  4Y4R A;  5H20 A;  3VOE A;  1N77 A;  4A3I J;  2QCO A;  3JRE A;  1JKQ C;  3IHU A;  1ETY A;  2BGC A;  2DOF A;  2EIM H;  2IGM A;  4EJU A;  2XB0 X;  3BZC A;  4GO1 A;  3GFM A;  2KDZ A;  2QQ9 A;  4PJL A;  3BG5 A;  5BS6 A;  4RB2 C;  3MQ0 A;  3OR1 C;  3VFZ A;  2YPR A;  2NNN A;  2IGO A;  2F5F A;  2FQ4 A;  4EGZ A;  1ZQ3 P;  3MZY A;  1B9N A;  3ASN H;  2RC4 A;  4CIC A;  3ESW B;  2EIK H;  1FSH A;  1BI3 A;  2K02 A;  2JJ7 A;  2E35 A;  2QWW A;  4M6V A;  1RZ4 A;  1JHF A;  2E1M C;  4IL6 C;  1PUE E;  2CGP A;  3AG3 H;  3EQL F;  2Z99 A;  2VI6 A;  3GTQ J;  2YX4 A;  2BOL A;  1BC8 C;  3GWZ A;  1B9M A;  5E18 F;  2NS0 A;  3CDI A;  1WJD A;  3GF2 A;  5E8I A;  3HOV J;  3RYR A;  1ZR2 A;  3T8R A;  1IZ1 A;  3LSG A;  2F4O B;  3EUA A;  3REO A;  2GA2 A;  4HDV A;  5E1Z B;  3RQI A;  4AWX B;  2WTE A;  3SZP A;  4B1R A;  2M2E A;  2VOD A;  2J5O A;  2X6X A;  2DO7 A;  3LMM A;  3RQ4 A;  2A5W A;  4D5F A;  5L3B A;  4I2O A;  5LEJ A;  1BA5 A;  2GAU A;  3KPH A;  3GTL J;  5KNL A;  2R5Y A;  1LNW A;  3OV8 A;  1RUO A;  3OYN A;  1MJB A;  2HDW A;  1WSU A;  5EZH A;  3OIO A;  4N4O B;  4OMZ A;  2L9N A;  3E5U A;  3HHH A;  4HF0 A;  3JTG A;  4U0V A;  1OCP A;  3BY6 A;  3MD2 A;  1R7J A;  4DBR A;  2A3S A;  2OV7 A;  4XRS A;  1XG1 A;  1WZ2 A;  4BJT A;  2K3F A;  3W6V A;  1LFP A;  3J7Z I;  1JE8 A;  2ZKZ A;  2OF7 A;  2QM3 A;  4PJJ A;  5HDN A;  2JWT A;  2G7U A;  1Y1V J;  2FE3 A;  1OPC A;  4HBL A;  1Y39 A;  1BR2 A;  1WJE A;  2FBI A;  3CJR B;  2H94 A;  3GCM A;  2FF4 A;  2E34 A;  1Z91 A;  3Q9V A;  4ZZD A;  2M45 A;  2O03 A;  3ABL H;  2GZW A;  2RKH A;  5KHD A;  4JX5 A;  1J75 A;  3F8M A;  4JK1 X;  4RBO A;  2HEO A;  2CQX A;  5E3M A;  1PYV A;  1R5H A;  3FMR A;  5FKO A;  3I4N J;  2DCE A;  2D5V A;  5LFA A;  2XV4 S;  2LYC A;  5BPD A;  3RZD J;  2EV6 A;  3GFI A;  5IT9 K;  2OCE A;  3JW4 A;  4EVI A;  3IC7 A;  1ULY A;  2XRN A;  4RB1 A;  1TBD A;  2LG4 A;  4KIB A;  2HS5 A;  5F6F A;  4HF2 A;  5IP6 A;  1I1S A;  3Q3S A;  3COA C;  4AVP A;  5E17 F;  3MEX A;  3B02 A;  4KDP A;  2X1C A;  3DKY A;  4HYE A;  5TRD A;  2EZH A;  1PUF A;  4XLP F;  3CQZ J;  2HVS A;  2OBP A;  1GXQ A;  4I01 A;  4BXU A;  4D1Q A;  3IUO A;  4RGU A;  1A6I A;  3H5R A;  5LD2 C;  2MD5 A;  2LK2 A;  1KQ9 A;  3ZQL A;  1ITY A;  4CO8 A;  1G3W A;  1F36 A;  2F48 A;  3VPR A;  3D5S C;  2M30 A;  2DAO A;  2PFB A;  3ELK A;  3Q0W A;  5D4S A;  4OIN F;  2E1C A;  1Z05 A;  2ELJ A;  5K5Q A;  3OYF A;  2HWV A;  4FX4 A;  1G3T A;  3LFK A;  4QWQ A;  2KRF A;  2P6T A;  3KP2 A;  4A5M A;  4A3D J;  2VOP A;  3HM5 A;  4XKC A;  3ERM A;  2EZK A;  1ZTR A;  5CVV A;  4B3X A;  3JRC A;  3L7W A;  3CCM I;  4FHT A;  1X1D A;  3FXR A;  2R7U A;  3HKZ A;  2O8K A;  1QPI A;  1XGO A;  1FZP B;  3QPH A;  2VN2 A;  3DFG A;  2EIN H;  2VBX A;  3FK7 A;  1DQU A;  1MD0 A;  3G6E I;  1E0E A;  2OZU A;  2FMY A;  1YI2 I;  4HSR A;  2EFO A;  3ZN0 A;  2AQF A;  3HHG A;  1FNN A;  3IH2 A;  1ZG1 A;  4FET A;  2KKO A;  3T5X A;  4W97 A;  2E1O A;  1Z7U A;  2V7F A;  3CJQ B;  1LE8 B;  5EEA A;  1UEL B;  4XRF A;  5B1A H;  4FX0 A;  2ZXH A;  1E3O C;  2H8R A;  1M1E B;  2W4S A;  1OJL A;  3BR5 A;  4BS9 A;  3R0A A;  4BXF A;  1IV8 A;  3BLY A;  5E1X A;  2IPR A;  2Z1D A;  5FRO A;  2XRO A;  3CDH A;  4DIQ A;  3LAJ A;  4G7O F;  3OOP A;  4XNF A;  2A61 A;  3ABK H;  4EM2 A;  2ZBK A;  1TQI A;  3GTG J;  2O61 A;  4BAY A;  2R93 J;  3H3V K;  1HW5 A;  2ID3 A;  1XSX A;  2WAD A;  3GZN B;  2RNJ A;  5DS9 A;  5ICF A;  1D0X A;  4RGX A;  4Y7N J;  2GXB A;  1U5T B;  3ZMD A;  4EQQ A;  3CCR I;  1GUU A;  3L2W A;  4TV7 A;  2HYJ A;  4OMY A;  4AVZ A;  4JQF A;  2LBF A;  2R7D A;  3H92 A;  1J5Y A;  5CVR A;  1RZ9 A;  4KNY A;  3EYY A;  1BIB A;  2JMW A;  3MWM A;  3HOS A;  4E7Z A;  1BL0 A;  1X1P A;  2KIQ A;  3EET A;  1ZG3 A;  2HKX A;  3RJP A;  2VKV A;  3G1O A;  4Q4Z F;  3GZ5 A;  1DP7 P;  1FBS A;  2IW5 A;  1QBJ A;  4M3F A;  1YX5 A;  1KU7 A;  4XSZ F;  4NUB A;  4PK4 A;  4BQQ A;  4GFB A;  1ON2 A;  4WXD A;  5L3D A;  4DYR A;  2XGX A;  5BNG A;  3E3V A;  1R6R A;  2BEO A;  3K4M A;  2JA5 J;  3PIP F;  4P55 A;  4Y15 A;  1JGS A;  3FX3 A;  5KAF C;  2CO5 A;  3S32 A;  2FOW A;  1IRF A;  1R4M B;  4IVN A;  2LDU A;  4MQ9 F;  3TDU C;  1HC8 A;  2P4W A;  3I55 I;  2QA4 I;  4X6A J;  2DU9 A;  2XGE A;  3TOB A;  5L3E A;  4IZZ A;  1ERD A;  1F08 A;  1R1T A;  4LGW A;  2M4K A;  5EF6 A;  4B48 A;  2A69 F;  1V55 H;  2V6C A;  1GLN A;  2EFW A;  1FIA A;  4M3B A;  2WAQ A;  2Y0S A;  2QVO A;  2LKX A;  4NQW A;  2Y9Z A;  2V1U A;  4KT5 C;  3CCL I;  1V54 H;  2IJL A;  2DOD A;  2W25 A;  3U9G A;  1VQK I;  2PBI A;  4PSW A;  3WTX C;  1OCR H;  3ZQQ A;  5LHI A;  2LFB A;  1T2K A;  2XAJ A;  5E3O A;  2HPM A;  3LFU A;  2LH9 A;  4M73 A;  3J7A Y;  1QO0 D;  2AXT C;  1RET A;  3M07 A;  3BR3 A;  2HQN A;  1M55 A;  2DJN A;  3FKJ A;  2NTC A;  1FIP A;  4KMU X;  3DPU A;  3HEF A;  1GVD A;  1B6A A;  2XGC A;  3FM3 A;  4NC6 A;  2A07 F;  3ZQF A;  1YS6 A;  3CMM A;  5JVG F;  1HBX G;  1G8X A;  2DYS H;  2MYS A;  1IN5 A;  3LQR A;  1F5T A;  2K4J A;  1UG0 A;  3N05 A;  4V19 K;  3A2K A;  4WK8 F;  4HLY A;  3O8G A;  2CS3 A;  5J1R A;  1FX7 A;  1A36 A;  4E7H A;  5FD5 A;  3HXL A;  2PMH A;  3V8L A;  4HEA 2;  2CUJ A;  3CLQ A;  2O9L A;  3FXK A;  4CZZ A;  1USS A;  2HQR A;  2KDO A;  1YJ9 I;  3F3X A;  4GYI A;  3ECO A;  3QWL A;  3AKZ A;  1UHW A;  1IN8 A;  3S3N A;  3W3C A;  1K6O A;  1AKH A;  2IAI A;  1Y8R B;  1FBU A;  4XKV A;  1S7O A;  3BQY A;  3HOZ J;  4P1W A;  3BDD A;  5IOY A;  1I5Z A;  2HVQ A;  3HOT A;  2LY2 A;  2K9N A;  3Q5F A;  2R7X A;  2H6C A;  3I58 A;  1CGP A;  4QLC U;  2KPM A;  5J1Y A;  3QN2 A;  3RTR A;  3M8J A;  1BM9 A;  3ZMT A;  4P9U A;  2HXI A;  4A3L J;  3S3M A;  3BG6 A;  2IS2 A;  4E7I A;  4F91 B;  5D8K B;  3OYK A;  1ZEL A;  2Y30 A;  3DWL E;  2PG4 A;  3HOY J;  1O3R A;  2MLK A;  3CCE I;  4EJW A;  3E6D A;  3K1P A;  3K4L A;  4ESF A;  4QPO A;  2NRA C;  2R4G A;  3NAR A;  2DT6 A;  2X1E A;  3RPU D;  4PZJ A;  3HB9 A;  5LEK A;  1WJA A;  4RLF A;  3CCS I;  1P4W A;  4CCO A;  4BQO A;  2VJ5 A;  5IY5 H;  3FHZ A;  3FXU A;  2VQL A;  5DCX A;  2R7F A;  2DN0 A;  3BJ6 A;  4Z2Y A;  3MZH A;  1N25 A;  3CCY A;  2XVC A;  4Y13 A;  2DXI A;  3TP3 A;  5DM7 F;  3CMY A;  3MAJ A;  5CQG A;  5D6E A;  2QYO A;  4HG2 A;  1JUM A;  4CCL A;  5H6Q A;  2A6T A;  5BOX A;  1YTY A;  1B4A A;  2WWY A;  3I4M J;  2DOA A;  1HLV A;  2Q0O A;  2M0C A;  4KMF A;  2WC2 A;  3I5U A;  5EGO B;  1EA3 A;  3PSI A;  4U88 A;  3KYC B;  4RMN A;  3W6J B;  2ID6 A;  2M7B A;  4IQ4 A;  4C30 A;  1IUY A;  3V8J A;  5FGM A;  4AID A;  4UVC A;  3X2Q H;  3ZMZ A;  2P8T A;  2PEX A;  2RN7 A;  2OQR A;  1VI0 A;  2AS5 F;  2XPU A;  1ZH5 A;  3BP8 A;  2L54 A;  4I7H A;  4E7J A;  1P4X A;  4M9Z A;  3ML6 A;  2FRH A;  2KHM A;  2CW7 A;  2JN6 A;  4RS8 A;  4BJ5 C;  3KE2 A;  3OYH A;  4KIS A;  1STZ A;  2W57 A;  2IRF G;  3L2C A;  2NS7 A;  4H4K C;  3TW6 A;  1JKP C;  3LL7 A;  2XAS A;  1OKR A;  3H9J A;  4D9J A;  4ZYH A;  4A3F J;  3VYR B;  3CF2 A;  4NC7 A;  5AON A;  1O4X A;  1Y1W J;  4J01 A;  1GHC A;  2NVX J;  1TBX A;  3HZJ A;  4KJZ A;  2EQR A;  5HDK A;  2ADU A;  1WJ5 A;  3QPT A;  5CVI A;  3C2G A;  4YRV A;  4UUS A;  5DM6 F;  1TWC J;  1O7F A;  4EM0 B;  2OZ6 A;  2PJP A;  2XF7 A;  2ZSI B;  2HFH A;  4ANJ A;  2ZME C;  3DF8 A;  2L7F P;  4EEF G;  3VYT B;  1H9G A;  1HOM A;  5FFZ A;  3LQQ A;  3QYE A;  1K83 J;  1SAU A;  4HV6 A;  4XN3 A;  2DMT A;  4EMS A;  4JYK A;  2EIL H;  1NHA A;  4LIV A;  5JVT A;  3HRT A;  2R7W A;  1UHM A;  1X19 A;  1OCC H;  3CO6 C;  3CUQ C;  2R92 J;  2ACJ A;  1XGM A;  2HQ5 A;  4I0B A;  4G94 A;  4PUS A;  2ZFU A;  5C3E J;  4BE2 A;  1YJN I;  1RC9 A;  2DFE A;  2X85 A;  1J9I A;  1VTN C;  1AU7 A;  2FNA A;  1X3U A;  3WG7 H;  3WHC A;  2TBD A;  2CWE A;  1OYY A;  2P81 A;  3D5R C;  2HDD A;  4P96 A;  2ME0 A;  2RRE A;  2XIG A;  1DUX C;  5FLV A;  4H0E A;  1P7J A;  1P92 A;  1K4T A;  2STT A;  5CJ9 A;  1L0O C;  3G73 A;  4AIJ A;  3KLN A;  4XIC A;  1FOX A;  1Z6R A;  5CPR B;  1YW8 A;  3PL8 A;  4LB6 B;  4ZYE A;  3MZ8 A;  2EPF A;  3FZV A;  3R4K A;  3HRU A;  1ZLK A;  3KFW X;  4XRS G;  1S72 I;  2CW0 F;  2W24 A;  3PFY A;  3ZCO A;  4ZO0 A;  1HKQ A;  2KZG A;  2P5K A;  3CC4 I;  4CUG A;  2DPD A;  1ZG5 A;  2K9S A;  1V3F A;  1B1B A;  3C18 A;  3RKY A;  3KEO A;  4HX4 A;  3P5J A;  1X1C A;  4HA8 A;  4CDG A;  4JX4 A;  2OD5 A;  2OAZ A;  2R7V A;  4JOM A;  4PJM A;  2V1N A;  1MDM B;  1HDP A;  1XX5 A;  2ISY A;  3OYC A;  3PUB A;  3NWS A;  1ZR4 A;  1Z9C A;  1BW5 A;  3SDG A;  2ZXW H;  1ZGJ A;  1IJW C;  1WWX A;  4KW3 A;  3CF5 F;  5EG0 B;  2DT7 B;  5HOD A;  5D8L B;  4U0W A;  2KIF A;  2HYG D;  4A6E A;  1GDT A;  1VZ0 A;  2EB7 A;  3AAF A;  2QBY B;  3E0J B;  3AFH A;  1OR7 C;  1UHS A;  4Q48 A;  4A93 J;  1YOV B;  5FRN A;  2E2H J;  3F72 A;  3I4P A;  4XN0 A;  2E2I J;  5EEH A;  4G7H F;  2ZXI A;  1PP7 U;  1YS7 A;  3VSK A;  4N9H A;  1W7P B;  2ZME B;  2UZK A;  5LBQ A;  3PM1 A;  2Z2S B;  4OU0 A;  3RKW A;  3ZPL A;  2WB1 A;  2LLK A;  1RRJ A;  1VQ9 I;  2H09 A;  2MA3 A;  2PMU A;  3GZ6 A;  2PN6 A;  3CUQ B;  5K7H A;  2K4B A;  4RM3 A;  1YO5 C;  1JHH A;  4M3G A;  2N8G A;  2ZXJ A;  2FU4 A;  1Z77 A;  1TWF J;  1NG7 A;  4FGN A;  2CQK A;  4P5O A;  1TQM A;  1A35 A;  3H0G J;  5J6X A;  4U0Y A;  1XC5 A;  2KJB A;  3GYH X;  4A5N A;  1C0W A;  2CUE A;  1MND A;  1U9O A;  2V9P A;  3A01 B;  1IUF A;  3CME I;  2BVL A;  1OYW A;  5FJ8 J;  1XB4 A;  1Z3X A;  3K0L A;  5D5U B;  3DU6 A;  3LSJ A;  1R00 A;  1S5L C;  3KX2 A;  3U2R A;  2B63 J;  3S1M J;  1AA7 A;  1J2X A;  2P6S A;  3V7R A;  9ANT A;  2ZJQ F;  2NL8 A;  1T0F C;  1SMY F;  2M7A A;  2DFI A;  3N97 A;  3PNV A;  5DEQ A;  5DUI A;  2J5P A;  2ZJ2 A;  4HQM A;  2R7R A;  1I6H J;  1QZE A;  2W1O A;  5E8G A;  4NDL A;  1K78 B;  4MIM A;  3L9F A;  1KSY A;  3IL2 A;  1K79 A;  3BC8 A;  2F5E A;  1YHQ I;  3WGI A;  2LTP A;  4LJZ F;  3M9A A;  4M9X A;  4MLO A;  5H6R A;  2XDV A;  3EDP A;  3PQK A;  4V2F A;  3E1S A;  4M71 A;  2HI3 A;  5K7F A;  4ZYG A;  5E1W A;  3IV5 A;  1BN5 A;  4HNV A;  1HSJ A;  2P5L C;  2FEZ A;  2L4A A;  3JAM Z;  3FXO A;  1IDY A;  4XM3 A;  5LGN A;  2R7Z J;  3TKY A;  2FML A;  1E3P A;  2ESH A;  1IN4 A;  2G9W A;  5FKK A;  1WJF A;  2AXL A;  2VE9 A;  1TWH J;  3ZQI A;  4WXH A;  5AIQ A;  1FYL A;  2MG4 A;  3FXM A;  3CCQ I;  3HKZ N;  3H0D A;  2ZNY A;  3TOA A;  3A02 A;  2I10 A;  2JRM A;  1JI8 A;  3OSG A;  2KMU A;  2MH2 A;  4N0B A;  2E7W A;  2DYR H;  1IV6 A;  4ZYA A;  1MBE A;  1QU3 A;  3KP4 A;  3B6A A;  3ZXS A;  5GTI C;  5J1U A;  1LFU P;  3WHB A;  4CYC A;  1J09 A;  3S16 J;  2P7V B;  3RYP A;  1RR8 C;  1XS9 A;  1OIS A;  2V1D A;  3V7C A;  1EF4 A;  1FY7 A;  2BY1 A;  3N4M A;  5EGO A;  1LEA A;  4KUM A;  1B8I B;  2BY0 A;  2DTZ A;  2C6Y A;  4BJ6 C;  3RDI A;  3DXJ F;  5KAI C;  1JUP A;  2DMP A;  3LA2 A;  4S04 A;  2JK3 A;  3QRF F;  2RV8 A;  2HOT A;  4IHW A;  1RKT A;  2DDA A;  3IWF A;  5HLG A;  2XAQ A;  2LR8 A;  4Q47 A;  4W1U A;  1KU9 A;  1XTA A;  2KIU A;  3MMY B;  4MHG A;  4AC0 A;  2STW A;  5DUK A;  1O57 A;  3FWE A;  1B72 A;  1LKX A;  3S15 J;  1FTZ A;  2ECC A;  2DLL A;  1BOA A;  1W5C C;  2YU3 A;  2XAF A;  1JKR C;  1POG A;  4RGR A;  1F4K A;  5CVJ A;  3A4C A;  2XKP A;  1WI9 A;  3PNY A;  4N9I A;  5HOO A;  4A3K J;  2V79 A;  2NOJ B;  3WTZ A;  5DD4 A;  3K70 D;  2XSD C;  4LG0 B;  2VON A;  2H1L A;  3SQN A;  1IXC A;  1L5I A;  3O3K A;  4OIR F;  4AU7 A;  4KA4 A;  3HUG B;  4G9Y A;  3LAP A;  1S3J A;  2FD5 A;  2EK5 A;  3C3W A;  1H9T A;  1EH6 A;  1UJ8 A;  3OOU A;  3F6V A;  2CFX A;  3H9Q A;  4M6X A;  3BG9 A;  1WJB A;  1ETQ A;  2AHQ A;  5IYC J;  5IT9 Z;  3U1K A;  3KIO A;  2ZCW A;  5L3G A;  3BTC A;  2L7K A;  2EWN A;  2E1M B;  3E7L A;  3M4O J;  1RNL A;  3JRH A;  1S7A A;  1S7E A;  2A68 F;  4FQG A;  1R49 A;  1J59 A;  1KA8 A;  4PSX A;  1V4R A;  4RB0 A;  2DMN A;  4XLC A;  5GAD J;  1W36 D;  3JRB A;  3S3O A;  2Z5U A;  2PI0 A;  1T8I A;  4AD9 A;  3OYL A;  2LC2 A;  4ZH4 F;  2OQG A;  2LRE A;  3B73 A;  4FIS A;  1D1B A;  2UXN A;  2L9S A;  2QQA A;  3ECH A;  4L0Z B;  1WRJ A;  3U1D A;  2HR3 A;  2FX0 A;  3ABT A;  3E5Q A;  4CCJ A;  5FO5 A;  2CU7 A;  4FB3 A;  5IT3 A;  2WAQ N;  2MSY A;  2Y0S N;  2VXD A;  3K4N A;  3FHN A;  1O7L A;  5CKT A;  5HLI A;  1BOB A;  3WTT C;  5LGT A;  3T8T A;  1ACI A;  3BT9 A;  3SFZ A;  2RAE A;  3H3U A;  5DV5 A;  4HNU A;  1XMX A;  5F0H A;  4CHU A;  2KQR A;  2D45 A;  1YW9 A;  4ZQ9 A;  1KQ8 A;  1RKW A;  3CZ6 A;  4UV8 A;  1FJL A;  4NBQ A;  1X3W B;  3TGN A;  4ITV A;  4A12 A;  1TC3 C;  3WGG A;  2Y31 A;  1MH3 A;  3QOE A;  4AYB A;  2HPI A;  4XLF A;  1KZH A;  2TCT A;  3L2V A;  2EIJ H;  5C4J J;  3J81 Z;  1GT0 C;  2O6G E;  3M3Y J;  2UWM A;  3VB2 A;  3PJR A;  1MJA A;  2V9K A;  2UUZ A;  2F4I A;  2W00 A;  3CJT B;  1NG6 A;  2AQE A;  1AWC A;  2E36 A;  2VQG A;  5EG0 A;  2DFF A;  4A2U A;  4BE1 A;  4FTH A;  2FJ1 A;  4LLL A;  1PJR A;  4B3A A;  3BQZ A;  1E3H A;  3TQN A;  3HG9 A;  3SJM A;  2CSO A;  2V9V A;  1IXS B;  2DFH A;  4XBF A;  3F0C A;  4PGH A;  4BYY A;  2HTS A;  3K7A J;  1BBY A;  3E5X A;  1CF7 A;  4Y52 J;  4YFK F;  3I71 A;  1LVK A;  1N75 A;  4A6D A;  3GFJ A;  2BVM A;  1W7P A;  4XL9 A;  4ESJ A;  4QPQ A;  1P4A A;  2XPW A;  5J3L A;  2BW3 B;  2JSP A;  2K85 A;  1YQA A;  4BHC A;  3TW7 A;  5J40 A;  4HDU A;  5CVU A;  3HOU J;  4X0G A;  3BRO A;  3LWF A;  1FOY A;  1XN7 A;  4D7N A;  1QQI A;  1R4N B;  3AL0 C;  3T0Y A;  1L2M A;  4CYD A;  3ZQG A;  1TZL A;  3G1L A;  1BW6 A;  1W5T A;  4M6Y A;  2EZI A;  4HRI A;  3ZMV A;  1OQY A;  1LUJ B;  3CP2 A;  3OIQ A;  1SVL A;  2R0Q C;  4EAT A;  2JVG A;  2E60 A;  1VFC A;  5JHF A;  3S2H J;  1Z67 A;  2HOS A;  2K9L A;  3ONQ A;  2A05 A;  2B0L A;  3H3Z A;  3A01 A;  2X0L A;  1MMD A;  4F55 A;  1D5V A;  3JRI A;  1REP C;  1G59 A;  1EKE A;  2LNB A;  5EDN A;  1IW7 F;  2DDB A;  3FIW A;  3HRS A;  4C3I J;  1ZRC A;  2K3P A;  4M3D A;  4CCM A;  1KU3 A;  1MJ9 A;  3F8F A;  3GX4 X;  4BY1 J;  2FUG 2;  2VL8 A;  4RAZ A;  2GWR A;  3JTH A;  3SFI A;  2A6E F;  2LOO A;  2MW8 A;  1WPK A;  3K1N A;  4O6J A;  1LVA A;  2VLA A;  3VYU B;  5BYG A;  1FLI A;  2DQR A;  2L7M P;  3RZO J;  1AOY A;  3I3L A;  3S1N J;  1XCV A;  3FXQ A;  3G71 I;  3HGG A;  2VB6 A;  3CO7 C;  2JPC A;  3CJN A;  4HX8 A;  5TGT A;  2Z33 A;  1VQ5 I;  1KYW A;  3HJE A;  1MZB A;  2DMQ A;  5DCF A;  5AIP A;  2LKS A;  4PDK A;  1R36 A;  3BR2 A;  2VXZ A;  3KLO A;  1QZY A;  1SVM A;  1HA8 A;  2IXS A;  4XLN F;  3E6C C;  2L7Z A;  2JA7 J;  2EFQ A;  1BIA A;  3FMQ A;  4NC8 A;  2ICW G;  4RGS A;  4PFO A;  4M3E A;  2M8G X;  1BR1 A;  3DPL C;  4IF4 A;  3HIF A;  1APL C;  2GXG A;  3EUH A;  4S05 A;  3JCU C;  1YLF A;  4DZP A;  2DT5 A;  2R5Z B;  3WU1 B;  5GP9 A;  3MN2 A;  1MBH A;  1D1C A;  4I02 A;  1JXS A;  2L4M A;  1FOK A;  2ELH A;  1X2M A;  2YSR A;  1FMV A;  1RI7 A;  2P0W A;  3S1R J;  4BHP A;  4G7Z F;  5M3F J;  4L18 B;  4IPA A;  3CES A;  3I64 A;  4XLH A;  3FK6 A;  4NHJ A;  3ZQH A;  4CSW A;  4M9S A;  4RDU A;  3V8K A;  2WY7 Q;  1Q1H A;  2V26 A;  1VND A;  3CCV I;  1FWZ A;  4K2E A;  3WGH A;  3LSR A;  5KVR A;  3R0J A;  1HKS A;  1B8I A;  4DNC A;  4OAY A;  3BR0 A;  1WI3 A;  3GUD A;  3JSO A;  1AHD P;  1IRG A;  3BPV A;  1A5J A;  3L2U A;  5IYD J;  1S9H A;  2XUB A;  1A6Q A;  1SD6 A;  3S2D J;  2JT1 A;  2DJI A;  2F5C A;  2L9R A;  3BG7 A;  3J80 K;  1VQ6 I;  3IH3 A;  1ETO A;  3FMS A;  1MBJ A;  1WGX A;  1IC8 A;  3OMY A;  4WWC A;  3KZI C;  4L9J A;  4KIG A;  1MMA A;  3R6S A;  5FB2 A;  4UUV A;  3KEY A;  3F21 A;  3OSF A;  4LK1 F;  1YRN B;  4ENM A;  2QQ8 A;  2XB5 A;  3BOQ A;  2JPB A;  2IPQ X;  2OJE D;  4LG0 A;  2K7L A;  3H5N A;  1ETX A;  3H35 A;  3IAM 2;  2IA1 A;  2VE8 A;  1OCT C;  3I54 A;  3DEU A;  4CA0 A;  2MBF A;  4DYC A;  1HKT A;  2ZB9 A;  2WAE A;  1XD7 A;  3BTL A;  5JHU A;  5F27 A;  2EBI A;  3U21 A;  1MSF C;  2K40 A;  4LMY A;  3A1Y A;  2VT2 A;  1H89 C;  4CH7 A;  3GFL A;  4M72 A;  2FSW A;  3OY9 A;  3UKG A;  1YIO A;  4CGZ A;  2K5C A;  4RAG A;  1XDU A;  3NQO A;  3P9K A;  3O8H A;  4RB3 C;  3GLL A;  2WBM A;  2ZC2 A;  3MVP A;  4YEL A;  1JT0 A;  1F43 A;  2CQN A;  1RPW A;  1RUN A;  1LQ1 A;  2UV1 A;  3K70 C;  1SVO A;  5CYV A;  2X9D A;  1R23 A;  2NVY J;  2O5R A;  2BHY A;  2ZNZ A;  5ILV A;  2OU2 A;  2HDC A;  2O0Y A;  2Q2E B;  1YE9 A;  3F22 A;  1TTY A;  4MTD A;  3DLA A;  1J7K A;  2BV6 A;  2X48 A;  1OMI A;  4GDF A;  2ITL A;  1XMA A;  4I76 A;  5DTD A;  2LRD A;  4AUX A;  3O2P E;  4LOC A;  2DBB A;  2JQ7 A;  1Y6I A;  1OLT A;  1T08 B;  2ISZ A;  1LB2 A;  2R3S A;  5IPA A;  2BBY A;  5LHG A;  3OYJ A;  1MSE C;  5EEG A;  3BWG A;  3LSK A;  4Z6Y A;  4LIF A;  1Z0X A;  5EJC A;  2VBW A;  4ESB A;  4IHS A;  4IHY A;  4A3C J;  5CQE A;  1MW7 A;  1W36 C;  2JVH A;  2IA0 A;  2X51 A;  5ICC A;  4BL0 B;  1NTC A;  1LE8 A;  4ZDO A;  3FM5 A;  2BXZ A;  4CXF A;  1I1G A;  2VBY A;  3OYM A;  2WB1 N;  2IT0 A;  1ZAO A;  1ZHF A;  3WTS C;  4XON A;  1ONV A;  2PJR B;  4BUP A;  5J4V A;  2XHK A;  4RLQ A;  3ZMS A;  2BXY A;  3L2R A;  3KEQ A;  2QUF A;  2DA3 A;  3GME A;  3K6G A;  4HOB A;  1Y0N A;  2FA5 A;  3K1M A;  2ZJR F;  4CCK A;  2QLZ A;  4E70 A;  1MKM A;  2A6H F;  2FOK A;  1TNT A;  1O3Q A;  1KU2 A;  1R1V A;  1BI1 A;  5TIS C;  1I3A A;  2M87 A;  1VQ8 I;  4Q5S F;  3EYI A;  2GA1 A;  4N4N B;  5LRS A;  3OL3 A;  1U5T A;  3L2Q A;  4A0Y A;  5D5W B;  3GTO J;  2MAB A;  4BGD A;  4X1E A;  1PUF B;  3G2B A;  1X4O A;  1XPX A;  3TMO A;  3M7G A;  4LIT A;  2O7O A;  4EJV A;  2LF8 A;  3NEU A;  3MKY B;  1ON1 A;  4ENJ A;  2EV0 A;  3AG2 H;  1IF1 A;  1YIJ I;  2CV0 A;  2VPL A;  3FBN B;  4XQF A;  2BY3 A;  2XAU A;  3PO2 J;  2PMZ A;  3WU2 C;  5H2F C;  1DP3 A;  1W4M A;  5J4Y A;  3DQV C;  3KYL A;  4V2G A;  2EH3 A;  1PP8 F;  5HS9 A;  4E7K A;  3C2H A;  4IRI A;  2KIM A;  1MBF A;  3GXO A;  3K69 A;  4ETS A;  4A0Z A;  2XRL A;  4UVA A;  2W85 A;  3HL2 A;  5JR3 A;  1QHG A;  1YW7 A;  1QGP A;  1U0J A;  1R5I D;  1R58 A;  4EV0 A;  1FBQ A;  2F5D A;  1H8A C;  3HTU A;  1X1A A;  2VPR A;  4L5J A;  2OPT A;  3SHF A;  3LNQ A;  1TP4 A;  1SD7 A;  2EZL A;  3PQJ A;  3NWT A;  2H8W A;  2IS1 A;  1U8R A;  1Z21 A;  2D1H A;  5HLT A;  1WVR A;  1DU6 A;  4IX7 A;  3HOW J;  2OTL I;  1LFB A;  2HYF A;  1IGN A;  4UB8 C;  4O3M A;  1PVE A;  2VQH A;  1JTY A;  2H27 A;  2L2O A;  2HU9 A;  1SD4 A;  1SMT A;  5HS8 A;  4MEX F;  3DLL F;  2Y9Y A;  1LPQ A;  1FTT A;  1HQC A;  3I53 A;  5ICG A;  1IXR C;  4B09 A;  4D0P A;  2OCC H;  4HX7 A;  4BHB A;  2HTJ A;  5A2Q Z;  1I27 A;  4YII A;  3EUH C;  1B59 A;  2K9M A;  4I98 B;  3RI4 A;  4HST A;  2F6C A;  2QGU A;  2VIX A;  4ON0 A;  4ZDP A;  4WF2 A;  4HAM A;  1IG7 A;  4A3E J;  1P6R A;  4I6Z A;  4F52 A;  1WQ2 A;  1W1W E;  3WG9 A;  4J19 A;  2VC1 A;  3HSF A;  4XID A;  3QPL A;  1D0Y A;  2YX7 A;  1Z6T A;  3DBR B;  3CUO A;  3KYD B;  4ASN A;  1Z1D B;  3H1C A;  4R79 A;  5GPA A;  4G6Q A;  4IOC F;  1DPU A;  4GCV A;  2LBF B;  3QU3 A;  3RSN A;  2L0K A;  4OIP F;  2W82 A;  3RKX A;  4IRH A;  3S8P A;  1UMQ A;  4IO9 F;  5FLX Z;  2I5U A;  2IGN A;  1HW2 A;  4RAF A;  2CYY A;  1ZAR A;  3K10 A;  4XKW A;  5F0F A;  3QK2 A;  2E1N A;  3WE2 A;  1ZRD A;  3D1N I;  4UY8 I;  5JLW A;  3K4K A;  1DPR A;  3BPX A;  2HOA A;  2MFZ A;  4JP0 A;  3UNG C;  3MKL A;  4PCQ A;  1VF9 A;  3J7A O;  2VUM J;  1TWG J;  3HYI A;  1KYZ A;  3DCF A;  2KL4 A;  5KCM A;  4AIK A;  1SFX A;  3RKQ A;  2Y48 A;  4HLX A;  1I39 A;  1VQL I;  1JJ8 C;  4G12 A;  3RPQ A;  3B6C A;  2JZY A;  1D3Y A;  2L01 A;  4QSH A;  5DCM B;  3ABU A;  1K4S A;  1OCO H;  4A3M J;  2K9Q A;  4KYW A;  1QPM A;  3GBG A;  1R1U A;  1K6Y A;  1TLH B;  1LDD A;  5HDG A;  1LJ9 A;  4M74 A;  1YRN A;  3JAM K;  3CMA I;  1WKM A;  3W2V A;  3C2B A;  3M1C A;  1T33 A;  3CP8 A;  3ISP A;  2Q1Z B;  4B43 A;  5ICE A;  2IS4 A;  4NQW B;  4R1H A;  3GTM J;  3KZZ A;  2DA1 A;  5FKN A;  3Q0V A;  2E19 A;  3OYB A;  3ROU A;  3OWT A;  1KSX A;  3UR3 C;  4XKB A;  2QZ8 A;  1K61 A;  3GTK J;  5J8F A;  3GTP J;  2X4H A;  3CD6 I;  4U87 A;  4DYQ A;  1YFH A;  3NRV A;  4ABZ A;  1TT0 A;  3QPS A;  2XAG A;  3IH4 A;  2DK8 A;  4LB5 A;  2B7E A;  4CZC A;  2XSJ C;  4JX6 A;  4UUT A;  2CW8 A;  1TNS A;  1P2F A;  5K7Z A;  2E71 A;  3LA3 A;  2FNP A;  3A0H C;  3LOC A;  2PQ8 A;  1MBK A;  4ZDL A;  2JTV A;  3ZN1 A;  2JRT A;  2O3F A;  1ETK A;  4B47 A;  5D4R A;  1HCR A;  1F9N A;  2ITJ A;  3L00 A;  1I3Q J;  4AYB N;  3ULQ B;  1XDS A;  1IN6 A;  4ZC3 A;  4BQA A;  5C4X J;  2Q2E A;  1ETV A;  2MC3 A;  2M1B A;  3VSL A;  5K1Y A;  2R7O A;  3DKX A;  1E2X A;  2ECB A;  5KK1 A;  2YS9 A;  3BG3 A;  1HW1 A;  4XOP A;  4OIO F;  3MKZ A;  3I56 I;  1MH4 A;  1PDN C;  1Y0U A;  3R61 A;  4Y3O A;  1T6S A;  1KQ0 A;  2WA0 A;  1Y8Q B;  2NS8 A;  3SYT A;  3LSM A;  1X58 A;  5M5Y J;  2COM A;  2CUZ A;  4C2T A;  1AKH B;  2HZD A;  5F64 A;  1LDJ A;  5GAE J;  3OYG A;  3HOX J;  4A0X A;  5JI6 A;  3S1Q J;  2L02 A;  4FCY A;  2R7T A;  3MCZ A;  3FDY A;  2GOX B;  4LG3 A;  4UXN A;  2XAH A;  2ELK A;  5JLX A;  4RA2 A;  3IP4 B;  2VC0 A;  1YYV A;  2KJC A;  2CFO A;  4BEH B;  1X2N A;  2F2E A;  2IGK A;  2DTR A;  5L3F A;  2PJR A;  3F6O A;  2Y69 H;  3KET A;  2ME6 A;  3E6B A;  2MGQ A;  2OTJ I;  4ZYD A;  5B66 C;  2HKO A;  3SXY A;  5F1J A;  3TO7 A;  2NOG A;  3KCC A;  1NK2 P;  2WV1 A;  4J00 A;  1U5T C;  3P9I A;  2PLY A;  3VYS B;  2NVQ J;  2M0M A;  2M34 A;  3IWZ A;  2KP6 A;  3ZMU A;  3F9K A;  2RGV A;  3ZQC A;  2TDX A;  2RQP A;  1RES A;  4LFU A;  4BBR J;  2QKL B;  3FXL A;  1LDK B;  1G4D A;  1XCB A;  1FYK A;  3K9T A;  1ZRE A;  4BY7 J;  2JUG A;  4BH9 A;  4IHT A;  1ZRF A;  1TWA J;  3BCA A;  2GM4 A;  3I59 B;  2IF9 A;  4HV5 A;  3I9V 2;  2V1X A;  3GLX A;  1ZLJ A;  1MIJ A;  4I09 A;  1TL8 A;  3F8B A;  1BC7 C;  4HZF A;  2KT0 A;  3RIR A;  5ERI A;  4O5V A;  4EM1 A;  3S2W A;  4C2U A;  2BZT A;  2QQB A;  3PSF A;  4MGR A;  3PFI A;  2K86 A;  2LKP A;  5M5X J;  5IP9 J;  2LD5 A;  1W7P D;  1IN7 A;  2DQL A;  2HOE A;  5HNF A;  1UUT A;  3BTJ A;  2L5Q A;  2LY1 A;  4OWR B;  3LSP A;  1MDM A;  4MEY F;  1ZK8 A;  3TDZ C;  2UXX A;  5F0C A;  3J81 K;  4FAS D;  4XLE A;  4E7L A;  4BU2 A;  1D0Z A;  4BQN A;  2BHZ A;  2TRT A;  3S93 A;  1G2H A;  1HST A;  2RQQ A;  3JRA A;  4YFN F;  2X6W A;  1V5G A;  2JA2 A;  2K27 A;  2EA2 A;  4LLN A;  4UUS B;  4BDZ A;  2E2J J;  3FBI B;  4HPQ A;  3BCB A;  2QBY A;  1SAN A;  2IS6 A;  1FSE A;  4F3Q A;  2W7N A;  2X6O A;  4L0Y B;  1YJW I;  4YEJ A;  2Z3Y A;  3DU5 A;  3GVA A;  1JT6 A;  4C2M J;  1UG2 A;  2GIV A;  2KFD A;  2ZME A;  4C9Y A;  4BE0 A;  4B4C A;  2E5N A;  2X6Y A;  2BE5 F;  2Y75 A;  3IRR A;  3WTW C;  2V4J C;  4UVB A;  4JBA A;  2DA7 A;  2GOM A;  4KT6 A;  5J47 A;  2VT3 A;  3WOD F;  2VBZ A;  5DYM A;  4IQJ A;  4XMY A;  1R9W A;  3PO3 J;  3Q0U A;  1UZC A;  5HNH A;  3CUQ A;  2QSG X;  2KRC A;  2GQQ A;  2LP0 A;  1Z1D A;  2ESN A;  4L9N A;  4ENK A;  3FF5 A;  1JJ6 C;  1FEX A;  3OYI A;  1VQ4 I;  2W84 A;  3HPH A;  1U3E M;  1VQP I;  2VKH A;  2X1D A;  5DDG A;  5FLM J;  1H88 C;  2HQA A;  2PX9 A;  2XKO A;  2DMU A;  3D0S A;  1RR7 A;  2M4G A;  1WH7 A;  2XGD A;  2NYX A;  3OL4 A;  4RM2 A;  3K4C A;  2VKD A;  2VJI A;  1OYI A;  2NVT J;  3S14 J;  3NAU A;  2H1K A;  5FKM A;  5D5X B;  1SAX A;  3SEZ A;  3JRG A;  4IHV A;  2NXN B;  4OIQ F;  3CCJ I;  2WY8 Q;  4A69 C;  2Y0M A;  2Z16 A;  4LLG F;  3M8F A;  2JUC A;  4MNU A;  1K78 A;  2VOO A;  1S8N A;  4YFX F;  2ZJP F;  1D1A A;  4Y33 A;  1I50 J;  3VEP A;  4F93 B;  2YR2 A;  1DGW Y;  1SD5 A;  4PFP A;  2OA4 A;  1IAW A;  1YX3 A;  3LSH A;  5DCM A;  4E4H A;  4I0A A;  2VKE A;  2HXO A;  1R71 A;  1HDD C;  2M3A A;  1R22 A;  3LSI A;  4AM3 A;  3GO5 A;  4G8X A;  1JTX A;  1Y56 A;  1EJ9 A;  1RIO H;  3MKW B;  2G0E A;  2B9S A;  1LEB A;  4FE4 A;  3O6B B;  4XOR A;  4L5E A;  4IJA A;  3PUF A;  4ZTF A;  1W0U A;  3F23 A;  3OR2 C;  5F04 A;  2KRH A;  3HSR A;  4BXX J;  3T1B A;  5FFX A;  1OR7 A;  2I8D A;  5F08 A;  4YIR X;  1FT9 A;  5FKL A;  4U7B A;  3K4B A;  3WTY C;  1EV7 A;  1JGG A;  1G3S A;  1BR4 A;  2HW0 A;  1TQP A;  3W2W A;  1ETW A;  1FYM A;  1SFE A;  4MO7 A;  1ZKG A;  5F1R A;  2G7H A;  2Z9O A;  5GAG J;  2ZSH B;  2EJR A;  4L9V A;  5E20 A;  4XSX F;  2A5Y B;  5FD6 A;  2GBY A;  3IKV A;  2DK5 A;  2M9H A;  5L3C A;  1U9N A;  5K5O A;  2FQ3 A;  1NK3 P;  4NNJ A;  5J8C A;  1BJZ A;  4KN7 X;  3AL0 B;  3OIP A;  3HGY A;  1O3S A;  4BNC A;  1FP1 D;  3R60 A;  1ORK A;  1U8B A;  2NVU B;  2P5V A;  5IP7 J;  1BJA A;  5GAH J;  3LA7 A;  3CDL A;  5IOZ A;  3QOP A;  1D5Y A;  1F1Z A;  4G6T B;  2L3D A;  4LIU A;  3TO6 A;  3H36 A;  3WTU C;  2XF6 A;  5ILS A;  3TED A;  5LRR A;  5D6F A;  1MMN A;  2QF7 A;  2F5V A;  3QP6 A;  5HVQ C;  4HNT A;  2EA4 A;  3J80 Z;  3SZT A;  4II3 A;  5EYR A;  3VDX A;  1UB9 A;  4QIW N;  1T0F A;  2VAS A;  3BZK A;  1P9Q C;  3HDD A;  3FXJ A;  5CYN A;  3PIO F;  2IBD A;  3C7J A;  2FXA A;  4P9F A;  3M8E A;  3HUG A;  4C3H J;  3HC7 A;  4BEH A;  4KIF A;  2DPU A;  4D7M A;  1BI2 A;  1G6N A;  1T56 A;  2DA4 A;  2PMZ N;  3VOD A;  3K2Z A;  5JFR A;  4BDY A;  1UCR A;  3TL4 X;  3H5A A;  1S6L A;  3ZGK A;  2KLO A;  4KIT B;  3KP5 A;  2QSH X;  2HZT A;  2XPV A;  1OCZ H;  3D5L A;  1QZZ A;  2MLG A;  2F4M B;  4DQ2 A;  3G3Z A;  3AG4 H;  2ETH A;  4PJ0 C;  3K4J A;  4E6K G;  3OS0 A;  2DA2 A;  5E79 C;  5CLS A;  3HRM A;  3QOD A;  1T38 A;  4WXC A;  1XGS A;  2FBH A;  5GPC A;  3ZRG A;  3EUK L;  2FUF A;  1MMS A;  5FRM A;  1T95 A;  1O3T A;  3CCU I;  1SFK A;  2D1V A;  3C1D A;  1N78 A;  5BQT A;  1P7I A;  2QEX I;  1IDZ A;  4UB6 C;  2M5W A;  3DKW A;  4HQE A;  1QVT A;  3S17 J;  1WHU A;  2DW4 A;  2OC6 A;  3P7N A;  4II2 A;  5HS7 A;  1R5G A;  3L09 A;  2ZFW A;  4F7Z A;  2WV0 A;  5LLQ A;  4L9T A;  4IXA A;  4CYC B;  5IYB J;  3GW2 A;  4EGY A;  2R5Y B;  3OYD A;  3I59 A;  1U2W A;  3DTK A;  1VQ7 I;  2CH0 A;  3L1P A;  2GXA A;  2R7Q A;  1IRZ A;  1IRX A;  3V42 A;  4XK4 A;  2GLO A;  3GTJ J;  3KZY A;  1UAA A;  3QYB A;  3V7S A;  2VJJ A;  4XRM A;  2RDP A;  3DPT A;  1I6X A;  3KP3 A;  1GV5 A;  1UFM A;  4YG2 F;  1WCM J;  1X3Z B;  1E17 A;  1FP2 A;  5D9I A;  3MFK A;  3RPU A;  2JA8 J;  4UV9 A;  2H6B A;  3BJO A;  3SEQ A;  1FMW A;  2EFP A;  2LY9 A;  1B72 B;  4FE7 A;  2DOE A;  2CQ7 A;  4IEJ A;  4XR6 A;  3ZQ7 A;  2CG4 A;  4OOI A;  3DTE A;  3SZG A;  3CC2 I;  3FIS A;  2ZO4 A;  3HSE A;  4GGG A;  4MFE A;  3DBL B;  3DBH B;  2EV5 A;  1TT5 B;  1NH3 A;  3QP5 A;  3J7Y J;  2AO9 A;  2KZV A;  1DU0 A;  1MNM C;  2D2W A;  4FT8 A;  1FPQ A;  3HPG A;  2LMD A;  3CTA A;  4UNO A;  1SEU A;  3H9G A;  3OS1 A;  3OYE A;  1DDN A;  1Q1V A;  1QVU A;  1VQN I;  1XMK A;  4KFC A;  4RAY A;  2VQC A;  4GXO A;  4KN4 X;  4A3B J;  3M1E A;  3A03 A;  1XGN A;  2IA2 A;  4NB5 A;  2FBK A;  3AG1 H;  5ILU A;  1Z7L A;  3QAH A;  5LHH A;  2MD0 A;  3ZR8 X;  4DGW B;  1TW2 A;  5BPI A;  5B3S H;  2CV2 A;  2BW3 A;  4D5C A;  4MFD A;  3CLO A;  3F8N A;  4ENN A;  3LST A;  1GXP A;  1OFC X;  2QKM B;  2P7C B;  2QEN A;  2DI3 A;  1W0T A;  3SDB A;  3DEE A;  3W2A A;  2CJJ A;  2RVC A;  2MC4 A;  4EJO A;  3E6M A;  4XLA A;  6PAX A;  4OAZ A;  4ZTJ A;  4F92 B;  4AIH A;  3DTI A;  4Y17 A;  2BYV E;  2HGC A;  2VJ4 A;  3ERE D;  1GVJ A;  2V6E A;  4L5I A;  5GTH C;  1WH5 A;  1ZGW A;  4A3G J;  1KGS A;  5C44 J;  4CCN A;  5ED4 A;  4U7D A;  4HW0 A;  2GIZ A;  1H0M A;  2E7X A;  2MH9 A;  3F8C A;  2JSC A;  3BTI A;  4LMD A;  1TW3 A;  1HF0 A;  1XSD A;  3QU6 A;  4YIF A;  2XC7 A;  3HBL A;  3OYA A;  3WTV C;  1XSV A;  4E7S A;  3G4S I;  1ODD A;  1UST A;  2YUS A;  1EH7 A;  2KIS A;  1KON A;  4I99 C;  4KIC A;  4XOT A;  5EZG A;  4DBQ A;  1JUS A;  2JA6 J;  3ASO H;  1SC7 A;  1V5F A;  1ZYR F;  3BJA A;  4IRG A;  1MMG A;  1WJC A;  1X4P A;  3JRD A;  2EFN A;  2WAF A;  4B8X A;  3E97 A;  4LK0 F;  1YIT I;  3I0T A;  1ZN2 A;  4DOZ A;  1YG2 A;  2IVM A;  1D8J A;  4A3J J;  3TP0 A;  1A04 A;  3G1M A;  4PJN A;  5LGU A;  1SFU A;  3ZOB A;  1QNT A;  4R8H A;  4LD5 A;  3WU0 A;  4C3J J;  4B44 A;  4BBS J;  3DEW A;  5HLH A;  2OUM A;  3VWB A;  2IP2 A;  1QA6 A;  1Z3Y A;  1W5S A;  3KP6 A;  3TO9 A;  4ZJZ A;  1ENH A;  1D8K A;  2E5Z A;  3HTS B;  1DGR M;  5A2Q K;  3CC7 I;  2Y2Z A;  1VQM I;  4IKF A;  3IAS 2;  5BMZ A;  4DW6 A;  2DA6 A;  3A0B C;  3JSP A;  1R9T J;  1V5E A;  3V4G A;  3EPZ A;  4PGG A;  1QHH D;  3WE3 A;  4GYG A;  1T39 A;  1U78 A;  4IHX A;  3DV8 A;  3FKI J;  5B5E C;  3GEZ A;  2QSF X;  2R5Z A;  4NBP A;  1HXD A;  2CQQ A;  1CF7 B;  3BR1 A;  3W6K B;  4DZJ A;  2CUF A;  2L9V A;  2LF7 A;  2NAZ A;  3DP7 A;  3QYF A;  5D5V B;  4EJT A;  2CV1 A;  5E3L A;  1MBG A;  2O8X A;  1BI0 A;  2HNH A;  1K7A A;  4WX9 A;  4UHT A;  1ZGA A;  3Q9S A;  3TBI A;  1T98 A;  3P9C A;  3RCO A;  5M3M J;  4DJA A;  3ABM H;  1S29 A;  4QTR A;  2XF5 A;  2CMP A;  5DD8 A;  2R7S A;  2YU9 J;  1GV2 A;  2LSO A;  1U6G A;  1QRY A;  1L3L A;  2M8E A;  2DA5 A;  3PNT A;  4S0H B;  3IRQ A;  5TJJ A;  5FLX K;  2LVS A;  5K5R A;  4BAC A;  4GRI A;  4BKX A;  4HF1 A;  1G3Y A;  1CQT A;  2COB A;  2NNY A;  4ZZL A;  1FC3 A; 
#chains in the Genus database with same CATH homology
 3H9J A;  1LDK B;  4D9J A;  1HA8 A;  3VYR B;  2IXS A;  3CF2 A;  4NC7 A;  4J01 A;  4NC8 A;  2JUG A;  4KJZ A;  1WJ5 A;  3BCA A;  4PFO A;  3C2G A;  4YRV A;  1BR1 A;  3DPL C;  2IF9 A;  1X1B A;  3OS2 A;  3I9V 2;  2HVR A;  1MNE A;  1WFX A;  2XF7 A;  2ZSI B;  4ANJ A;  3QFQ A;  3VYT B;  1D1C A;  2RNG A;  3QYE A;  1SAU A;  4Y4R A;  4XN3 A;  4C2U A;  1N77 A;  3PSF A;  4LIV A;  2R7W A;  1FMV A;  1X19 A;  2P0W A;  2IGM A;  3CES A;  5HNF A;  1UUT A;  4XLH A;  4PJL A;  4CSW A;  2L5Q A;  4PUS A;  2LY1 A;  2ZFU A;  2WY7 Q;  3OR1 C;  4OWR B;  4BE2 A;  2V26 A;  2IGO A;  2X85 A;  4FAS D;  4XLE A;  4E7L A;  2TBD A;  4BU2 A;  1D0Z A;  4BQN A;  4OAY A;  3D5R C;  2RRE A;  3S93 A;  3L2U A;  2E1M C;  2RQQ A;  1S9H A;  2X6W A;  1V5G A;  2JA2 A;  2BOL A;  2DJI A;  4BDZ A;  5CPR B;  3FBI B;  4HPQ A;  3BG7 A;  3PL8 A;  1WJD A;  3BCB A;  2IS6 A;  4F3Q A;  2W7N A;  3OMY A;  3LSG A;  4YEJ A;  3EUA A;  3PFY A;  3DU5 A;  3ZCO A;  4ZO0 A;  1MMA A;  3KEY A;  2X6X A;  3LMM A;  4CUG A;  4C9Y A;  3RQ4 A;  2A5W A;  4BE0 A;  2E5N A;  2X6Y A;  1X1C A;  2V4J C;  2GOM A;  4KT6 A;  5KNL A;  4IQJ A;  2R7V A;  4JOM A;  4PJM A;  2V1N A;  2HDW A;  3OYN A;  4XMY A;  1R9W A;  3H5N A;  3H35 A;  3IAM 2;  4N4O B;  4CA0 A;  2L9N A;  2WAE A;  5HNH A;  3OYC A;  3PUB A;  3U21 A;  2KRC A;  3NWS A;  3A1Y A;  3MD2 A;  4DBR A;  4KW3 A;  2OV7 A;  4CH7 A;  3OY9 A;  3OYI A;  2DT7 B;  3HPH A;  4BJT A;  2VKH A;  2X1D A;  1LFP A;  2K5C A;  2HQA A;  4PJJ A;  1VZ0 A;  2M4G A;  3E0J B;  2WBM A;  3AFH A;  3OL4 A;  1OR7 C;  1BR2 A;  1WJE A;  4RM2 A;  4YEL A;  3CJR B;  3K4C A;  2VKD A;  5KHD A;  2VJI A;  5FRN A;  2UV1 A;  4XN0 A;  3K70 C;  2ZXI A;  3SEZ A;  2O5R A;  3VSK A;  1PYV A;  2Q2E B;  2WY8 Q;  2DCE A;  2Z2S B;  1YE9 A;  5LFA A;  2Z16 A;  2LYC A;  3DLA A;  2WB1 A;  2ITL A;  4GDF A;  1D1A A;  4Y33 A;  2LRD A;  1TBD A;  2LG4 A;  4F93 B;  1DGW Y;  4PFP A;  1YX3 A;  3LSH A;  1Y6I A;  1OLT A;  4RM3 A;  4E4H A;  2X1C A;  3DKY A;  3OYJ A;  4LIF A;  3LSK A;  1NG7 A;  2HVS A;  2M3A A;  4FGN A;  4P5O A;  3LSI A;  4D1Q A;  3IUO A;  5CQE A;  1MW7 A;  3H5R A;  5LD2 C;  1W36 C;  2JVH A;  2X51 A;  4BL0 B;  1MND A;  1Y56 A;  4ZDO A;  2BVL A;  3MKW B;  1Z3X A;  4XOR A;  3DU6 A;  4ZTF A;  3OYM A;  3KX2 A;  3D5S C;  3OR2 C;  1AA7 A;  2ELJ A;  2KRH A;  2PJR B;  2NL8 A;  4XON A;  3OYF A;  4BUP A;  1T0F C;  2M7A A;  2I8D A;  4RLQ A;  3PNV A;  3L2R A;  4U7B A;  3K4B A;  4XKC A;  3K6G A;  4B3X A;  2R7R A;  1BR4 A;  2W1O A;  4CCK A;  2HW0 A;  3W2W A;  1X1D A;  1KSY A;  2R7U A;  3BC8 A;  3HKZ A;  2ZSH B;  4MLO A;  2XDV A;  1DQU A;  4N4N B;  3E1S A;  1E0E A;  3OL3 A;  3L2Q A;  4HSR A;  2MAB A;  4BGD A;  2AQF A;  3G2B A;  1X4O A;  4NNJ A;  4XM3 A;  3TMO A;  4LIT A;  3AL0 B;  3OIP A;  3MKY B;  4FET A;  2V7F A;  3CJQ B;  1WJF A;  2CV0 A;  2VPL A;  1UEL B;  3FBN B;  4XQF A;  2ZXH A;  2XAU A;  2W4S A;  2PMZ A;  4BS9 A;  1DP3 A;  4G6T B;  4BXF A;  3BLY A;  3DQV C;  4LIU A;  2IPR A;  3KYL A;  2Z1D A;  5FRO A;  3H0D A;  2XF6 A;  4E7K A;  4DIQ A;  3C2H A;  1MMN A;  4XNF A;  2F5V A;  5HVQ C;  1JI8 A;  2KMU A;  4HNT A;  4ZYA A;  3HL2 A;  1QU3 A;  4II3 A;  3VDX A;  3ZXS A;  2VAS A;  2WAD A;  1P9Q C;  1QHG A;  1U0J A;  1J09 A;  5CYN A;  1D0X A;  1X1A A;  3HC7 A;  4BEH A;  3NWT A;  3L2W A;  2IS1 A;  4BJ6 C;  1Z21 A;  5HLT A;  4AVZ A;  4JQF A;  4BDY A;  2LBF A;  4IX7 A;  3TL4 X;  3H5A A;  3ZGK A;  2KLO A;  1RZ9 A;  4KIT B;  3D5L A;  2VQH A;  3HOS A;  2L2O A;  4E7Z A;  2HU9 A;  3K4J A;  4E6K G;  3MMY B;  3OS0 A;  3QOD A;  3ZRG A;  1LKX A;  3EUK L;  2FUF A;  5FRM A;  1T95 A;  1YX5 A;  1SFK A;  1N78 A;  4NUB A;  4PK4 A;  4BQQ A;  3EUH C;  2K9M A;  2OC6 A;  4II2 A;  3A4C A;  4HST A;  3PNY A;  5HOO A;  1R6R A;  2F6C A;  2VIX A;  3K4M A;  2NOJ B;  4ZDP A;  3OYD A;  3DTK A;  3K70 D;  4F52 A;  3S32 A;  2CH0 A;  2R7Q A;  1L5I A;  1IRX A;  3V42 A;  4AU7 A;  3HUG B;  1D0Y A;  1UAA A;  3QYB A;  1Z1D B;  2VJJ A;  4R79 A;  3DPT A;  4IZZ A;  1ERD A;  1F08 A;  2LBF B;  3OOU A;  3H9Q A;  3RSN A;  2M4K A;  1WJB A;  4B48 A;  5D9I A;  1GLN A;  2W82 A;  3S8P A;  2L7K A;  2WAQ A;  2IGN A;  2Y0S A;  2E1M B;  3SEQ A;  1FMW A;  3K10 A;  4XKW A;  3QK2 A;  4PSX A;  4PSW A;  4XR6 A;  3ZQQ A;  4XLC A;  3DTE A;  3K4K A;  3S3O A;  3SZG A;  1W36 D;  2MFZ A;  2HPM A;  3UNG C;  3LFU A;  2LH9 A;  3J7A Y;  3OYL A;  2LC2 A;  1M55 A;  2KZV A;  2LRE A;  3FKJ A;  1D1B A;  2L9S A;  5KCM A;  2KL4 A;  2NTC A;  3HPG A;  3DPU A;  3H9G A;  4CCJ A;  3OS1 A;  3OYE A;  4FB3 A;  3CMM A;  2VXD A;  3K4N A;  1G8X A;  2VQC A;  3FHN A;  2MYS A;  5CKT A;  1BOB A;  3GBG A;  1UG0 A;  3N05 A;  1K6Y A;  4HNU A;  1Z7L A;  3A2K A;  2KQR A;  2MD0 A;  3ZR8 X;  4DGW B;  2CS3 A;  4ZQ9 A;  2CV2 A;  3W2V A;  2BW3 A;  3CZ6 A;  4E7H A;  3M1C A;  3HXL A;  3CP8 A;  4ITV A;  4B43 A;  2Q1Z B;  2CUJ A;  4HEA 2;  2IS4 A;  4NQW B;  2KDO A;  2QKM B;  3QOE A;  4AYB A;  2HPI A;  4XLF A;  3SDB A;  3OYB A;  3L2V A;  2UWM A;  3OWT A;  3DEE A;  1KSX A;  3W2A A;  3UR3 C;  3PJR A;  3AKZ A;  2V9K A;  2UUZ A;  4XKB A;  2F4I A;  2MC4 A;  2W00 A;  3S3N A;  1NG6 A;  3W3C A;  4XLA A;  4OAZ A;  4U87 A;  2AQE A;  4F92 B;  4ZTJ A;  3DTI A;  2VQG A;  2VJ4 A;  4XKV A;  1TT0 A;  2V6E A;  4BE1 A;  4P1W A;  4CZC A;  2HVQ A;  4CCN A;  3HOT A;  1PJR A;  2XSJ C;  2CW8 A;  2LY2 A;  2R7X A;  3HG9 A;  4LMD A;  2XC7 A;  4ZDL A;  3OYA A;  2KPM A;  3QN2 A;  3RTR A;  3M8J A;  4E7S A;  4B47 A;  4DBQ A;  1KON A;  3S3M A;  4XOT A;  3BG6 A;  2IS2 A;  4E7I A;  4F91 B;  2ITJ A;  1LVK A;  1N75 A;  1ZEL A;  1V5F A;  3OYK A;  3DWL E;  2BVM A;  1MMG A;  4XL9 A;  4ZC3 A;  4QPQ A;  1WJC A;  1X4P A;  2BW3 B;  3K4L A;  3VSL A;  2WAF A;  2JSP A;  2R7O A;  3DKX A;  4QPO A;  4DOZ A;  2R4G A;  2DT6 A;  4XOP A;  4X0G A;  2X1E A;  3RPU D;  3MKZ A;  4PJN A;  1WJA A;  4RLF A;  4Y3O A;  3AL0 C;  1L2M A;  2WA0 A;  4CCO A;  4B44 A;  4BQO A;  2VJ5 A;  2OUM A;  2VQL A;  3LSM A;  1TZL A;  3SYT A;  5DCX A;  3VWB A;  2CUZ A;  4C2T A;  1Z3Y A;  4HRI A;  2HZD A;  4ZJZ A;  2E5Z A;  3OYG A;  3CP2 A;  1DGR M;  3OIQ A;  4EAT A;  2JVG A;  2DXI A;  2E60 A;  4IKF A;  3IAS 2;  5CQG A;  2R7T A;  5JHF A;  3FDY A;  2GOX B;  4HG2 A;  4LG3 A;  4CCL A;  1V5E A;  2A6T A;  2K9L A;  3EPZ A;  3ONQ A;  1QHH D;  2DOA A;  1MMD A;  4F55 A;  1G59 A;  3IP4 B;  2CFO A;  4NBP A;  4BEH B;  2IGK A;  1EA3 A;  3PSI A;  4RMN A;  2PJR A;  2K3P A;  4CCM A;  2M7B A;  3QYF A;  4IQ4 A;  4C30 A;  2FUG 2;  2VL8 A;  2CV1 A;  2LOO A;  2VLA A;  2HNH A;  3VYU B;  5BYG A;  4J00 A;  3TBI A;  3VYS B;  3RCO A;  4E7J A;  4DJA A;  2XF5 A;  2CMP A;  2M0M A;  3I3L A;  2R7S A;  2KP6 A;  2KHM A;  2CW7 A;  3F9K A;  3PNT A;  2VB6 A;  4BJ5 C;  5TGT A;  4BAC A;  4GRI A;  3OYH A;  4KIS A;  2QKL B;  4H4K C;  2VXZ A;  3LL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...