3DKYA

Crystal structure of the replication initiator protein encoded on plasmid pmv158 (repb), tetragonal form, to 3.6 ang resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
200
structure length
200
Chain Sequence
EKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSSIKGQKYKKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHESKDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYDFIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Replication protein repB
publication title Plasmid replication initiator RepB forms a hexamer reminiscent of ring helicases and has mobile nuclease domains
pubmed doi rcsb
source organism Streptococcus agalactiae
total genus 58
structure length 200
sequence length 200
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01719 Rep_2 Plasmid replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3dkyA02
3.40.1310.30 Alpha Beta 3-Layer(aba) Sandwich Replication Protein E1; Chain: A, Replication Protein E1; Chain: A, 3dkyA01
4U87A 3DKYA 3DKXA
chains in the Genus database with same CATH superfamily
2WV0A 2WY8Q 4JQFA 4ZC3A 2QZ8A 1RZ4A 3ZRGA 3I4MJ 4IHVA 1RUNA 2PBIA 4YFKF 1SFOJ 1XGMA 2K9QA 4D5FA 2V6CA 1D0YA 3BZKA 1MBJA 4EVIA 2M7AA 2PEXA 1AKHB 1GXQA 3M9AA 4OAZA 1MD0A 1SD7A 2RQPA 5B66C 1VQOI 1I1SA 2YX4A 2IA1A 5C44J 1FSEA 1AKHA 4LMDA 1BN5A 1IGNA 1UJ8A 3IAM2 3ZQGA 3QU3A 4F92B 1MNMC 2ISYA 2PN6A 3LSKA 4XICA 5EZHA 4BYYA 1BJAA 3CP2A 1YW7A 3K70C 1MBKA 1ETXA 3S3NA 4HYEA 3BTLA 4XN0A 3BR0A 5HNFA 4ZZDA 4Y13A 2YX7A 2HOSA 1QHHD 1H9TA 4CCJA 1OMIA 3E5QA 3VYSB 4RAFA 3WE2A 3FZVA 4LIUA 2R7WA 2KFDA 2XAGA 3FMRA 4BDYA 1W36D 1BA5A 5JHFA 1MMNA 1SANA 2IJLA 3RJPA 3A2KA 4Y52J 4YRVA 3OR2C 4DOZA 4PJMA 2AO9A 2BOLA 5E3NA 5ILSA 3HOXJ 2H8WA 3I3LA 2ETHA 1BL0A 2E7XA 3PL8A 4RAGA 3F72A 2OCEA 3LSMA 2DI3A 4F52A 3WTWC 1UHWA 1U9NA 4I76A 2L9SA 4GCVA 4G9YA 5GAEJ 2QKMB 3GTMJ 4F93B 2QEXI 2EQRA 1W0TA 2XB0X 4L9VA 4PJ0C 1FC3A 2K3FA 4FX4A 4NBQA 1P2FA 1OYWA 2E71A 1ONVA 3I59B 4H0EA 2F5FA 1TQMA 1WI9A 1JKOC 1XMKA 2HNHA 1N75A 2Y48A 3I59A 3KETA 1WJ5A 2IGMA 2DFFA 5BS6A 5E79C 3R61A 4K2EA 3DLLF 2EFQA 4C2TA 3CDLA 3G4SI 2DOEA 2W85A 2F5VA 2Z5UA 4HF0A 4RM2A 3IUOA 1STZA 4DW6A 4IEJA 3DEEA 4HF2A 4HSRA 4PFOA 4HW0A 3T8RA 3AL0C 4FASD 2A69F 2NS0A 2ZFWA 3DLAA 5E1ZB 1KYWA 3CO6C 4FE4A 4BDZA 3LA3A 3GUDA 2GXAA 1J0RA 3AG3H 3HOTA 2CH0A 2MD5A 2NOGA 4DJAA 4BHPA 2LSOA 4PDKA 3GW2A 5J47A 2CGPA 4XSZF 5K7ZA 2KISA 3TDZC 1TC3C 1XD7A 2Y0SN 3M3YJ 2KLOA 4NC7A 3PIPF 2LRDA 1D1BA 1TWGJ 2V9PA 4A3FJ 3N97A 2K4JA 4M9ZA 1TW3A 2R7FA 2DMPA 2V9KA 1DGWY 3G73A 2J5OA 3S1MJ 1GHCA 3ZQFA 3U21A 3KEYA 1X1CA 4CZCA 2E1MB 4QTRA 1J09A 1HOMA 2XAUA 3REOA 1FMWA 3E97A 3QYFA 4JK1X 3DU6A 3C2BA 3KP5A 1Y0UA 2HZDA 3M1EA 5DM7F 2EPFA 2B0LA 4NC6A 4CICA 1ODDA 1IV6A 3QYBA 3HOYJ 2LTPA 2EB7A 3I9V2 1U8BA 3V7RA 3ERED 1VQLI 5F04A 3FXRA 3GTQJ 1JHHA 1MBFA 2K02A 3S93A 1T56A 2L5QA 1HQCA 1Z7LA 3BZCA 1N78A 2IAIA 1RESA 2XDVA 3C1DA 4ZJZA 3PUBA 2CW7A 2JA6J 4MQVA 2G0EA 4U7BA 1O4XA 3DTEA 5C3EJ 1GV2A 1IJWC 1X2NA 1GDTA 1HW2A 2JSPA 4IOAF 2IBDA 5CYNA 4Y17A 4AD9A 3SQNA 3HC7A 3HGYA 1ZAOA 2W7NA 4HOBA 4U0WA 1TLHB 3W2AA 5CVVA 3BG9A 2W82A 2RC4A 3BCBA 4KMUX 3HRUA 3S1RJ 2P5KA 3BT9A 4OMYA 1L3LA 1IW7F 3A02A 5H6RA 5KHDA 3KE2A 5M5YJ 2HFHA 1HF0A 3JSPA 5J4VA 3CF2A 1E3HA 1VQ8I 5GAGJ 3SZGA 1A5JA 2LFBA 2QENA 3VSKA 3EYIA 1HDPA 2TRTA 2ZCWA 2DAOA 2YSRA 3S3OA 2DQRA 4HDUA 2KRHA 2WV1A 1B9NA 2KZVA 2XF5A 2HWVA 5H6QA 3WTSC 2ISZA 2ITLA 3TEDA 4C2UA 4A5MA 2KKOA 2ZXWH 2VBYA 2E2JJ 3HPHA 4A3DJ 4X6AJ 1RIOH 1R22A 3ECHA 1JGSA 1S7OA 1I3QJ 2CFXA 2DQLA 1R5GA 4FHTA 4FE7A 5M3MJ 2TCTA 4CDGA 4QWQA 1YRNB 2DA7A 3E5XA 1ZARA 3RSNA 3HOUJ 1FYMA 1YRNA 4I0BA 3FXMA 3D5LA 2VJ5A 4RMNA 2JA5J 1ZN2A 3CJTB 3EYYA 4B48A 3HL2A 2NVYJ 2NAZA 4LLNA 4JYKA 3GEZA 2A6EF 2FBHA 2X6XA 3ZN0A 4KMFA 3P9CA 5LGNA 4LIFA 2HZTA 2JRMA 1R7JA 5F27A 2VBWA 2KJBA 2CQKA 5J4YA 3RTRA 2HQ5A 2DXIA 1BBYA 1WRJA 4ABZA 2I8DA 4XBFA 3FXUA 2QKLB 3K4CA 3BG5A 3NARA 4I0AA 2LREA 5EF6A 3GFMA 3H92A 3A0BC 1ZREA 3H9GA 2L7KA 1IXRC 4ESFA 2DDBA 3HZJA 4ZYAA 4I02A 3AG1H 3MQ0A 4KIFA 4YFNF 4MEYF 3LAJA 1QPIA 3F22A 3F21A 2NYXA 1ZG1A 2VE8A 4F91B 3PSIA 3W3CA 2H27A 3IWFA 4E7LA 1V55H 3L09A 5DCMB 2IRFG 4E7IA 4WWCA 2CUJA 2VC1A 3K2AA 4B1RA 3IWZA 3QPTA 3LSGA 2DO7A 5DCMA 2HDDA 5HLHA 1XSDA 2QSFX 2X6WA 3RKWA 2ZSHB 3K4JA 2E36A 2FBIA 5J3LA 3LQRA 3J7ZI 5HDKA 1A04A 3HHHA 1P4AA 2IS4A 5J1RA 3JTHA 5FLXK 4IJAA 1KZHA 1JUSA 3E6MA 5IYDJ 5GAHJ 2HPIA 5HOOA 1W0UA 1RZ9A 5KVRA 3LQQA 2E2IJ 5CYVA 5FKMA 3T1BA 2YU9J 1Z9CA 5IP9J 1IRFA 5BMZA 1XDUA 1ZG3A 2NVQJ 3HSEA 1DPUA 3FXLA 2EIMH 3BP8A 3GX4X 1I50J 1S9HA 1BIBA 3H9JA 5B1AH 1VQ5I 2VXZA 4HX7A 4XMYA 4EGYA 3BQZA 1NHAA 3ABMH 4NHJA 4OIOF 3WGGA 3H3VK 2ZC2A 3FDYA 2X6YA 2FNAA 2A5WA 3A03A 3WE3A 2IEKA 2Y31A 4Y33A 3A1YA 1AU7A 4BE0A 1YHQI 1BOBA 1YIJI 2DA6A 5DEQA 4HG2A 3OYKA 5CVIA 4A3EJ 5LEJA 1VQ4I 4EJVA 4AIHA 2FE3A 4LGWA 3Q5FA 1ZYRF 3GTJJ 2ADUA 2GIVA 3LL7A 3LOCA 1FYLA 5IP7J 1NTCA 2IF9A 2HR3A 3O6BB 3SEQA 5B1BH 3OWTA 3GWZA 3V8JA 5C4JJ 4A3JJ 5HLTA 1CGPA 1D8JA 4S04A 4J01A 2BVMA 2P5LC 5E3OA 1MGTA 4IF4A 3WGHA 4PJJA 1BR1A 1H8AC 3TO9A 2L4MA 1K4SA 4XKWA 4LK0F 1IN5A 3FX3A 3S2HJ 4IPAA 3EUKL 3F9KA 1ZR4A 1KQ8A 2JSCA 4XL9A 2WAEA 2JRTA 4A3GJ 3DF8A 2COMA 2R7ZJ 3G1LA 2ACJA 5TISC 4ON0A 1Z05A 4IQ4A 4XLHA 1T0FA 2HVQA 4XNFA 3ZQLA 4ZYHA 1AA7A 3E7LA 1S6LA 2JT1A 5JI6A 1ZG5A 1R58A 3B73A 9ANTA 4DYQA 1EF4A 2AXTC 3K4LA 3DEUA 4I99C 4M6YA 2K7LA 2M1BA 2XAQA 3OYLA 2M7BA 4WF2A 3OYAA 4Y4RA 3W6KB 4M3GA 4S05A 5LHGA 1FJLA 1QBJA 4JP0A 3IHUA 1QPMA 3QWLA 4IHTA 1K7AA 1D1CA 3LSTA 3MKYB 5M3FJ 1JKPC 3J7AO 5FGMA 4WXCA 5K7HA 4ENKA 2BHZA 3ZGKA 5GPCA 2HOEA 3KP2A 3K70D 2GQQA 2QBYB 2X1EA 3P5JA 2EIKH 3E0JB 4RS8A 5M5WJ 2OU2A 2ITJA 3C2GA 5EYRA 4PSWA 2QBYA 1OYYA 1OJLA 3CC4I 5K7FA 2VXDA 1XB4A 2XSDC 2QSGX 2K9SA 4MNUA 2WBMA 4MFEA 4A93J 2MA3A 2YPRA 4C3IJ 1MJBA 2F6CA 3WODF 4UVAA 2Z33A 1VQPI 2EFNA 4XRSG 3RPUA 3QPHA 2LKXA 3GCMA 4CCOA 3OS1A 4MO7A 4TV7A 2UV1A 2Y2ZA 3QFQA 5BQTA 3F8MA 1LUJB 4U7DA 3S16J 2V1XA 4U0YA 2OQRA 2QQ8A 2P5VA 2PQ8A 2HQNA 2AQEA 3OYJA 3HOVJ 2B9SA 1PP7U 1JXSA 1ETOA 1WJDA 2ECBA 2VLAA 1R71A 1SFXA 4BXXJ 1I27A 2G7UA 1O3RA 1E17A 1IN6A 1OCOH 1XX5A 1OR7A 2BYVE 3M7GA 4EGZA 5DUIA 4I2OA 4GFBA 4JBAA 2HW0A 4BS9A 3AAFA 1J75A 3CF5F 2NRAC 3DKYA 1V5GA 1TP4A 3VOEA 4IZZA 1R5HA 3CCVI 3CLQA 3PIOF 4A0YA 1A31A 1PJRA 1Q1VA 2D2WA 1WVRA 5ICFA 2BEOA 1MBEA 2H6CA 1USSA 4J19A 1VF9A 3NAUA 2R7VA 4G7HF 5HS9A 2ZNZA 4YELA 4R1HA 3VYTB 2QQAA 2FUG2 3WU1B 4M74A 4HAMA 3LSPA 3HRMA 4AIJA 2GIZA 4HQMA 5FKOA 2PJRB 4G94A 1Z21A 1T0FC 5LHIA 3JREA 3D5SC 2WB1N 3J7YJ 1BIAA 4D0PA 2PJRA 2W4SA 3OIQA 1F36A 2ZSIB 2QLZA 3QODA 3QOEA 2ZJPF 5LGUA 1IC8A 1FIPA 5KAIC 4ZDOA 2L7MP 1R9TJ 1ENHA 1EJ9A 1N25A 3EUAA 4P96A 2DOAA 1DDNA 1T98A 3CMEI 4MIMA 4FCYA 1KQ9A 2H1KA 3W6VA 3D1NI 1VFCA 3HKZN 3HBLA 2CWEA 5HS8A 5HVQC 2EFPA 2DK8A 1XGOA 4RB0A 2P0WA 3ZQQA 1YS6A 4GGGA 2F4OB 4A12A 5ERIA 4U88A 5KCMA 2XPVA 3QPLA 1RC9A 1MH3A 2LK2A 4BE1A 1PP8F 2A61A 4C3JJ 2A07F 2K40A 4EEFG 1D8KA 1U6GA 1GV5A 4CGZA 4KNYA 4PUSA 2XC7A 1YX3A 3JAMK 2ZJQF 2MGQA 2BXZA 1WGXA 1XCBA 3O8HA 2VUMJ 4A3IJ 3GZ5A 2OPTA 2I10A 3KEQA 3G71I 4FB3A 3NRVA 5LGTA 5J1UA 1OCZH 1APLC 5DM6F 2L4AA 3PNYA 1JKQC 1O3SA 5TGTA 1MJ9A 2A6HF 2VC0A 3VYUB 2ZFUA 3CJNA 3SYTA 1K83J 4YEJA 2IA0A 2VI6A 5E1WA 2M45A 1OCPA 1Y1VJ 3K0LA 1KSYA 2EINH 3CCJI 1VQKI 4CZZA 3GFJA 3SFZA 4UUTA 1VNDA 2EJRA 4KN4X 1V4RA 3RQ4A 4BJ6C 3H36A 3L2WA 4BL0B 3MKWB 2NXNB 4EMSA 3KCCA 3FXQA 3F3XA 3WGIA 3RPQA 1YIOA 2BY1A 1WHUA 3GXOA 1IF1A 3ZP5A 4A6EA 4IKFA 4DBQA 2OC6A 2QA4I 2OA4A 1WJAA 4M3BA 5EG0B 3LFUA 1CQTA 1S5LC 1ETWA 1EH7A 2Z99A 4PCQA 5EG0A 2DJIA 1LQ1A 2ELKA 3DBHB 3QQAA 5L3GA 1T6SA 2VOPA 2AXLA 1LDKB 5IOZA 3BLYA 1MIJA 2E5NA 4CA0A 2H6BA 1VQMI 2P4WA 3CUQC 2ZKZA 1BC7C 1Y0NA 4P5OA 1UHSA 1WFXA 1ETYA 1F43A 3HOWJ 4OAYA 1X1DA 2Y30A 2GAUA 3K1MA 4XLCA 3K4KA 4L9JA 5HDNA 3KLNA 3PQKA 2FX0A 4OWRB 3TW6A 2BZTA 2MYSA 3GFIA 3L2UA 1D0ZA 3F6VA 2KDZA 3Q9SA 4I6ZA 1ZTRA 2R5ZB 4BJ5C 2DODA 3LSHA 3RKYA 3NWSA 2A3SA 1FPQA 2HXOA 1IN4A 2VE9A 5FLVA 4M6XA 2UZKA 2R5ZA 2EZHA 5AONA 1U9OA 3E5UA 1IDZA 4WXHA 2GOXB 3U2RA 1MJAA 2E1NA 4BQNA 5CPRB 1Z0XA 3JRHA 2CQQA 4XORA 3WTXC 5F0HA 1F9NA 2RDPA 2Y69H 1PUEE 2XGCA 1Y56A 4BHBA 1IN8A 1DPRA 1FOKA 4LMYA 1SFKA 3I56I 3SJMA 2HKXA 2QYOA 3ABTA 4KISA 2HGCA 5DTDA 1BJZA 2R7XA 5F1JA 1FMVA 2M9HA 1E2XA 3KP3A 2RVCA 5IT9Z 5LFAA 2XPUA 3H5NA 1Q1HA 3CQZJ 2EK5A 3V8LA 3PQJA 1K78B 3H0GJ 6PAXA 1A6QA 3FHZA 2E1CA 1K78A 5DYMA 2BHYA 4IRGA 4ZDLA 1IRXA 2ZNYA 1K4TA 2X48A 1I1GA 2DFHA 4A3BJ 2W57A 2Z1DA 2IS6A 2DLLA 1S29A 3HSRA 4FX0A 3ERMA 3K2ZA 2RAEA 3ROUA 3BROA 3DCFA 3I5UA 3KPHA 3TOAA 3L2RA 4GYGA 4RGUA 5ILVA 3I64A 2LR8A 2R7UA 2MH2A 3CCRI 4YFXF 1FIAA 2NNYA 2R5YB 3CD6I 4BY7J 1CF7B 3G6EI 3PNTA 4EV0A 1Z3XA 2KMUA 1BI1A 4UUSB 2R5YA 1CF7A 3H0DA 5K5RA 1ON2A 2VT2A 4CCKA 4UUSA 1GXPA 3M8JA 5E8GA 2R93J 1DU6A 3RZDJ 1K79A 1YITI 1O3TA 4HX8A 4NUBA 1YOVB 2CS3A 3HEFA 3HPGA 4CYDA 3DKXA 3MKLA 3JRBA 1NG7A 3ML6A 3M8EA 3CCLI 1PVEA 2L0KA 1RR8C 2KT0A 5FKKA 3BQYA 1OQYA 2ZO4A 2M34A 4RGXA 1G2HA 1WJCA 2CU7A 2WAQN 3KP7A 2GA1A 5D5WB 1U8RA 1ZK8A 5L3FA 2CQNA 3J80K 4BU2A 4M72A 2XUBA 3RYPA 1UCRA 4XK4A 4HNVA 2V6EA 2C6YA 2EA2A 3KZZA 1LFPA 1ZLKA 3BG6A 1NK2P 1R4NB 4OINF 4S0HB 4HLYA 2QWWA 2P7VB 1SVMA 2VKHA 2RNGA 3ZXSA 2WA0A 4G6QA 3AG4H 2OTLI 3BTJA 1P6RA 1U0JA 2Q1ZB 1XCVA 4HNUA 4ENMA 2UXNA 1F5TA 4CH7A 4KT6A 1JI8A 4PGHA 3SZTA 3CDHA 3TO6A 1L5IA 2E7WA 1E0EA 4ZYEA 3P7NA 1XSVA 4P9FA 3GO5A 3CESA 1G3TA 2XROA 2I5UA 3ELKA 4UB6C 2DT7B 2EZIA 4IRHA 2O8KA 4O5VA 4BKXA 1NG6A 2HOAA 4BQOA 4HV5A 3F8BA 3DP7A 1DU0A 1SMYF 2DJNA 4FETA 1BM9A 4BEHB 1YQAA 2HTSA 2IA2A 3KYCB 5A2QK 3WHBA 4UY8I 4IOCF 3OMYA 5FKLA 4BEHA 5M5XJ 1H89C 5CVJA 5JR3A 5L3EA 1SAUA 4M9XA 2JUGA 5GADJ 2V1UA 4HNTA 1K6YA 3JRIA 2RREA 4F3QA 4YIIA 3IKTA 3BZ6A 2L3DA 3Q0WA 2R7QA 2V26A 4HF1A 5FFXA 2AQFA 3K4BA 2D5VA 1LVKA 4UVCA 2COBA 2JVHA 1LE8B 1OKRA 2OF7A 2NNNA 2IGNA 2CW8A 2LY1A 2HPMA 3HB9A 5D4RA 3S1QJ 4KJZA 1LE8A 3DPLC 3IKVA 4ZH4F 1ITYA 2STTA 5DS9A 2Y0MA 4KYWA 2DFIA 1QQIA 1TT0A 1ACIA 1BW6A 1B59A 3DBRB 5FB2A 2GZWA 3J81K 2DT6A 5E17F 4L5EA 2F5DA 5IP6A 2GBYA 2OQGA 4AYBN 2OCCH 2P7CB 5L3CA 3E6CC 3HDDA 1WKMA 3L2QA 2E1MC 1IDYA 3VFZA 1WH5A 3AFHA 4E7SA 1D5YA 1R5ID 1KGSA 1UB9A 1ZGAA 4Z6YA 3JTGA 2CO5A 3AKZA 3OYGA 3JRGA 1HXDA 5HNHA 1SC7A 2L9NA 3GZNB 4DGWB 5ICEA 2JA8J 2P81A 2MC4A 1SD6A 2WY7Q 1B9MA 2BBYA 4XOPA 2A6TA 3KYLA 3S2DJ 2QQBA 2VJJA 1TNSA 3FK6A 1J5YA 2MLKA 4B4CA 5D5UB 2E35A 3F8NA 4FT8A 2DBBA 2BE5F 4N4OB 3H35A 3FHNA 3DWLE 3MCZA 3W6JB 2QM3A 3PO3J 4H4KC 3JW4A 4ZTJA 3I4NJ 1IXSB 4LB5A 3OSGA 4ANJA 4QPOA 3CC7I 2RQQA 1OCRH 2BY2A 2XB5A 1H9GA 1RR7A 4M3EA 4O3MA 4NB5A 4Q5SF 2X85A 3F6OA 1T2KA 4CHUA 1UFMA 2FMYA 2FQ4A 4IVNA 1P7JA 4NNJA 1HA8A 1QHGA 2DOFA 1QZYA 2X1CA 2VQCA 5F64A 2KIMA 4G6TB 4RGRA 5DD4A 1P9QC 4UB8C 2QUFA 4B8XA 2ZBKA 2VPRA 4W97A 1L0OC 1S7EA 1XDSA 4DNCA 3QRFF 1HLVA 1I6XA 1OISA 2V9VA 4LG3A 3RQIA 2JA7J 3V7CA 2K4BA 1Z77A 2XIGA 4E6KG 3K9TA 3DQVC 1Z3YA 5F08A 4G12A 1RUOA 3K1PA 3RIRA 5F1RA 3QP6A 1TBXA 2W00A 3I58A 4DZPA 2KRCA 5HLIA 3ZMVA 2M0MA 1XGSA 1BI3A 2XGXA 5EDNA 2EV0A 3OYNA 3MKZA 3MMYB 3JCUC 4Y3OA 3PO2J 1S72I 4OOIA 1TWAJ 3LA2A 1GUUA 5HLGA 5DV5A 2DW4A 3BCAA 3HRSA 4UXNA 4L18B 4XLPF 4XLEA 2HYFA 3DV8A 4QLCU 1P92A 2H8RA 2VQLA 4BQAA 1PUFB 3BDDA 5D4SA 3H9QA 4MTEA 5JLXA 2Y75A 3IH3A 1R49A 3DPUA 1X19A 1PUFA 1LDDA 1FBQA 1G3WA 4OIPF 3TQNA 3S8PA 4MEXF 3ESWB 3OYMA 3KFWX 1WZ2A 2A68F 2FF4A 1W5SA 2L7ZA 5K1YA 2M30A 3B6CA 2A5YB 3JRAA 5CLSA 3S3MA 2FSWA 4B09A 4IHSA 4O6JA 2VQHA 4A5NA 3WG9A 2L9VA 2KPMA 4V2GA 3OS0A 2IS2A 3BOQA 4A6DA 3RKXA 1MH4A 4JX4A 1BW5A 4XQFA 4CXFA 2YR2A 3NEUA 2HQAA 2E34A 2LF8A 4FGNA 4BXUA 3Q3SA 3KP6A 1FP1D 2MABA 4EJTA 2X6OA 5IY5H 3G1MA 5J6XA 1JHFA 3I54A 3TBIA 4IX7A 2XKOA 2O61A 2OV7A 2KIFA 2VJ4A 4Q47A 4EM1A 4B3XA 4D7NA 5D5VB 2F5EA 2X4HA 4WX9A 1HKQA 2MD0A 3F0CA 1QNTA 3ABLH 1UG2A 3ASOH 3KIOA 4C9YA 5EGOB 1YW8A 1DQUA 2H09A 2VOOA 3VODA 5EGOA 2ME0A 4AIKA 1WPKA 3N05A 2LD5A 3CTAA 4L9TA 3ZMZA 4QIWN 4NBPA 5DD8A 3WG7H 1ZGWA 3Q0VA 2WC2A 4BNCA 1GLNA 3IL2A 1W7PD 2XHKA 4LIVA 1SFEA 1TQIA 5DDGA 5TRDA 1YW9A 1Z67A 1HC8A 3X2QH 3GVAA 4CCNA 1UZCA 2QF7A 3SFIA 4MTDA 1HSJA 3CDIA 1QRYA 2VT3A 2FOWA 3ZMTA 4D1QA 4UVBA 3WU2C 2KL4A 2DPUA 2VONA 2ELJA 2RKHA 5K5QA 1WSUA 2Q8KA 5KAFC 3WTYC 2K9NA 4EM0B 2M2EA 1Y39A 1FZPB 2AHQA 2FEZA 3BTCA 4HSTA 1Z7UA 1FTTA 1KU2A 2Y0SA 2JPCA 2R7SA 2R3SA 3FXKA 1KSXA 3KZIC 1VQNI 4AC0A 4RBOA 2LOOA 4YIFA 3SHFA 3NWTA 5JVTA 1G8XA 1E3PA 3KYDB 3HRTA 4RDUA 4XKBA 1RPWA 4I98B 4NQWB 5JLWA 4Y15A 4N9HA 4YG2F 5BYGA 3R4KA 1K6OA 1MMDA 4NQWA 3DXJF 3M07A 1XS9A 3ZQIA 1PYVA 1ULYA 4GO1A 4ENJA 1E3OC 2FNPA 4XKVA 2EWNA 5FLXZ 1R1UA 1HDDC 4KDPA 1MMGA 3E6DA 1LVAA 4F7ZA 4XRMA 2L02A 3MWMA 4PFPA 2X1DA 5IYBJ 2W48A 1LFBA 1HW1A 4LK1F 2GWRA 1V3FA 2EH3A 2IP2A 2YS9A 2GXGA 1UMQA 2Z2SB 2OUMA 5FO5A 1VTNC 1FOYA 2RN7A 5HDGA 1YX5A 4G8XA 5IYCJ 3A0HC 4OIRF 3CCMI 4ZZLA 1F08A 4CCLA 1IO2A 1ETVA 4P9UA 4ESJA 1GVJA 3G3ZA 1YJNI 1JJ6C 3BR1A 3V7SA 3K7AJ 5L3DA 4RAZA 3Q9VA 3GYHX 3CCSI 1C0WA 5E3LA 2R7DA 3DEWA 3IV5A 2BXYA 4XSXF 2L01A 3HUGB 1IN7A 2DN0A 3KZYA 3SDBA 3K1NA 3WTZA 1PDNC 3HUGA 3DTKA 5LLQA 3GTLJ 1FBSA 2PX9A 3W2VA 1DP3A 3ZMUA 1KYZA 3PM1A 3FM5A 3WTVC 1Z6TA 1LEAA 1TWHJ 3DU5A 2YU3A 2XVCA 3E6BA 3ZOBA 3E3VA 5LBQA 2BY0A 1MSEC 1R23A 3QP5A 3J7AY 2GOMA 3IH4A 5GTIC 2DU9A 2X0LA 4KITB 4XLFA 1JJ8C 4L5IA 5D5XB 3QN2A 1SVLA 2E19A 4HX4A 5LHHA 1IAWA 2RNJA 3G1OA 1RKTA 4HDVA 2V7FA 4HBLA 2M8GX 1V5FA 4BGDA 1WI3A 4LFUA 4II2A 1MBGA 3RCOA 4HA8A 4DYCA 1UG0A 2BGCA 2HXIA 1SMTA 2HOTA 2XSJC 3ABKH 4PJNA 1VI0A 2DMQA 4I01A 2EFWA 1B72B 2ELHA 2VJIA 1MMSA 1EH6A 4DIQA 2XRLA 5E8IA 1JTYA 2E60A 2PG4A 1B72A 4HV6A 3BJAA 4I09A 2M4GA 3TP3A 4LLGF 4AUXA 1I3AA 2XPWA 3MZHA 1OR7C 3TO7A 3KX2A 2DFEA 2PI0A 4AYBA 1ZQ3P 1R6RA 4P1WA 5IT3A 3BPVA 1BOAA 1HW5A 3IH2A 5KNLA 4E4HA 1BI2A 1X58A 1A6IA 3NQOA 3O3KA 3H5RA 1O3QA 2MH9A 3CUOA 4A2UA 5B3SH 1ETKA 4II3A 2LKSA 2ME6A 3OOPA 3HTSB 4CO8A 4GRIA 1ZHFA 3FKJA 4M3FA 3VYRB 4BAYA 5KK1A 4N4NB 2F5CA 4L5JA 3PJRA 3F8CA 1D0XA 3M4OJ 2PFBA 3I4PA 1F1ZA 1HKSA 2K9LA 1M1EB 4NC8A 2F4IA 4EJOA 3BTIA 2VKVA 3C3WA 3C7JA 4L0YB 2STWA 2CSOA 4IHWA 3OYHA 1T8IA 4C2MJ 4CYCB 5BPDA 1YG2A 3CJRB 3OYEA 1T08B 4AWXB 1Z91A 1TZLA 2Z3YA 1IXCA 1JT6A 4CYCA 1R1TA 4RLFA 5JVGF 4QSHA 2DMNA 2W25A 2XASA 3FK7A 1OFCX 5HODA 3BR2A 2FQ3A 5FROA 2D45A 2KIQA 3H5AA 1ZH5A 3D5RC 3ISPA 1FBUA 3Q0UA 5L3BA 1L2MA 3RDIA 4AIDA 3OOUA 3EPZA 5B5EC 2XV4S 1EH8A 2LY2A 2OBPA 1TBDA 3FIWA 5FFZA 1FOXA 3LFKA 4MGRA 4MQ9F 4KW3A 2BV6A 3OYDA 4IXAA 1IUFA 4HQEA 2VKDA 3T0YA 3TW7A 2CW0F 4UHTA 3SDGA 4ZYDA 3GTPJ 3GF2A 3FMSA 4UV8A 2R7TA 4XR6A 1XC5A 4LG0B 1GVDA 2DA3A 2XGDA 3SXYA 1LJ9A 4UUVA 1O7FA 4Q48A 2R7OA 2NVXJ 1Y6IA 4JOMA 4LG0A 2GA2A 2XAFA 3OIOA 3D0SA 1FYKA 4D7MA 1Y8RB 1B4AA 1JGGA 4J00A 2F2EA 2ESHA 4KUMA 2IVMA 2M87A 3BR6A 3ZCOA 2EV5A 2HDWA 3T5XA 3LMMA 1JKRC 2J5PA 4FISA 2LNBA 1G59A 1LPQA 3ABUA 2PMHA 1R9WA 3K4NA 3VWBA 1LNWA 1QZEA 2CQ7A 2CJJA 4X1EA 3R0AA 2JMWA 2RGVA 4A3CJ 1UUTA 2IPQX 2NS8A 5ICGA 4A3MJ 2MSYA 4AM3A 2JWTA 4LITA 2CG4A 4EM2A 5D6EA 1ETQA 4RAYA 4C30A 2XF7A 4LJZF 1USTA 1TW2A 1J2XA 2H94A 2HQRA 2LBFB 2VBZA 4Z2YA 1FNNA 3GTOJ 2ZJ2A 2ICWG 2LBFA 2WTEA 1EKEA 1QVTA 2DMUA 1XMXA 1X2MA 2PJPA 3TL4X 2P6SA 1IZ1A 3OYIA 5DUKA 3H3UA 1WCMJ 3M1CA 1XGNA 2VQGA 3ZQ7A 1B6AA 2KQRA 5CQGA 2MW8A 1IV8A 3A4CA 3TOBA 1T39A 3R0JA 1O7LA 2X9DA 1EV7A 2DPDA 4PZJA 2TBDA 5FRMA 3IRRA 3COAC 3BR5A 3DKWA 1FT9A 3WHCA 1X4OA 1A36A 3WTTC 1JUPA 4A0ZA 3OR1C 1W5CC 2XGEA 2Y9YA 2OD5A 4XLAA 2QVOA 4LLLA 2O3FA 2NTCA 1Z6RA 4GXOA 3JAMZ 4Y7NJ 4BE2A 1T38A 4EQQA 1REPC 4M73A 2WADA 4XIDA 1GT0C 3B02A 2NVTJ 2CMPA 1T33A 4XN3A 3W2WA 1FTZA 3VB2A 3UKGA 2HTJA 1TWCJ 3OIPA 4XRSA 1ZGJA 4M9SA 2DA2A 1WJEA 3I0TA 1POGA 3BY6A 1VQ6I 3K4MA 2K3PA 4QPQA 1HCRA 4LOCA 1RNLA 4G7OF 2KP6A 5E3MA 4BBRJ 1YE9A 3BJ6A 4MHGA 1OLTA 2LMDA 2V4JC 4RB1A 2JZYA 2OAZA 4G7ZF 2MLGA 1N77A 2EV6A 5D8KB 4KIBA 3HSFA 5H2FC 2IW5A 1BR4A 3GBGA 3OYBA 3L7WA 1UHMA 2XAHA 4DQ2A 3VSLA 3JRFA 4LD5A 1LEBA 4RB2C 2V1NA 3FXJA 2X51A 3IC7A 3CCQI 2LYCA 2QSHX 3HGGA 2Q2EB 1FOWA 2L54A 1SEUA 3F8FA 3C18A 1QZZA 2DA4A 2Q0OA 2Q2EA 1KQ0A 5F0CA 4BHCA 1S8NA 2RV8A 2M3AA 1G6NA 5F0FA 1RRJA 2KHMA 3HHGA 1P4WA 4M3DA 2NVUB 1YI2I 4V2FA 2CV2A 2DDAA 1X1AA 2KRFA 4JX6A 3CCYA 2MG4A 3O2PE 1YO5C 3S15J 4XRFA 3V42A 4B3AA 4OMZA 2KDOA 3MEXA 5GPAA 2NOJB 4JX5A 3BWGA 1O57A 2IT0A 1S7AA 2PMZN 2ZB9A 3CMMA 2O5RA 4XLNF 5E1XA 1U78A 2M4KA 1K61A 2FRHA 1KA8A 2V1DA 4ETSA 1W36C 1RKWA 2LC2A 2DMTA 2E5ZA 1H88C 1X4PA 3OSFA 1MKMA 2WB1A 1JTXA 1OPCA 2EIJH 1ZRDA 1G3SA 1XMAA 1ZRFA 2EILH 3FXOA 1FLIA 3QOPA 1Z1DB 4A3KJ 4RB3C 1IG7A 4KT5C 1FY7A 2IPRA 1Z1DA 1Y1WJ 1RETA 3EQLF 3ZN1A 1RI7A 2VASA 2JN6A 2K86A 2EZLA 2LP0A 3HKZA 4LB6B 5BPIA 4AU7A 1JT0A 2D1VA 3AG2H 2MC3A 3GFLA 3WTUC 1NH3A 5F6FA 2JK3A 4F55A 1ZRCA 2XRNA 3QYEA 3H3ZA 1B8IB 5EEGA 2LKPA 3CMAI 1X1PA 1ZELA 3ZQCA 3EUHA 4RA2A 1B8IA 5ILUA 2M8EA 1R1VA 3MZYA 3ECOA 4HPQA 2ID6A 2B7EA 2QQ9A 1FP2A 2K85A 5J40A 1VQ9I 4IRIA 2DA1A 2F48A 2ZMEB 5ICCA 3CC2I 2DK5A 4XKCA 1XTAA 5IPAA 4BUPA 2W24A 2ZMEA 2IXSA 3LWFA 4M6VA 5GP9A 3RYRA 4CCMA 2JUCA 4B44A 1QGPA 2LLKA 3DPTA 4EATA 3MD2A 1IRGA 2CV1A 2WAFA 4KA4A 2HYGD 3V8KA 2HYJA 4EJWA 4L0ZB 1D1AA 2L7FP 3CMYA 2HDCA 1X1BA 2PLYA 1SD5A 2TDXA 2LVSA 2JA2A 3M8FA 3L1PA 1A35A 1OYIA 4EJUA 3L00A 2VKEA 3TP0A 4KFCA 3DTIA 4X0GA 5LEKA 1YJ9I 1BC8C 4DYRA 4AVZA 4G6DA 2L9RA 3N4MA 2W84A 1ZR2A 2UWMA 2P8TA 1LKXA 1JUMA 1TL8A 2ID3A 4M71A 2N8GA 4XM3A 3L2VA 1ON1A 5CJ9A 2CYYA 3VDXA 5CQEA 3S2WA 3GTGJ 2FUFA 1QA6A 5FD5A 3P9KA 4IO9F 5CVUA 1FSHA 5J8CA 1MDMB 4PSXA 1XG1A 3RZOJ 4N9IA 2EZKA 1MDMA 3JR9A 3GZ6A 1TTYA 1NK3P 3J80Z 3HXLA 3FBNB 5EEHA 4NDLA 2IS1A 2FBKA 2IGOA 4A0XA 1YTYA 1FEXA 2QCOA 1P4XA 4AVPA 1WJFA 3CLOA 1ZKGA 1J59A 3K6GA 1MZBA 2LY9A 3LSIA 3TDUC 2WWYA 4U0VA 3HYIA 1AWCA 3LA7A 4FQGA 2R4GA 3GLXA 1YYVA 5AIQA 1R4MB 3GTKJ 1EA3A 3PNVA 3CCEI 4P55A 2BVLA 3LSJA 1T95A 2HU9A 2ZXIA 4B43A 1X3ZB 1QU3A 1H0MA 1I6HJ 5D9IA 3PFYA 2FXAA 1OCCH 3K69A 4KICA 3RPUD 4ZYGA 2FOKA 2H1LA 2MBFA 5FD6A 1YJWI 2GLOA 3FKIJ 4R8HA 4BH9A 4Q4ZF 3LNQA 4FTHA 2AS5F 4D9JA 2O03A 3L9FA 5LRRA 1ZLJA 4E7HA 4WXDA 2JJ7A 3MFKA 3GLLA 1SFUA 2G7HA 2JTVA 4L9NA 3HTUA 3U1KA 1HSTA 2V79A 3BG3A 5H20A 1VZ0A 2OTJI 2DYSH 1U2WA 4XOTA 1ERDA 1U5TB 3C2HA 3IAS2 5HS7A 5EJCA 3T8TA 3CZ6A 3QU6A 2DT5A 1IRZA 3EUHC 2W1OA 5A2QZ 3UNGC 3F23A 3S1NJ 2P6TA 1U5TA 4E7KA 4I7HA 4KIGA 1SAXA 2HVSA 2DTRA 3WU0A 4IHXA 4ZO0A 2NL8A 1R36A 1FWZA 5JFRA 2FJ1A 3RKQA 2ESNA 4DBRA 2ZMEC 5FKNA 4ITVA 2JQ7A 1I39A 2UXXA 1D5VA 4YIRX 5ED4A 4WK8F 3FBIB 4BY1J 1V5EA 4HRIA 2VPLA 4IHYA 1YLFA 2OZUA 5FLMJ 3KLOA 2LG4A 4R79A 5D6FA 3JRDA 3H1CA 3K10A 2Z16A 3BJOA 3CP8A 2HVRA 3I71A 1UAAA 3IRQA 2OZ6A 3TMOA 4N0BA 3HJEA 2CUFA 2LDUA 3R60A 4UV9A 2O8XA 1G3YA 1QO0D 1R00A 4UNOA 4WCGA 3ZMSA 3EETA 4E70A 3BC8A 3BPXA 3MVPA 3J81Z 1DUXC 1JE8A 4V19K 3MAJA 3OL4A 2L2OA 2UUZA 4RGSA 1YFHA 3FMQA 1OCTC 3ZMDA 5D8LB 3S14J 2DA5A 4RM3A 2GXBA 2K9MA 2XKPA 1V54H 2DYRH 1AOYA 1W1WE 5FJ8J 3B6AA 5DCXA 1KU9A 4BXFA 3IP4B 2OJED 2LH9A 1G4DA 5K5OA 4A3LJ 3O8GA 5GTHC 3CCUI 3S32A 2EBIA 2ZJRF 1WH7A 3FM3A 2Y9ZA 2HI3A 2JVGA 3DFGA 2O6GE 5LD2C 5C4XJ 2HS5A 2CV0A 3UR3C 3VPRA 4ZDPA 2CFOA 4CSWA 2DTZA 3A01B 4B47A 3OS2A 2VB6A 2A05A 5BOXA 3FWEA 2FD5A 1B1BA 1J7KA 4OIQF 3ULQB 1Y8QB 3A01A 2FA5A 3RI4A 1BI0A 5J8FA 3TGNA 3E1SA 1X3UA 3PFIA 2K27A 2FU4A 2G9WA 2M0CA 1DP7P 4PGGA 2BY3A 2B63J 2ECCA 4GYIA 4HLXA 3KP4A 4BQQA 3L2CA 4IL6C 1J9IA 4ENNA 2D1HA 3MN2A 3FISA 1SVOA 5EEAA 1VQ7I 1MMAA 1TQPA 2CQXA 2F4MB 4HEA2 5CVRA 1SD4A 2WAQA 3OYCA 3QPSA 1MNDA 2JPBA 1D3YA 2PMUA 1XPXA 4RLQA 3OYFA 2R7RA 4BBSJ 3I53A 2O0YA 5DCFA 3JSOA 1TT5B 2HKOA 2YUSA 4XONA 1X3WB 5J1YA 3LSRA 4PK4A 1YS7A 3GMEA 2LF7A 3QAHA 3S17J 1WQ2A 2ZXJA 1KONA 3BG7A 1W4MA 3U1DA 1W7PB 2DCEA 3FF5A 3ASNH 5IT9K 3ZPLA 3SZPA 4ZTFA 2KZGA 4ZQ9A 1W7PA 1XN7A 4IQJA 3ZR8X 1XSXA 2FMLA 2VL8A 3TKYA 5LRSA 1U5TC 3BR3A 5EZGA 2R0QC 3CUQB 3SEZA 1TNTA 3PUFA 4ASNA 2HEOA 1P7IA 4C3HJ 3U9GA 3CUQA 5TJJA 4D5CA 1MSFC 1S3JA 1WWXA 3HOSA 5CKTA 2IGKA 4ESBA 2ZXHA 5BNGA 4MFDA 1KU3A 3QK2A 1U3EM 3I55I 1W5TA 2CRGA 3HOZJ 2QGUA 2XF6A 3P9IA 2KJCA 2EFOA 2Z9OA 3HG9A 1IUYA 3OV8A 2M5WA 4A69C 3HM5A 4BJTA 4OU0A 3LAPA 5IOYA 3CO7C 4BACA 4DZJA 2EA4A 1ORKA 5E20A 3JRCA 1BR2A 3VEPA 4KN7X 3G2BA 4HZFA 3ZQHA 3R6SA 3PSFA 1AHDP 2E2HJ 2O9LA 2CUZA 1HBXG 2VBXA 1DGRM 2VIXA 1QVUA 1LFUP 3V4GA 1WJBA 4MLOA 1M55A 1KU7A 3CJQB 1LDJA 3EDPA 3HIFA 3OL3A 2KIUA 1MNEA 2O7OA 1F4KA 1I5ZA 2R92J 3KEOA 1LB2A 2K5CA 5AIPA 2PMZA 5JHUA 4E7ZA 3OY9A 4CUGA 2MFZA 2NS7A 4U87A 1UELB 2BW3B 1MW7A 5E18F 3ONQA 3DBLB 4GDFA 5FRNA 2BW3A 3MZ8A 2GM4A 2VN2A 2VODA 1FX7A 1HKTA 4PJLA 1TWFJ 4E7JA 1MBHA 2E1OA 2CUEA 3AL0B 4W1UA 2XAJA
chains in the Genus database with same CATH topology
4H4KC 2NTCA 2WY8Q 2VXDA 4ZTJA 4BE2A 4JQFA 4ZC3A 3ZRGA 4ANJA 2WADA 4QPOA 2WBMA 2RQQA 2CMPA 4XN3A 3W2WA 1D0YA 2M7AA 2X85A 2F6CA 3OIPA 4OAZA 4NNJA 1HA8A 1QHGA 4CCOA 3OS1A 2X1CA 2UV1A 2VQCA 3QFQA 1WJEA 4G6TB 1P9QC 3K4MA 4LMDA 2K3PA 4QPQA 3IAM2 2KP6A 4F92B 4LG3A 2AQEA 3OYJA 1YE9A 1WJDA 3LSKA 2VLAA 4E6KG 3DQVC 1Z3YA 1OLTA 3CP2A 2V4JC 3K70C 1N77A 3S3NA 4XN0A 5HNFA 2HW0A 4BS9A 2W00A 2KRCA 3DKYA 1BR4A 3GBGA 2M0MA 3OYBA 1V5GA 1QHHD 4IZZA 4CCJA 1PJRA 3VYSB 3VSLA 3MKZA 3OYNA 3MMYB 4Y3OA 4LIUA 2V1NA 2R7WA 4BDYA 1W36D 2X51A 2LYCA 5JHFA 1MMNA 2R7VA 2Q2EB 4YELA 3VYTB 3A2KA 2FUG2 3BCAA 4YRVA 4XLEA 3OR2C 4DOZA 4PJMA 2BOLA 2M3AA 2VQLA 2PJRB 1Z21A 2KHMA 1T0FC 3H9QA 3I3LA 3D5SC 3DPUA 1X19A 2PJRA 2W4SA 3OIQA 2ZSIB 3PL8A 2CV2A 3QODA 3QOEA 3S8PA 1X1AA 3LSMA 4F52A 3OYMA 4ZDOA 2L9SA 3V42A 2QKMB 3EUAA 4F93B 3S3MA 2DOAA 2KDOA 2NOJB 2VQHA 3CMMA 2O5RA 2KPMA 3OS0A 2IS2A 2M4KA 4XQFA 5HVQC 1W36C 2HQAA 4FGNA 2LC2A 2E5ZA 3ZQQA 2P0WA 1X4PA 2MABA 2WB1A 2HNHA 5KCMA 1N75A 3TBIA 4IX7A 1WJ5A 1Z1DB 2IGMA 2OV7A 2VJ4A 4B3XA 4BE1A 4C2TA 2IPRA 2MD0A 2F5VA 4RM2A 3IUOA 4C9YA 2VASA 3DEEA 4HSRA 4PUSA 4PFOA 3AL0C 1DQUA 1YX3A 4FASD 3DLAA 2XC7A 3HKZA 4AU7A 4BDZA 3N05A 4F55A 3HOTA 2CH0A 3QYEA 4DJAA 4NBPA 4FB3A 1ZELA 1GLNA 3PNYA 4LIVA 5TGTA 2KLOA 4NC7A 2LRDA 4HPQA 1D1BA 3VYUB 2ZFUA 3SYTA 4CCNA 4YEJA 4XKCA 4D1QA 1KSYA 2V9KA 1DGWY 4BUPA 2KL4A 3U21A 2IXSA 3KEYA 4CCMA 4B44A 1X1CA 4CZCA 2E1MB 1J09A 2XAUA 3DPTA 4EATA 3MD2A 2ELJA 1FMWA 3QYFA 3RQ4A 4BJ6C 3L2WA 3DU6A 2CV1A 4BL0B 2WAFA 3MKWB 2HZDA 1D1AA 4HSTA 1X1BA 2Y0SA 3QYBA 3I9V2 2R7SA 2JA2A 4IKFA 4DBQA 2OC6A 1KSXA 1WJAA 3DTIA 3LFUA 4X0GA 3S93A 2LOOA 2L5QA 1Z7LA 4AVZA 1N78A 2DJIA 2XDVA 3NWTA 2UWMA 4ZJZA 1G8XA 3PUBA 2CW7A 4XKBA 1LKXA 1LDKB 3L2VA 4NQWB 3BLYA 4XM3A 4U7BA 2E5NA 4CA0A 3VDXA 3DTEA 5CQEA 2FUFA 5BYGA 1MMDA 2JSPA 1PYVA 5CYNA 4P5OA 4PSXA 1WFXA 3HC7A 4XKVA 2W7NA 1MMGA 3W2AA 2W82A 3BCBA 4OAYA 1X1DA 2X1DA 4PFPA 4XLCA 3K4KA 3HXLA 3FBNB 2IS1A 2IGOA 2Z2SB 2OUMA 3L2UA 4OWRB 1WJFA 2MYSA 1D0ZA 3K6GA 1YX5A 3LSIA 5KHDA 4BJ5C 3LSHA 1F08A 4CCLA 3NWSA 2R4GA 3CF2A 3SZGA 2GOXB 3VSKA 4BQNA 5CPRB 1EA3A 3PNVA 3S3OA 4XORA 2BVLA 1T95A 2HU9A 2ZXIA 4B43A 2KRHA 1QU3A 3HUGB 1Y56A 2KZVA 3PFYA 5D9IA 2XF5A 3SDBA 3RPUD 1SFKA 2ITLA 4C2UA 3DTKA 4KISA 4D9JA 2R7XA 3W2VA 4E7HA 1DP3A 1FMVA 3HPHA 5LFAA 3DU5A 3H5NA 1VZ0A 4XOTA 1ERDA 3C2HA 3IAS2 3CZ6A 3J7AY 3EUHC 2W1OA 2GOMA 3UNGC 4E7KA 3RSNA 4ZDLA 1IRXA 4KITB 2HVSA 4XLFA 3D5LA 2VJ5A 4RMNA 3QN2A 4ZO0A 2NL8A 2Z1DA 3HL2A 4B48A 2IS6A 4DBRA 4ITVA 2V7FA 1V5FA 2X6XA 3FBIB 4BGDA 1V5EA 4II2A 4HRIA 2VPLA 4LIFA 3RCOA 2LG4A 1UG0A 4R79A 3L2RA 3K10A 2Z16A 2DXIA 3CP8A 2R7UA 2XSJC 2I8DA 4PJNA 2HVRA 1UAAA 2QKLB 3K4CA 3TMOA 2VJIA 4DIQA 2LREA 3PNTA 2E60A 1Z3XA 2KMUA 2L7KA 3H9GA 3BC8A 4ZYAA 3H0DA 2M4GA 4CCKA 3OL4A 2L2OA 2UUZA 3M8JA 1OR7C 4F91B 3KX2A 3PSIA 4NUBA 3W3CA 4AYBA 2CS3A 4E7LA 4RM3A 2K9MA 3HPGA 1R6RA 3DKXA 4E7IA 4P1WA 2CUJA 5DCXA 1NG7A 3LSGA 4BXFA 3IP4B 5KNLA 2LH9A 2X6WA 4E4HA 3H5RA 2ZSHB 3K4JA 3S32A 4II3A 2JVGA 1WJCA 4GRIA 2IS4A 5LD2C 3FKJA 2CV0A 3VYRB 3UR3C 4N4NB 2HPIA 4ZDPA 2CFOA 4CSWA 5HOOA 1RZ9A 3PJRA 4BU2A 4B47A 3OS2A 1D0XA 2VB6A 4NC8A 2K9LA 2V6EA 2F4IA 1LFPA 3BG6A 3E1SA 1S9HA 3H9JA 3OYHA 2VXZA 2VKHA 4XMYA 2RNGA 3CJRB 3ZXSA 3OYEA 2WA0A 4BQQA 1U0JA 2Q1ZB 1TZLA 4HNUA 4CH7A 4RLFA 4KT6A 1JI8A 1MMAA 4HEA2 2WAQA 3OYCA 3FDYA 1L5IA 1MNDA 5FROA 2X6YA 3H5AA 2A5WA 3D5RC 4RLQA 3OYFA 1L2MA 2R7RA 3OOUA 1E0EA 3EPZA 4Y33A 3A1YA 3CESA 2LY2A 4BE0A 1TBDA 4XONA 1BOBA 2DT7B 4PK4A 4HG2A 3OYKA 4KW3A 1KONA 1NG6A 3BG7A 3OYDA 2DCEA 2VKDA 4BQOA 4ZTFA 4ZQ9A 4IQJA 3ZR8X 4FETA 4BEHB 3LL7A 2VL8A 4XR6A 2R7TA 3OMYA 4BEHA 3SEZA 2R7OA 2IF9A 1Y6IA 1SAUA 4JOMA 2JUGA 3SEQA 4HNTA 1K6YA 3OWTA 3HOSA 2RREA 5CKTA 4F3QA 2IGKA 4J00A 2ZXHA 3ZCOA 2R7QA 5HLTA 2V26A 3QK2A 2HDWA 4J01A 2BVMA 3LMMA 2AQFA 3K4BA 1LVKA 2XF6A 2JVHA 3HG9A 4PJJA 1G59A 1BR1A 1R9WA 2IGNA 4XKWA 2CW8A 3K4NA 3VWBA 4BJTA 2LY1A 3EUKL 3F9KA 2HPMA 4KJZA 3DPLC 4XL9A 4BACA 2WAEA 1UUTA 1BR2A 1TT0A 4IQ4A 4XLHA 3G2BA 4LITA 2HVQA 4XNFA 1AA7A 3PSFA 4C30A 2DT6A 2XF7A 2CUZA 1DGRM 2VIXA 2LBFB 3K4LA 1WJBA 3L2QA 4MLOA 2E1MC 1M55A 2LBFA 3CJQB 3AFHA 3OL3A 3TL4X 4E7SA 1MNEA 2M7BA 3OYLA 3OYIA 3OYAA 4Y4RA 3AKZA 2K5CA 3OYGA 2PMZA 3M1CA 2VQGA 5HNHA 4E7ZA 3OY9A 4CUGA 2MFZA 2L9NA 4U87A 1UELB 2BW3B 2KQRA 4DGWB 1MW7A 5CQGA 3A4CA 3ONQA 4GDFA 5FRNA 2MC4A 2BW3A 1D1CA 2WY7Q 3MKYB 2TBDA 4XOPA 5FRMA 2A6TA 3KYLA 2VJJA 1X4OA 4PJLA 3ZGKA 3OR1C 3K70D 4E7JA 2X1EA 3E0JB 4XLAA 3AL0B 4N4OB 2ITJA 3C2GA 3H35A 3FHNA 3DWLE 3RTRA 4PSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U87 A;  3DKY A;  3DKX A; 
#chains in the Genus database with same CATH topology
 2WV0 A;  2WY8 Q;  4JQF A;  4ZC3 A;  2QZ8 A;  1RZ4 A;  3ZRG A;  3I4M J;  4IHV A;  1RUN A;  2PBI A;  4YFK F;  1SFO J;  1XGM A;  2K9Q A;  4D5F A;  2V6C A;  1D0Y A;  3BZK A;  1MBJ A;  4EVI A;  2M7A A;  2PEX A;  1AKH B;  1GXQ A;  3M9A A;  4OAZ A;  1MD0 A;  1SD7 A;  2RQP A;  5B66 C;  1VQO I;  1I1S A;  2YX4 A;  2IA1 A;  5C44 J;  1FSE A;  1AKH A;  4LMD A;  1BN5 A;  1IGN A;  1UJ8 A;  3IAM 2;  3ZQG A;  3QU3 A;  4F92 B;  1MNM C;  2ISY A;  2PN6 A;  3LSK A;  4XIC A;  5EZH A;  4BYY A;  1BJA A;  3CP2 A;  1YW7 A;  3K70 C;  1MBK A;  1ETX A;  3S3N A;  4HYE A;  3BTL A;  4XN0 A;  3BR0 A;  5HNF A;  4ZZD A;  4Y13 A;  2YX7 A;  2HOS A;  1QHH D;  1H9T A;  4CCJ A;  1OMI A;  3E5Q A;  3VYS B;  4RAF A;  3WE2 A;  3FZV A;  4LIU A;  2R7W A;  2KFD A;  2XAG A;  3FMR A;  4BDY A;  1W36 D;  1BA5 A;  5JHF A;  1MMN A;  1SAN A;  2IJL A;  3RJP A;  3A2K A;  4Y52 J;  4YRV A;  3OR2 C;  4DOZ A;  4PJM A;  2AO9 A;  2BOL A;  5E3N A;  5ILS A;  3HOX J;  2H8W A;  3I3L A;  2ETH A;  1BL0 A;  2E7X A;  3PL8 A;  4RAG A;  3F72 A;  2OCE A;  3LSM A;  2DI3 A;  4F52 A;  3WTW C;  1UHW A;  1U9N A;  4I76 A;  2L9S A;  4GCV A;  4G9Y A;  5GAE J;  2QKM B;  3GTM J;  4F93 B;  2QEX I;  2EQR A;  1W0T A;  2XB0 X;  4L9V A;  4PJ0 C;  1FC3 A;  2K3F A;  4FX4 A;  4NBQ A;  1P2F A;  1OYW A;  2E71 A;  1ONV A;  3I59 B;  4H0E A;  2F5F A;  1TQM A;  1WI9 A;  1JKO C;  1XMK A;  2HNH A;  1N75 A;  2Y48 A;  3I59 A;  3KET A;  1WJ5 A;  2IGM A;  2DFF A;  5BS6 A;  5E79 C;  3R61 A;  4K2E A;  3DLL F;  2EFQ A;  4C2T A;  3CDL A;  3G4S I;  2DOE A;  2W85 A;  2F5V A;  2Z5U A;  4HF0 A;  4RM2 A;  3IUO A;  1STZ A;  4DW6 A;  4IEJ A;  3DEE A;  4HF2 A;  4HSR A;  4PFO A;  4HW0 A;  3T8R A;  3AL0 C;  4FAS D;  2A69 F;  2NS0 A;  2ZFW A;  3DLA A;  5E1Z B;  1KYW A;  3CO6 C;  4FE4 A;  4BDZ A;  3LA3 A;  3GUD A;  2GXA A;  1J0R A;  3AG3 H;  3HOT A;  2CH0 A;  2MD5 A;  2NOG A;  4DJA A;  4BHP A;  2LSO A;  4PDK A;  3GW2 A;  5J47 A;  2CGP A;  4XSZ F;  5K7Z A;  2KIS A;  3TDZ C;  1TC3 C;  1XD7 A;  2Y0S N;  3M3Y J;  2KLO A;  4NC7 A;  3PIP F;  2LRD A;  1D1B A;  1TWG J;  2V9P A;  4A3F J;  3N97 A;  2K4J A;  4M9Z A;  1TW3 A;  2R7F A;  2DMP A;  2V9K A;  1DGW Y;  3G73 A;  2J5O A;  3S1M J;  1GHC A;  3ZQF A;  3U21 A;  3KEY A;  1X1C A;  4CZC A;  2E1M B;  4QTR A;  1J09 A;  1HOM A;  2XAU A;  3REO A;  1FMW A;  3E97 A;  3QYF A;  4JK1 X;  3DU6 A;  3C2B A;  3KP5 A;  1Y0U A;  2HZD A;  3M1E A;  5DM7 F;  2EPF A;  2B0L A;  4NC6 A;  4CIC A;  1ODD A;  1IV6 A;  3QYB A;  3HOY J;  2LTP A;  2EB7 A;  3I9V 2;  1U8B A;  3V7R A;  3ERE D;  1VQL I;  5F04 A;  3FXR A;  3GTQ J;  1JHH A;  1MBF A;  2K02 A;  3S93 A;  1T56 A;  2L5Q A;  1HQC A;  1Z7L A;  3BZC A;  1N78 A;  2IAI A;  1RES A;  2XDV A;  3C1D A;  4ZJZ A;  3PUB A;  2CW7 A;  2JA6 J;  4MQV A;  2G0E A;  4U7B A;  1O4X A;  3DTE A;  5C3E J;  1GV2 A;  1IJW C;  1X2N A;  1GDT A;  1HW2 A;  2JSP A;  4IOA F;  2IBD A;  5CYN A;  4Y17 A;  4AD9 A;  3SQN A;  3HC7 A;  3HGY A;  1ZAO A;  2W7N A;  4HOB A;  4U0W A;  1TLH B;  3W2A A;  5CVV A;  3BG9 A;  2W82 A;  2RC4 A;  3BCB A;  4KMU X;  3HRU A;  3S1R J;  2P5K A;  3BT9 A;  4OMY A;  1L3L A;  1IW7 F;  3A02 A;  5H6R A;  5KHD A;  3KE2 A;  5M5Y J;  2HFH A;  1HF0 A;  3JSP A;  5J4V A;  3CF2 A;  1E3H A;  1VQ8 I;  5GAG J;  3SZG A;  1A5J A;  2LFB A;  2QEN A;  3VSK A;  3EYI A;  1HDP A;  2TRT A;  2ZCW A;  2DAO A;  2YSR A;  3S3O A;  2DQR A;  4HDU A;  2KRH A;  2WV1 A;  1B9N A;  2KZV A;  2XF5 A;  2HWV A;  5H6Q A;  3WTS C;  2ISZ A;  2ITL A;  3TED A;  4C2U A;  4A5M A;  2KKO A;  2ZXW H;  2VBY A;  2E2J J;  3HPH A;  4A3D J;  4X6A J;  1RIO H;  1R22 A;  3ECH A;  1JGS A;  1S7O A;  1I3Q J;  2CFX A;  2DQL A;  1R5G A;  4FHT A;  4FE7 A;  5M3M J;  2TCT A;  4CDG A;  4QWQ A;  1YRN B;  2DA7 A;  3E5X A;  1ZAR A;  3RSN A;  3HOU J;  1FYM A;  1YRN A;  4I0B A;  3FXM A;  3D5L A;  2VJ5 A;  4RMN A;  2JA5 J;  1ZN2 A;  3CJT B;  3EYY A;  4B48 A;  3HL2 A;  2NVY J;  2NAZ A;  4LLN A;  4JYK A;  3GEZ A;  2A6E F;  2FBH A;  2X6X A;  3ZN0 A;  4KMF A;  3P9C A;  5LGN A;  4LIF A;  2HZT A;  2JRM A;  1R7J A;  5F27 A;  2VBW A;  2KJB A;  2CQK A;  5J4Y A;  3RTR A;  2HQ5 A;  2DXI A;  1BBY A;  1WRJ A;  4ABZ A;  2I8D A;  4XBF A;  3FXU A;  2QKL B;  3K4C A;  3BG5 A;  3NAR A;  4I0A A;  2LRE A;  5EF6 A;  3GFM A;  3H92 A;  3A0B C;  1ZRE A;  3H9G A;  2L7K A;  1IXR C;  4ESF A;  2DDB A;  3HZJ A;  4ZYA A;  4I02 A;  3AG1 H;  3MQ0 A;  4KIF A;  4YFN F;  4MEY F;  3LAJ A;  1QPI A;  3F22 A;  3F21 A;  2NYX A;  1ZG1 A;  2VE8 A;  4F91 B;  3PSI A;  3W3C A;  2H27 A;  3IWF A;  4E7L A;  1V55 H;  3L09 A;  5DCM B;  2IRF G;  4E7I A;  4WWC A;  2CUJ A;  2VC1 A;  3K2A A;  4B1R A;  3IWZ A;  3QPT A;  3LSG A;  2DO7 A;  5DCM A;  2HDD A;  5HLH A;  1XSD A;  2QSF X;  2X6W A;  3RKW A;  2ZSH B;  3K4J A;  2E36 A;  2FBI A;  5J3L A;  3LQR A;  3J7Z I;  5HDK A;  1A04 A;  3HHH A;  1P4A A;  2IS4 A;  5J1R A;  3JTH A;  5FLX K;  4IJA A;  1KZH A;  1JUS A;  3E6M A;  5IYD J;  5GAH J;  2HPI A;  5HOO A;  1W0U A;  1RZ9 A;  5KVR A;  3LQQ A;  2E2I J;  5CYV A;  5FKM A;  3T1B A;  2YU9 J;  1Z9C A;  5IP9 J;  1IRF A;  5BMZ A;  1XDU A;  1ZG3 A;  2NVQ J;  3HSE A;  1DPU A;  3FXL A;  2EIM H;  3BP8 A;  3GX4 X;  1I50 J;  1S9H A;  1BIB A;  3H9J A;  5B1A H;  1VQ5 I;  2VXZ A;  4HX7 A;  4XMY A;  4EGY A;  3BQZ A;  1NHA A;  3ABM H;  4NHJ A;  4OIO F;  3WGG A;  3H3V K;  2ZC2 A;  3FDY A;  2X6Y A;  2FNA A;  2A5W A;  3A03 A;  3WE3 A;  2IEK A;  2Y31 A;  4Y33 A;  3A1Y A;  1AU7 A;  4BE0 A;  1YHQ I;  1BOB A;  1YIJ I;  2DA6 A;  5DEQ A;  4HG2 A;  3OYK A;  5CVI A;  4A3E J;  5LEJ A;  1VQ4 I;  4EJV A;  4AIH A;  2FE3 A;  4LGW A;  3Q5F A;  1ZYR F;  3GTJ J;  2ADU A;  2GIV A;  3LL7 A;  3LOC A;  1FYL A;  5IP7 J;  1NTC A;  2IF9 A;  2HR3 A;  3O6B B;  3SEQ A;  5B1B H;  3OWT A;  3GWZ A;  3V8J A;  5C4J J;  4A3J J;  5HLT A;  1CGP A;  1D8J A;  4S04 A;  4J01 A;  2BVM A;  2P5L C;  5E3O A;  1MGT A;  4IF4 A;  3WGH A;  4PJJ A;  1BR1 A;  1H8A C;  3TO9 A;  2L4M A;  1K4S A;  4XKW A;  4LK0 F;  1IN5 A;  3FX3 A;  3S2H J;  4IPA A;  3EUK L;  3F9K A;  1ZR4 A;  1KQ8 A;  2JSC A;  4XL9 A;  2WAE A;  2JRT A;  4A3G J;  3DF8 A;  2COM A;  2R7Z J;  3G1L A;  2ACJ A;  5TIS C;  4ON0 A;  1Z05 A;  4IQ4 A;  4XLH A;  1T0F A;  2HVQ A;  4XNF A;  3ZQL A;  4ZYH A;  1AA7 A;  3E7L A;  1S6L A;  2JT1 A;  5JI6 A;  1ZG5 A;  1R58 A;  3B73 A;  9ANT A;  4DYQ A;  1EF4 A;  2AXT C;  3K4L A;  3DEU A;  4I99 C;  4M6Y A;  2K7L A;  2M1B A;  2XAQ A;  3OYL A;  2M7B A;  4WF2 A;  3OYA A;  4Y4R A;  3W6K B;  4M3G A;  4S05 A;  5LHG A;  1FJL A;  1QBJ A;  4JP0 A;  3IHU A;  1QPM A;  3QWL A;  4IHT A;  1K7A A;  1D1C A;  3LST A;  3MKY B;  5M3F J;  1JKP C;  3J7A O;  5FGM A;  4WXC A;  5K7H A;  4ENK A;  2BHZ A;  3ZGK A;  5GPC A;  2HOE A;  3KP2 A;  3K70 D;  2GQQ A;  2QBY B;  2X1E A;  3P5J A;  2EIK H;  3E0J B;  4RS8 A;  5M5W J;  2OU2 A;  2ITJ A;  3C2G A;  5EYR A;  4PSW A;  2QBY A;  1OYY A;  1OJL A;  3CC4 I;  5K7F A;  2VXD A;  1XB4 A;  2XSD C;  2QSG X;  2K9S A;  4MNU A;  2WBM A;  4MFE A;  4A93 J;  2MA3 A;  2YPR A;  4C3I J;  1MJB A;  2F6C A;  3WOD F;  4UVA A;  2Z33 A;  1VQP I;  2EFN A;  4XRS G;  3RPU A;  3QPH A;  2LKX A;  3GCM A;  4CCO A;  3OS1 A;  4MO7 A;  4TV7 A;  2UV1 A;  2Y2Z A;  3QFQ A;  5BQT A;  3F8M A;  1LUJ B;  4U7D A;  3S16 J;  2V1X A;  4U0Y A;  2OQR A;  2QQ8 A;  2P5V A;  2PQ8 A;  2HQN A;  2AQE A;  3OYJ A;  3HOV J;  2B9S A;  1PP7 U;  1JXS A;  1ETO A;  1WJD A;  2ECB A;  2VLA A;  1R71 A;  1SFX A;  4BXX J;  1I27 A;  2G7U A;  1O3R A;  1E17 A;  1IN6 A;  1OCO H;  1XX5 A;  1OR7 A;  2BYV E;  3M7G A;  4EGZ A;  5DUI A;  4I2O A;  4GFB A;  4JBA A;  2HW0 A;  4BS9 A;  3AAF A;  1J75 A;  3CF5 F;  2NRA C;  3DKY A;  1V5G A;  1TP4 A;  3VOE A;  4IZZ A;  1R5H A;  3CCV I;  3CLQ A;  3PIO F;  4A0Y A;  1A31 A;  1PJR A;  1Q1V A;  2D2W A;  1WVR A;  5ICF A;  2BEO A;  1MBE A;  2H6C A;  1USS A;  4J19 A;  1VF9 A;  3NAU A;  2R7V A;  4G7H F;  5HS9 A;  2ZNZ A;  4YEL A;  4R1H A;  3VYT B;  2QQA A;  2FUG 2;  3WU1 B;  4M74 A;  4HAM A;  3LSP A;  3HRM A;  4AIJ A;  2GIZ A;  4HQM A;  5FKO A;  2PJR B;  4G94 A;  1Z21 A;  1T0F C;  5LHI A;  3JRE A;  3D5S C;  2WB1 N;  3J7Y J;  1BIA A;  4D0P A;  2PJR A;  2W4S A;  3OIQ A;  1F36 A;  2ZSI B;  2QLZ A;  3QOD A;  3QOE A;  2ZJP F;  5LGU A;  1IC8 A;  1FIP A;  5KAI C;  4ZDO A;  2L7M P;  1R9T J;  1ENH A;  1EJ9 A;  1N25 A;  3EUA A;  4P96 A;  2DOA A;  1DDN A;  1T98 A;  3CME I;  4MIM A;  4FCY A;  1KQ9 A;  2H1K A;  3W6V A;  3D1N I;  1VFC A;  3HKZ N;  3HBL A;  2CWE A;  5HS8 A;  5HVQ C;  2EFP A;  2DK8 A;  1XGO A;  4RB0 A;  2P0W A;  3ZQQ A;  1YS6 A;  4GGG A;  2F4O B;  4A12 A;  5ERI A;  4U88 A;  5KCM A;  2XPV A;  3QPL A;  1RC9 A;  1MH3 A;  2LK2 A;  4BE1 A;  1PP8 F;  2A61 A;  4C3J J;  2A07 F;  2K40 A;  4EEF G;  1D8K A;  1U6G A;  1GV5 A;  4CGZ A;  4KNY A;  4PUS A;  2XC7 A;  1YX3 A;  3JAM K;  2ZJQ F;  2MGQ A;  2BXZ A;  1WGX A;  1XCB A;  3O8H A;  2VUM J;  4A3I J;  3GZ5 A;  2OPT A;  2I10 A;  3KEQ A;  3G71 I;  4FB3 A;  3NRV A;  5LGT A;  5J1U A;  1OCZ H;  1APL C;  5DM6 F;  2L4A A;  3PNY A;  1JKQ C;  1O3S A;  5TGT A;  1MJ9 A;  2A6H F;  2VC0 A;  3VYU B;  2ZFU A;  3CJN A;  3SYT A;  1K83 J;  4YEJ A;  2IA0 A;  2VI6 A;  5E1W A;  2M45 A;  1OCP A;  1Y1V J;  3K0L A;  1KSY A;  2EIN H;  3CCJ I;  1VQK I;  4CZZ A;  3GFJ A;  3SFZ A;  4UUT A;  1VND A;  2EJR A;  4KN4 X;  1V4R A;  3RQ4 A;  4BJ6 C;  3H36 A;  3L2W A;  4BL0 B;  3MKW B;  2NXN B;  4EMS A;  3KCC A;  3FXQ A;  3F3X A;  3WGI A;  3RPQ A;  1YIO A;  2BY1 A;  1WHU A;  3GXO A;  1IF1 A;  3ZP5 A;  4A6E A;  4IKF A;  4DBQ A;  2OC6 A;  2QA4 I;  2OA4 A;  1WJA A;  4M3B A;  5EG0 B;  3LFU A;  1CQT A;  1S5L C;  1ETW A;  1EH7 A;  2Z99 A;  4PCQ A;  5EG0 A;  2DJI A;  1LQ1 A;  2ELK A;  3DBH B;  3QQA A;  5L3G A;  1T6S A;  2VOP A;  2AXL A;  1LDK B;  5IOZ A;  3BLY A;  1MIJ A;  2E5N A;  4CA0 A;  2H6B A;  1VQM I;  2P4W A;  3CUQ C;  2ZKZ A;  1BC7 C;  1Y0N A;  4P5O A;  1UHS A;  1WFX A;  1ETY A;  1F43 A;  3HOW J;  4OAY A;  1X1D A;  2Y30 A;  2GAU A;  3K1M A;  4XLC A;  3K4K A;  4L9J A;  5HDN A;  3KLN A;  3PQK A;  2FX0 A;  4OWR B;  3TW6 A;  2BZT A;  2MYS A;  3GFI A;  3L2U A;  1D0Z A;  3F6V A;  2KDZ A;  3Q9S A;  4I6Z A;  1ZTR A;  2R5Z B;  4BJ5 C;  2DOD A;  3LSH A;  3RKY A;  3NWS A;  2A3S A;  1FPQ A;  2HXO A;  1IN4 A;  2VE9 A;  5FLV A;  4M6X A;  2UZK A;  2R5Z A;  2EZH A;  5AON A;  1U9O A;  3E5U A;  1IDZ A;  4WXH A;  2GOX B;  3U2R A;  1MJA A;  2E1N A;  4BQN A;  5CPR B;  1Z0X A;  3JRH A;  2CQQ A;  4XOR A;  3WTX C;  5F0H A;  1F9N A;  2RDP A;  2Y69 H;  1PUE E;  2XGC A;  1Y56 A;  4BHB A;  1IN8 A;  1DPR A;  1FOK A;  4LMY A;  1SFK A;  3I56 I;  3SJM A;  2HKX A;  2QYO A;  3ABT A;  4KIS A;  2HGC A;  5DTD A;  1BJZ A;  2R7X A;  5F1J A;  1FMV A;  2M9H A;  1E2X A;  3KP3 A;  2RVC A;  5IT9 Z;  5LFA A;  2XPU A;  3H5N A;  1Q1H A;  3CQZ J;  2EK5 A;  3V8L A;  3PQJ A;  1K78 B;  3H0G J;  6PAX A;  1A6Q A;  3FHZ A;  2E1C A;  1K78 A;  5DYM A;  2BHY A;  4IRG A;  4ZDL A;  1IRX A;  2ZNY A;  1K4T A;  2X48 A;  1I1G A;  2DFH A;  4A3B J;  2W57 A;  2Z1D A;  2IS6 A;  2DLL A;  1S29 A;  3HSR A;  4FX0 A;  3ERM A;  3K2Z A;  2RAE A;  3ROU A;  3BRO A;  3DCF A;  3I5U A;  3KPH A;  3TOA A;  3L2R A;  4GYG A;  4RGU A;  5ILV A;  3I64 A;  2LR8 A;  2R7U A;  2MH2 A;  3CCR I;  4YFX F;  1FIA A;  2NNY A;  2R5Y B;  3CD6 I;  4BY7 J;  1CF7 B;  3G6E I;  3PNT A;  4EV0 A;  1Z3X A;  2KMU A;  1BI1 A;  4UUS B;  2R5Y A;  1CF7 A;  3H0D A;  5K5R A;  1ON2 A;  2VT2 A;  4CCK A;  4UUS A;  1GXP A;  3M8J A;  5E8G A;  2R93 J;  1DU6 A;  3RZD J;  1K79 A;  1YIT I;  1O3T A;  4HX8 A;  4NUB A;  1YOV B;  2CS3 A;  3HEF A;  3HPG A;  4CYD A;  3DKX A;  3MKL A;  3JRB A;  1NG7 A;  3ML6 A;  3M8E A;  3CCL I;  1PVE A;  2L0K A;  1RR8 C;  2KT0 A;  5FKK A;  3BQY A;  1OQY A;  2ZO4 A;  2M34 A;  4RGX A;  1G2H A;  1WJC A;  2CU7 A;  2WAQ N;  3KP7 A;  2GA1 A;  5D5W B;  1U8R A;  1ZK8 A;  5L3F A;  2CQN A;  3J80 K;  4BU2 A;  4M72 A;  2XUB A;  3RYP A;  1UCR A;  4XK4 A;  4HNV A;  2V6E A;  2C6Y A;  2EA2 A;  3KZZ A;  1LFP A;  1ZLK A;  3BG6 A;  1NK2 P;  1R4N B;  4OIN F;  4S0H B;  4HLY A;  2QWW A;  2P7V B;  1SVM A;  2VKH A;  2RNG A;  3ZXS A;  2WA0 A;  4G6Q A;  3AG4 H;  2OTL I;  3BTJ A;  1P6R A;  1U0J A;  2Q1Z B;  1XCV A;  4HNU A;  4ENM A;  2UXN A;  1F5T A;  4CH7 A;  4KT6 A;  1JI8 A;  4PGH A;  3SZT A;  3CDH A;  3TO6 A;  1L5I A;  2E7W A;  1E0E A;  4ZYE A;  3P7N A;  1XSV A;  4P9F A;  3GO5 A;  3CES A;  1G3T A;  2XRO A;  2I5U A;  3ELK A;  4UB6 C;  2DT7 B;  2EZI A;  4IRH A;  2O8K A;  4O5V A;  4BKX A;  1NG6 A;  2HOA A;  4BQO A;  4HV5 A;  3F8B A;  3DP7 A;  1DU0 A;  1SMY F;  2DJN A;  4FET A;  1BM9 A;  4BEH B;  1YQA A;  2HTS A;  2IA2 A;  3KYC B;  5A2Q K;  3WHB A;  4UY8 I;  4IOC F;  3OMY A;  5FKL A;  4BEH A;  5M5X J;  1H89 C;  5CVJ A;  5JR3 A;  5L3E A;  1SAU A;  4M9X A;  2JUG A;  5GAD J;  2V1U A;  4HNT A;  1K6Y A;  3JRI A;  2RRE A;  4F3Q A;  4YII A;  3IKT A;  3BZ6 A;  2L3D A;  3Q0W A;  2R7Q A;  2V26 A;  4HF1 A;  5FFX A;  2AQF A;  3K4B A;  2D5V A;  1LVK A;  4UVC A;  2COB A;  2JVH A;  1LE8 B;  1OKR A;  2OF7 A;  2NNN A;  2IGN A;  2CW8 A;  2LY1 A;  2HPM A;  3HB9 A;  5D4R A;  3S1Q J;  4KJZ A;  1LE8 A;  3DPL C;  3IKV A;  4ZH4 F;  1ITY A;  2STT A;  5DS9 A;  2Y0M A;  4KYW A;  2DFI A;  1QQI A;  1TT0 A;  1ACI A;  1BW6 A;  1B59 A;  3DBR B;  5FB2 A;  2GZW A;  3J81 K;  2DT6 A;  5E17 F;  4L5E A;  2F5D A;  5IP6 A;  2GBY A;  2OQG A;  4AYB N;  2OCC H;  2P7C B;  5L3C A;  3E6C C;  3HDD A;  1WKM A;  3L2Q A;  2E1M C;  1IDY A;  3VFZ A;  1WH5 A;  3AFH A;  4E7S A;  1D5Y A;  1R5I D;  1KGS A;  1UB9 A;  1ZGA A;  4Z6Y A;  3JTG A;  2CO5 A;  3AKZ A;  3OYG A;  3JRG A;  1HXD A;  5HNH A;  1SC7 A;  2L9N A;  3GZN B;  4DGW B;  5ICE A;  2JA8 J;  2P81 A;  2MC4 A;  1SD6 A;  2WY7 Q;  1B9M A;  2BBY A;  4XOP A;  2A6T A;  3KYL A;  3S2D J;  2QQB A;  2VJJ A;  1TNS A;  3FK6 A;  1J5Y A;  2MLK A;  4B4C A;  5D5U B;  2E35 A;  3F8N A;  4FT8 A;  2DBB A;  2BE5 F;  4N4O B;  3H35 A;  3FHN A;  3DWL E;  3MCZ A;  3W6J B;  2QM3 A;  3PO3 J;  4H4K C;  3JW4 A;  4ZTJ A;  3I4N J;  1IXS B;  4LB5 A;  3OSG A;  4ANJ A;  4QPO A;  3CC7 I;  2RQQ A;  1OCR H;  2BY2 A;  2XB5 A;  1H9G A;  1RR7 A;  4M3E A;  4O3M A;  4NB5 A;  4Q5S F;  2X85 A;  3F6O A;  1T2K A;  4CHU A;  1UFM A;  2FMY A;  2FQ4 A;  4IVN A;  1P7J A;  4NNJ A;  1HA8 A;  1QHG A;  2DOF A;  1QZY A;  2X1C A;  2VQC A;  5F64 A;  2KIM A;  4G6T B;  4RGR A;  5DD4 A;  1P9Q C;  4UB8 C;  2QUF A;  4B8X A;  2ZBK A;  2VPR A;  4W97 A;  1L0O C;  1S7E A;  1XDS A;  4DNC A;  3QRF F;  1HLV A;  1I6X A;  1OIS A;  2V9V A;  4LG3 A;  3RQI A;  2JA7 J;  3V7C A;  2K4B A;  1Z77 A;  2XIG A;  4E6K G;  3K9T A;  3DQV C;  1Z3Y A;  5F08 A;  4G12 A;  1RUO A;  3K1P A;  3RIR A;  5F1R A;  3QP6 A;  1TBX A;  2W00 A;  3I58 A;  4DZP A;  2KRC A;  5HLI A;  3ZMV A;  2M0M A;  1XGS A;  1BI3 A;  2XGX A;  5EDN A;  2EV0 A;  3OYN A;  3MKZ A;  3MMY B;  3JCU C;  4Y3O A;  3PO2 J;  1S72 I;  4OOI A;  1TWA J;  3LA2 A;  1GUU A;  5HLG A;  5DV5 A;  2DW4 A;  3BCA A;  3HRS A;  4UXN A;  4L18 B;  4XLP F;  4XLE A;  2HYF A;  3DV8 A;  4QLC U;  1P92 A;  2H8R A;  2VQL A;  4BQA A;  1PUF B;  3BDD A;  5D4S A;  3H9Q A;  4MTE A;  5JLX A;  2Y75 A;  3IH3 A;  1R49 A;  3DPU A;  1X19 A;  1PUF A;  1LDD A;  1FBQ A;  1G3W A;  4OIP F;  3TQN A;  3S8P A;  4MEX F;  3ESW B;  3OYM A;  3KFW X;  1WZ2 A;  2A68 F;  2FF4 A;  1W5S A;  2L7Z A;  5K1Y A;  2M30 A;  3B6C A;  2A5Y B;  3JRA A;  5CLS A;  3S3M A;  2FSW A;  4B09 A;  4IHS A;  4O6J A;  2VQH A;  4A5N A;  3WG9 A;  2L9V A;  2KPM A;  4V2G A;  3OS0 A;  2IS2 A;  3BOQ A;  4A6D A;  3RKX A;  1MH4 A;  4JX4 A;  1BW5 A;  4XQF A;  4CXF A;  2YR2 A;  3NEU A;  2HQA A;  2E34 A;  2LF8 A;  4FGN A;  4BXU A;  3Q3S A;  3KP6 A;  1FP1 D;  2MAB A;  4EJT A;  2X6O A;  5IY5 H;  3G1M A;  5J6X A;  1JHF A;  3I54 A;  3TBI A;  4IX7 A;  2XKO A;  2O61 A;  2OV7 A;  2KIF A;  2VJ4 A;  4Q47 A;  4EM1 A;  4B3X A;  4D7N A;  5D5V B;  2F5E A;  2X4H A;  4WX9 A;  1HKQ A;  2MD0 A;  3F0C A;  1QNT A;  3ABL H;  1UG2 A;  3ASO H;  3KIO A;  4C9Y A;  5EGO B;  1YW8 A;  1DQU A;  2H09 A;  2VOO A;  3VOD A;  5EGO A;  2ME0 A;  4AIK A;  1WPK A;  3N05 A;  2LD5 A;  3CTA A;  4L9T A;  3ZMZ A;  4QIW N;  4NBP A;  5DD8 A;  3WG7 H;  1ZGW A;  3Q0V A;  2WC2 A;  4BNC A;  1GLN A;  3IL2 A;  1W7P D;  2XHK A;  4LIV A;  1SFE A;  1TQI A;  5DDG A;  5TRD A;  1YW9 A;  1Z67 A;  1HC8 A;  3X2Q H;  3GVA A;  4CCN A;  1UZC A;  2QF7 A;  3SFI A;  4MTD A;  1HSJ A;  3CDI A;  1QRY A;  2VT3 A;  2FOW A;  3ZMT A;  4D1Q A;  4UVB A;  3WU2 C;  2KL4 A;  2DPU A;  2VON A;  2ELJ A;  2RKH A;  5K5Q A;  1WSU A;  2Q8K A;  5KAF C;  3WTY C;  2K9N A;  4EM0 B;  2M2E A;  1Y39 A;  1FZP B;  2AHQ A;  2FEZ A;  3BTC A;  4HST A;  1Z7U A;  1FTT A;  1KU2 A;  2Y0S A;  2JPC A;  2R7S A;  2R3S A;  3FXK A;  1KSX A;  3KZI C;  1VQN I;  4AC0 A;  4RBO A;  2LOO A;  4YIF A;  3SHF A;  3NWT A;  5JVT A;  1G8X A;  1E3P A;  3KYD B;  3HRT A;  4RDU A;  4XKB A;  1RPW A;  4I98 B;  4NQW B;  5JLW A;  4Y15 A;  4N9H A;  4YG2 F;  5BYG A;  3R4K A;  1K6O A;  1MMD A;  4NQW A;  3DXJ F;  3M07 A;  1XS9 A;  3ZQI A;  1PYV A;  1ULY A;  4GO1 A;  4ENJ A;  1E3O C;  2FNP A;  4XKV A;  2EWN A;  5FLX Z;  1R1U A;  1HDD C;  4KDP A;  1MMG A;  3E6D A;  1LVA A;  4F7Z A;  4XRM A;  2L02 A;  3MWM A;  4PFP A;  2X1D A;  5IYB J;  2W48 A;  1LFB A;  1HW1 A;  4LK1 F;  2GWR A;  1V3F A;  2EH3 A;  2IP2 A;  2YS9 A;  2GXG A;  1UMQ A;  2Z2S B;  2OUM A;  5FO5 A;  1VTN C;  1FOY A;  2RN7 A;  5HDG A;  1YX5 A;  4G8X A;  5IYC J;  3A0H C;  4OIR F;  3CCM I;  4ZZL A;  1F08 A;  4CCL A;  1IO2 A;  1ETV A;  4P9U A;  4ESJ A;  1GVJ A;  3G3Z A;  1YJN I;  1JJ6 C;  3BR1 A;  3V7S A;  3K7A J;  5L3D A;  4RAZ A;  3Q9V A;  3GYH X;  3CCS I;  1C0W A;  5E3L A;  2R7D A;  3DEW A;  3IV5 A;  2BXY A;  4XSX F;  2L01 A;  3HUG B;  1IN7 A;  2DN0 A;  3KZY A;  3SDB A;  3K1N A;  3WTZ A;  1PDN C;  3HUG A;  3DTK A;  5LLQ A;  3GTL J;  1FBS A;  2PX9 A;  3W2V A;  1DP3 A;  3ZMU A;  1KYZ A;  3PM1 A;  3FM5 A;  3WTV C;  1Z6T A;  1LEA A;  1TWH J;  3DU5 A;  2YU3 A;  2XVC A;  3E6B A;  3ZOB A;  3E3V A;  5LBQ A;  2BY0 A;  1MSE C;  1R23 A;  3QP5 A;  3J7A Y;  2GOM A;  3IH4 A;  5GTI C;  2DU9 A;  2X0L A;  4KIT B;  4XLF A;  1JJ8 C;  4L5I A;  5D5X B;  3QN2 A;  1SVL A;  2E19 A;  4HX4 A;  5LHH A;  1IAW A;  2RNJ A;  3G1O A;  1RKT A;  4HDV A;  2V7F A;  4HBL A;  2M8G X;  1V5F A;  4BGD A;  1WI3 A;  4LFU A;  4II2 A;  1MBG A;  3RCO A;  4HA8 A;  4DYC A;  1UG0 A;  2BGC A;  2HXI A;  1SMT A;  2HOT A;  2XSJ C;  3ABK H;  4PJN A;  1VI0 A;  2DMQ A;  4I01 A;  2EFW A;  1B72 B;  2ELH A;  2VJI A;  1MMS A;  1EH6 A;  4DIQ A;  2XRL A;  5E8I A;  1JTY A;  2E60 A;  2PG4 A;  1B72 A;  4HV6 A;  3BJA A;  4I09 A;  2M4G A;  3TP3 A;  4LLG F;  4AUX A;  1I3A A;  2XPW A;  3MZH A;  1OR7 C;  3TO7 A;  3KX2 A;  2DFE A;  2PI0 A;  4AYB A;  1ZQ3 P;  1R6R A;  4P1W A;  5IT3 A;  3BPV A;  1BOA A;  1HW5 A;  3IH2 A;  5KNL A;  4E4H A;  1BI2 A;  1X58 A;  1A6I A;  3NQO A;  3O3K A;  3H5R A;  1O3Q A;  2MH9 A;  3CUO A;  4A2U A;  5B3S H;  1ETK A;  4II3 A;  2LKS A;  2ME6 A;  3OOP A;  3HTS B;  4CO8 A;  4GRI A;  1ZHF A;  3FKJ A;  4M3F A;  3VYR B;  4BAY A;  5KK1 A;  4N4N B;  2F5C A;  4L5J A;  3PJR A;  3F8C A;  1D0X A;  3M4O J;  2PFB A;  3I4P A;  1F1Z A;  1HKS A;  2K9L A;  1M1E B;  4NC8 A;  2F4I A;  4EJO A;  3BTI A;  2VKV A;  3C3W A;  3C7J A;  4L0Y B;  2STW A;  2CSO A;  4IHW A;  3OYH A;  1T8I A;  4C2M J;  4CYC B;  5BPD A;  1YG2 A;  3CJR B;  3OYE A;  1T08 B;  4AWX B;  1Z91 A;  1TZL A;  2Z3Y A;  1IXC A;  1JT6 A;  4CYC A;  1R1T A;  4RLF A;  5JVG F;  4QSH A;  2DMN A;  2W25 A;  2XAS A;  3FK7 A;  1OFC X;  5HOD A;  3BR2 A;  2FQ3 A;  5FRO A;  2D45 A;  2KIQ A;  3H5A A;  1ZH5 A;  3D5R C;  3ISP A;  1FBU A;  3Q0U A;  5L3B A;  1L2M A;  3RDI A;  4AID A;  3OOU A;  3EPZ A;  5B5E C;  2XV4 S;  1EH8 A;  2LY2 A;  2OBP A;  1TBD A;  3FIW A;  5FFZ A;  1FOX A;  3LFK A;  4MGR A;  4MQ9 F;  4KW3 A;  2BV6 A;  3OYD A;  4IXA A;  1IUF A;  4HQE A;  2VKD A;  3T0Y A;  3TW7 A;  2CW0 F;  4UHT A;  3SDG A;  4ZYD A;  3GTP J;  3GF2 A;  3FMS A;  4UV8 A;  2R7T A;  4XR6 A;  1XC5 A;  4LG0 B;  1GVD A;  2DA3 A;  2XGD A;  3SXY A;  1LJ9 A;  4UUV A;  1O7F A;  4Q48 A;  2R7O A;  2NVX J;  1Y6I A;  4JOM A;  4LG0 A;  2GA2 A;  2XAF A;  3OIO A;  3D0S A;  1FYK A;  4D7M A;  1Y8R B;  1B4A A;  1JGG A;  4J00 A;  2F2E A;  2ESH A;  4KUM A;  2IVM A;  2M87 A;  3BR6 A;  3ZCO A;  2EV5 A;  2HDW A;  3T5X A;  3LMM A;  1JKR C;  2J5P A;  4FIS A;  2LNB A;  1G59 A;  1LPQ A;  3ABU A;  2PMH A;  1R9W A;  3K4N A;  3VWB A;  1LNW A;  1QZE A;  2CQ7 A;  2CJJ A;  4X1E A;  3R0A A;  2JMW A;  2RGV A;  4A3C J;  1UUT A;  2IPQ X;  2NS8 A;  5ICG A;  4A3M J;  2MSY A;  4AM3 A;  2JWT A;  4LIT A;  2CG4 A;  4EM2 A;  5D6E A;  1ETQ A;  4RAY A;  4C30 A;  2XF7 A;  4LJZ F;  1UST A;  1TW2 A;  1J2X A;  2H94 A;  2HQR A;  2LBF B;  2VBZ A;  4Z2Y A;  1FNN A;  3GTO J;  2ZJ2 A;  2ICW G;  2LBF A;  2WTE A;  1EKE A;  1QVT A;  2DMU A;  1XMX A;  1X2M A;  2PJP A;  3TL4 X;  2P6S A;  1IZ1 A;  3OYI A;  5DUK A;  3H3U A;  1WCM J;  3M1C A;  1XGN A;  2VQG A;  3ZQ7 A;  1B6A A;  2KQR A;  5CQG A;  2MW8 A;  1IV8 A;  3A4C A;  3TOB A;  1T39 A;  3R0J A;  1O7L A;  2X9D A;  1EV7 A;  2DPD A;  4PZJ A;  2TBD A;  5FRM A;  3IRR A;  3COA C;  3BR5 A;  3DKW A;  1FT9 A;  3WHC A;  1X4O A;  1A36 A;  3WTT C;  1JUP A;  4A0Z A;  3OR1 C;  1W5C C;  2XGE A;  2Y9Y A;  2OD5 A;  4XLA A;  2QVO A;  4LLL A;  2O3F A;  2NTC A;  1Z6R A;  4GXO A;  3JAM Z;  4Y7N J;  4BE2 A;  1T38 A;  4EQQ A;  1REP C;  4M73 A;  2WAD A;  4XID A;  1GT0 C;  3B02 A;  2NVT J;  2CMP A;  1T33 A;  4XN3 A;  3W2W A;  1FTZ A;  3VB2 A;  3UKG A;  2HTJ A;  1TWC J;  3OIP A;  4XRS A;  1ZGJ A;  4M9S A;  2DA2 A;  1WJE A;  3I0T A;  1POG A;  3BY6 A;  1VQ6 I;  3K4M A;  2K3P A;  4QPQ A;  1HCR A;  4LOC A;  1RNL A;  4G7O F;  2KP6 A;  5E3M A;  4BBR J;  1YE9 A;  3BJ6 A;  4MHG A;  1OLT A;  2LMD A;  2V4J C;  4RB1 A;  2JZY A;  2OAZ A;  4G7Z F;  2MLG A;  1N77 A;  2EV6 A;  5D8K B;  4KIB A;  3HSF A;  5H2F C;  2IW5 A;  1BR4 A;  3GBG A;  3OYB A;  3L7W A;  1UHM A;  2XAH A;  4DQ2 A;  3VSL A;  3JRF A;  4LD5 A;  1LEB A;  4RB2 C;  2V1N A;  3FXJ A;  2X51 A;  3IC7 A;  3CCQ I;  2LYC A;  2QSH X;  3HGG A;  2Q2E B;  1FOW A;  2L54 A;  1SEU A;  3F8F A;  3C18 A;  1QZZ A;  2DA4 A;  2Q0O A;  2Q2E A;  1KQ0 A;  5F0C A;  4BHC A;  1S8N A;  2RV8 A;  2M3A A;  1G6N A;  5F0F A;  1RRJ A;  2KHM A;  3HHG A;  1P4W A;  4M3D A;  2NVU B;  1YI2 I;  4V2F A;  2CV2 A;  2DDA A;  1X1A A;  2KRF A;  4JX6 A;  3CCY A;  2MG4 A;  3O2P E;  1YO5 C;  3S15 J;  4XRF A;  3V42 A;  4B3A A;  4OMZ A;  2KDO A;  3MEX A;  5GPA A;  2NOJ B;  4JX5 A;  3BWG A;  1O57 A;  2IT0 A;  1S7A A;  2PMZ N;  2ZB9 A;  3CMM A;  2O5R A;  4XLN F;  5E1X A;  1U78 A;  2M4K A;  1K61 A;  2FRH A;  1KA8 A;  2V1D A;  4ETS A;  1W36 C;  1RKW A;  2LC2 A;  2DMT A;  2E5Z A;  1H88 C;  1X4P A;  3OSF A;  1MKM A;  2WB1 A;  1JTX A;  1OPC A;  2EIJ H;  1ZRD A;  1G3S A;  1XMA A;  1ZRF A;  2EIL H;  3FXO A;  1FLI A;  3QOP A;  1Z1D B;  4A3K J;  4RB3 C;  1IG7 A;  4KT5 C;  1FY7 A;  2IPR A;  1Z1D A;  1Y1W J;  1RET A;  3EQL F;  3ZN1 A;  1RI7 A;  2VAS A;  2JN6 A;  2K86 A;  2EZL A;  2LP0 A;  3HKZ A;  4LB6 B;  5BPI A;  4AU7 A;  1JT0 A;  2D1V A;  3AG2 H;  2MC3 A;  3GFL A;  3WTU C;  1NH3 A;  5F6F A;  2JK3 A;  4F55 A;  1ZRC A;  2XRN A;  3QYE A;  3H3Z A;  1B8I B;  5EEG A;  2LKP A;  3CMA I;  1X1P A;  1ZEL A;  3ZQC A;  3EUH A;  4RA2 A;  1B8I A;  5ILU A;  2M8E A;  1R1V A;  3MZY A;  3ECO A;  4HPQ A;  2ID6 A;  2B7E A;  2QQ9 A;  1FP2 A;  2K85 A;  5J40 A;  1VQ9 I;  4IRI A;  2DA1 A;  2F48 A;  2ZME B;  5ICC A;  3CC2 I;  2DK5 A;  4XKC A;  1XTA A;  5IPA A;  4BUP A;  2W24 A;  2ZME A;  2IXS A;  3LWF A;  4M6V A;  5GP9 A;  3RYR A;  4CCM A;  2JUC A;  4B44 A;  1QGP A;  2LLK A;  3DPT A;  4EAT A;  3MD2 A;  1IRG A;  2CV1 A;  2WAF A;  4KA4 A;  2HYG D;  3V8K A;  2HYJ A;  4EJW A;  4L0Z B;  1D1A A;  2L7F P;  3CMY A;  2HDC A;  1X1B A;  2PLY A;  1SD5 A;  2TDX A;  2LVS A;  2JA2 A;  3M8F A;  3L1P A;  1A35 A;  1OYI A;  4EJU A;  3L00 A;  2VKE A;  3TP0 A;  4KFC A;  3DTI A;  4X0G A;  5LEK A;  1YJ9 I;  1BC8 C;  4DYR A;  4AVZ A;  4G6D A;  2L9R A;  3N4M A;  2W84 A;  1ZR2 A;  2UWM A;  2P8T A;  1LKX A;  1JUM A;  1TL8 A;  2ID3 A;  4M71 A;  2N8G A;  4XM3 A;  3L2V A;  1ON1 A;  5CJ9 A;  2CYY A;  3VDX A;  5CQE A;  3S2W A;  3GTG J;  2FUF A;  1QA6 A;  5FD5 A;  3P9K A;  4IO9 F;  5CVU A;  1FSH A;  5J8C A;  1MDM B;  4PSX A;  1XG1 A;  3RZO J;  4N9I A;  2EZK A;  1MDM A;  3JR9 A;  3GZ6 A;  1TTY A;  1NK3 P;  3J80 Z;  3HXL A;  3FBN B;  5EEH A;  4NDL A;  2IS1 A;  2FBK A;  2IGO A;  4A0X A;  1YTY A;  1FEX A;  2QCO A;  1P4X A;  4AVP A;  1WJF A;  3CLO A;  1ZKG A;  1J59 A;  3K6G A;  1MZB A;  2LY9 A;  3LSI A;  3TDU C;  2WWY A;  4U0V A;  3HYI A;  1AWC A;  3LA7 A;  4FQG A;  2R4G A;  3GLX A;  1YYV A;  5AIQ A;  1R4M B;  3GTK J;  1EA3 A;  3PNV A;  3CCE I;  4P55 A;  2BVL A;  3LSJ A;  1T95 A;  2HU9 A;  2ZXI A;  4B43 A;  1X3Z B;  1QU3 A;  1H0M A;  1I6H J;  5D9I A;  3PFY A;  2FXA A;  1OCC H;  3K69 A;  4KIC A;  3RPU D;  4ZYG A;  2FOK A;  2H1L A;  2MBF A;  5FD6 A;  1YJW I;  2GLO A;  3FKI J;  4R8H A;  4BH9 A;  4Q4Z F;  3LNQ A;  4FTH A;  2AS5 F;  4D9J A;  2O03 A;  3L9F A;  5LRR A;  1ZLJ A;  4E7H A;  4WXD A;  2JJ7 A;  3MFK A;  3GLL A;  1SFU A;  2G7H A;  2JTV A;  4L9N A;  3HTU A;  3U1K A;  1HST A;  2V79 A;  3BG3 A;  5H20 A;  1VZ0 A;  2OTJ I;  2DYS H;  1U2W A;  4XOT A;  1ERD A;  1U5T B;  3C2H A;  3IAS 2;  5HS7 A;  5EJC A;  3T8T A;  3CZ6 A;  3QU6 A;  2DT5 A;  1IRZ A;  3EUH C;  2W1O A;  5A2Q Z;  3UNG C;  3F23 A;  3S1N J;  2P6T A;  1U5T A;  4E7K A;  4I7H A;  4KIG A;  1SAX A;  2HVS A;  2DTR A;  3WU0 A;  4IHX A;  4ZO0 A;  2NL8 A;  1R36 A;  1FWZ A;  5JFR A;  2FJ1 A;  3RKQ A;  2ESN A;  4DBR A;  2ZME C;  5FKN A;  4ITV A;  2JQ7 A;  1I39 A;  2UXX A;  1D5V A;  4YIR X;  5ED4 A;  4WK8 F;  3FBI B;  4BY1 J;  1V5E A;  4HRI A;  2VPL A;  4IHY A;  1YLF A;  2OZU A;  5FLM J;  3KLO A;  2LG4 A;  4R79 A;  5D6F A;  3JRD A;  3H1C A;  3K10 A;  2Z16 A;  3BJO A;  3CP8 A;  2HVR A;  3I71 A;  1UAA A;  3IRQ A;  2OZ6 A;  3TMO A;  4N0B A;  3HJE A;  2CUF A;  2LDU A;  3R60 A;  4UV9 A;  2O8X A;  1G3Y A;  1QO0 D;  1R00 A;  4UNO A;  4WCG A;  3ZMS A;  3EET A;  4E70 A;  3BC8 A;  3BPX A;  3MVP A;  3J81 Z;  1DUX C;  1JE8 A;  4V19 K;  3MAJ A;  3OL4 A;  2L2O A;  2UUZ A;  4RGS A;  1YFH A;  3FMQ A;  1OCT C;  3ZMD A;  5D8L B;  3S14 J;  2DA5 A;  4RM3 A;  2GXB A;  2K9M A;  2XKP A;  1V54 H;  2DYR H;  1AOY A;  1W1W E;  5FJ8 J;  3B6A A;  5DCX A;  1KU9 A;  4BXF A;  3IP4 B;  2OJE D;  2LH9 A;  1G4D A;  5K5O A;  4A3L J;  3O8G A;  5GTH C;  3CCU I;  3S32 A;  2EBI A;  2ZJR F;  1WH7 A;  3FM3 A;  2Y9Z A;  2HI3 A;  2JVG A;  3DFG A;  2O6G E;  5LD2 C;  5C4X J;  2HS5 A;  2CV0 A;  3UR3 C;  3VPR A;  4ZDP A;  2CFO A;  4CSW A;  2DTZ A;  3A01 B;  4B47 A;  3OS2 A;  2VB6 A;  2A05 A;  5BOX A;  3FWE A;  2FD5 A;  1B1B A;  1J7K A;  4OIQ F;  3ULQ B;  1Y8Q B;  3A01 A;  2FA5 A;  3RI4 A;  1BI0 A;  5J8F A;  3TGN A;  3E1S A;  1X3U A;  3PFI A;  2K27 A;  2FU4 A;  2G9W A;  2M0C A;  1DP7 P;  4PGG A;  2BY3 A;  2B63 J;  2ECC A;  4GYI A;  4HLX A;  3KP4 A;  4BQQ A;  3L2C A;  4IL6 C;  1J9I A;  4ENN A;  2D1H A;  3MN2 A;  3FIS A;  1SVO A;  5EEA A;  1VQ7 I;  1MMA A;  1TQP A;  2CQX A;  2F4M B;  4HEA 2;  5CVR A;  1SD4 A;  2WAQ A;  3OYC A;  3QPS A;  1MND A;  2JPB A;  1D3Y A;  2PMU A;  1XPX A;  4RLQ A;  3OYF A;  2R7R A;  4BBS J;  3I53 A;  2O0Y A;  5DCF A;  3JSO A;  1TT5 B;  2HKO A;  2YUS A;  4XON A;  1X3W B;  5J1Y A;  3LSR A;  4PK4 A;  1YS7 A;  3GME A;  2LF7 A;  3QAH A;  3S17 J;  1WQ2 A;  2ZXJ A;  1KON A;  3BG7 A;  1W4M A;  3U1D A;  1W7P B;  2DCE A;  3FF5 A;  3ASN H;  5IT9 K;  3ZPL A;  3SZP A;  4ZTF A;  2KZG A;  4ZQ9 A;  1W7P A;  1XN7 A;  4IQJ A;  3ZR8 X;  1XSX A;  2FML A;  2VL8 A;  3TKY A;  5LRS A;  1U5T C;  3BR3 A;  5EZG A;  2R0Q C;  3CUQ B;  3SEZ A;  1TNT A;  3PUF A;  4ASN A;  2HEO A;  1P7I A;  4C3H J;  3U9G A;  3CUQ A;  5TJJ A;  4D5C A;  1MSF C;  1S3J A;  1WWX A;  3HOS A;  5CKT A;  2IGK A;  4ESB A;  2ZXH A;  5BNG A;  4MFD A;  1KU3 A;  3QK2 A;  1U3E M;  3I55 I;  1W5T A;  2CRG A;  3HOZ J;  2QGU A;  2XF6 A;  3P9I A;  2KJC A;  2EFO A;  2Z9O A;  3HG9 A;  1IUY A;  3OV8 A;  2M5W A;  4A69 C;  3HM5 A;  4BJT A;  4OU0 A;  3LAP A;  5IOY A;  3CO7 C;  4BAC A;  4DZJ A;  2EA4 A;  1ORK A;  5E20 A;  3JRC A;  1BR2 A;  3VEP A;  4KN7 X;  3G2B A;  4HZF A;  3ZQH A;  3R6S A;  3PSF A;  1AHD P;  2E2H J;  2O9L A;  2CUZ A;  1HBX G;  2VBX A;  1DGR M;  2VIX A;  1QVU A;  1LFU P;  3V4G A;  1WJB A;  4MLO A;  1M55 A;  1KU7 A;  3CJQ B;  1LDJ A;  3EDP A;  3HIF A;  3OL3 A;  2KIU A;  1MNE A;  2O7O A;  1F4K A;  1I5Z A;  2R92 J;  3KEO A;  1LB2 A;  2K5C A;  5AIP A;  2PMZ A;  5JHU A;  4E7Z A;  3OY9 A;  4CUG A;  2MFZ A;  2NS7 A;  4U87 A;  1UEL B;  2BW3 B;  1MW7 A;  5E18 F;  3ONQ A;  3DBL B;  4GDF A;  5FRN A;  2BW3 A;  3MZ8 A;  2GM4 A;  2VN2 A;  2VOD A;  1FX7 A;  1HKT A;  4PJL A;  1TWF J;  4E7J A;  1MBH A;  2E1O A;  2CUE A;  3AL0 B;  4W1U A;  2XAJ A; 
#chains in the Genus database with same CATH homology
 4H4K C;  2NTC A;  2WY8 Q;  2VXD A;  4ZTJ A;  4BE2 A;  4JQF A;  4ZC3 A;  3ZRG A;  4ANJ A;  2WAD A;  4QPO A;  2WBM A;  2RQQ A;  2CMP A;  4XN3 A;  3W2W A;  1D0Y A;  2M7A A;  2X85 A;  2F6C A;  3OIP A;  4OAZ A;  4NNJ A;  1HA8 A;  1QHG A;  4CCO A;  3OS1 A;  2X1C A;  2UV1 A;  2VQC A;  3QFQ A;  1WJE A;  4G6T B;  1P9Q C;  3K4M A;  4LMD A;  2K3P A;  4QPQ A;  3IAM 2;  2KP6 A;  4F92 B;  4LG3 A;  2AQE A;  3OYJ A;  1YE9 A;  1WJD A;  3LSK A;  2VLA A;  4E6K G;  3DQV C;  1Z3Y A;  1OLT A;  3CP2 A;  2V4J C;  3K70 C;  1N77 A;  3S3N A;  4XN0 A;  5HNF A;  2HW0 A;  4BS9 A;  2W00 A;  2KRC A;  3DKY A;  1BR4 A;  3GBG A;  2M0M A;  3OYB A;  1V5G A;  1QHH D;  4IZZ A;  4CCJ A;  1PJR A;  3VYS B;  3VSL A;  3MKZ A;  3OYN A;  3MMY B;  4Y3O A;  4LIU A;  2V1N A;  2R7W A;  4BDY A;  1W36 D;  2X51 A;  2LYC A;  5JHF A;  1MMN A;  2R7V A;  2Q2E B;  4YEL A;  3VYT B;  3A2K A;  2FUG 2;  3BCA A;  4YRV A;  4XLE A;  3OR2 C;  4DOZ A;  4PJM A;  2BOL A;  2M3A A;  2VQL A;  2PJR B;  1Z21 A;  2KHM A;  1T0F C;  3H9Q A;  3I3L A;  3D5S C;  3DPU A;  1X19 A;  2PJR A;  2W4S A;  3OIQ A;  2ZSI B;  3PL8 A;  2CV2 A;  3QOD A;  3QOE A;  3S8P A;  1X1A A;  3LSM A;  4F52 A;  3OYM A;  4ZDO A;  2L9S A;  3V42 A;  2QKM B;  3EUA A;  4F93 B;  3S3M A;  2DOA A;  2KDO A;  2NOJ B;  2VQH A;  3CMM A;  2O5R A;  2KPM A;  3OS0 A;  2IS2 A;  2M4K A;  4XQF A;  5HVQ C;  1W36 C;  2HQA A;  4FGN A;  2LC2 A;  2E5Z A;  3ZQQ A;  2P0W A;  1X4P A;  2MAB A;  2WB1 A;  2HNH A;  5KCM A;  1N75 A;  3TBI A;  4IX7 A;  1WJ5 A;  1Z1D B;  2IGM A;  2OV7 A;  2VJ4 A;  4B3X A;  4BE1 A;  4C2T A;  2IPR A;  2MD0 A;  2F5V A;  4RM2 A;  3IUO A;  4C9Y A;  2VAS A;  3DEE A;  4HSR A;  4PUS A;  4PFO A;  3AL0 C;  1DQU A;  1YX3 A;  4FAS D;  3DLA A;  2XC7 A;  3HKZ A;  4AU7 A;  4BDZ A;  3N05 A;  4F55 A;  3HOT A;  2CH0 A;  3QYE A;  4DJA A;  4NBP A;  4FB3 A;  1ZEL A;  1GLN A;  3PNY A;  4LIV A;  5TGT A;  2KLO A;  4NC7 A;  2LRD A;  4HPQ A;  1D1B A;  3VYU B;  2ZFU A;  3SYT A;  4CCN A;  4YEJ A;  4XKC A;  4D1Q A;  1KSY A;  2V9K A;  1DGW Y;  4BUP A;  2KL4 A;  3U21 A;  2IXS A;  3KEY A;  4CCM A;  4B44 A;  1X1C A;  4CZC A;  2E1M B;  1J09 A;  2XAU A;  3DPT A;  4EAT A;  3MD2 A;  2ELJ A;  1FMW A;  3QYF A;  3RQ4 A;  4BJ6 C;  3L2W A;  3DU6 A;  2CV1 A;  4BL0 B;  2WAF A;  3MKW B;  2HZD A;  1D1A A;  4HST A;  1X1B A;  2Y0S A;  3QYB A;  3I9V 2;  2R7S A;  2JA2 A;  4IKF A;  4DBQ A;  2OC6 A;  1KSX A;  1WJA A;  3DTI A;  3LFU A;  4X0G A;  3S93 A;  2LOO A;  2L5Q A;  1Z7L A;  4AVZ A;  1N78 A;  2DJI A;  2XDV A;  3NWT A;  2UWM A;  4ZJZ A;  1G8X A;  3PUB A;  2CW7 A;  4XKB A;  1LKX A;  1LDK B;  3L2V A;  4NQW B;  3BLY A;  4XM3 A;  4U7B A;  2E5N A;  4CA0 A;  3VDX A;  3DTE A;  5CQE A;  2FUF A;  5BYG A;  1MMD A;  2JSP A;  1PYV A;  5CYN A;  4P5O A;  4PSX A;  1WFX A;  3HC7 A;  4XKV A;  2W7N A;  1MMG A;  3W2A A;  2W82 A;  3BCB A;  4OAY A;  1X1D A;  2X1D A;  4PFP A;  4XLC A;  3K4K A;  3HXL A;  3FBN B;  2IS1 A;  2IGO A;  2Z2S B;  2OUM A;  3L2U A;  4OWR B;  1WJF A;  2MYS A;  1D0Z A;  3K6G A;  1YX5 A;  3LSI A;  5KHD A;  4BJ5 C;  3LSH A;  1F08 A;  4CCL A;  3NWS A;  2R4G A;  3CF2 A;  3SZG A;  2GOX B;  3VSK A;  4BQN A;  5CPR B;  1EA3 A;  3PNV A;  3S3O A;  4XOR A;  2BVL A;  1T95 A;  2HU9 A;  2ZXI A;  4B43 A;  2KRH A;  1QU3 A;  3HUG B;  1Y56 A;  2KZV A;  3PFY A;  5D9I A;  2XF5 A;  3SDB A;  3RPU D;  1SFK A;  2ITL A;  4C2U A;  3DTK A;  4KIS A;  4D9J A;  2R7X A;  3W2V A;  4E7H A;  1DP3 A;  1FMV A;  3HPH A;  5LFA A;  3DU5 A;  3H5N A;  1VZ0 A;  4XOT A;  1ERD A;  3C2H A;  3IAS 2;  3CZ6 A;  3J7A Y;  3EUH C;  2W1O A;  2GOM A;  3UNG C;  4E7K A;  3RSN A;  4ZDL A;  1IRX A;  4KIT B;  2HVS A;  4XLF A;  3D5L A;  2VJ5 A;  4RMN A;  3QN2 A;  4ZO0 A;  2NL8 A;  2Z1D A;  3HL2 A;  4B48 A;  2IS6 A;  4DBR A;  4ITV A;  2V7F A;  1V5F A;  2X6X A;  3FBI B;  4BGD A;  1V5E A;  4II2 A;  4HRI A;  2VPL A;  4LIF A;  3RCO A;  2LG4 A;  1UG0 A;  4R79 A;  3L2R A;  3K10 A;  2Z16 A;  2DXI A;  3CP8 A;  2R7U A;  2XSJ C;  2I8D A;  4PJN A;  2HVR A;  1UAA A;  2QKL B;  3K4C A;  3TMO A;  2VJI A;  4DIQ A;  2LRE A;  3PNT A;  2E60 A;  1Z3X A;  2KMU A;  2L7K A;  3H9G A;  3BC8 A;  4ZYA A;  3H0D A;  2M4G A;  4CCK A;  3OL4 A;  2L2O A;  2UUZ A;  3M8J A;  1OR7 C;  4F91 B;  3KX2 A;  3PSI A;  4NUB A;  3W3C A;  4AYB A;  2CS3 A;  4E7L A;  4RM3 A;  2K9M A;  3HPG A;  1R6R A;  3DKX A;  4E7I A;  4P1W A;  2CUJ A;  5DCX A;  1NG7 A;  3LSG A;  4BXF A;  3IP4 B;  5KNL A;  2LH9 A;  2X6W A;  4E4H A;  3H5R A;  2ZSH B;  3K4J A;  3S32 A;  4II3 A;  2JVG A;  1WJC A;  4GRI A;  2IS4 A;  5LD2 C;  3FKJ A;  2CV0 A;  3VYR B;  3UR3 C;  4N4N B;  2HPI A;  4ZDP A;  2CFO A;  4CSW A;  5HOO A;  1RZ9 A;  3PJR A;  4BU2 A;  4B47 A;  3OS2 A;  1D0X A;  2VB6 A;  4NC8 A;  2K9L A;  2V6E A;  2F4I A;  1LFP A;  3BG6 A;  3E1S A;  1S9H A;  3H9J A;  3OYH A;  2VXZ A;  2VKH A;  4XMY A;  2RNG A;  3CJR B;  3ZXS A;  3OYE A;  2WA0 A;  4BQQ A;  1U0J A;  2Q1Z B;  1TZL A;  4HNU A;  4CH7 A;  4RLF A;  4KT6 A;  1JI8 A;  1MMA A;  4HEA 2;  2WAQ A;  3OYC A;  3FDY A;  1L5I A;  1MND A;  5FRO A;  2X6Y A;  3H5A A;  2A5W A;  3D5R C;  4RLQ A;  3OYF A;  1L2M A;  2R7R A;  3OOU A;  1E0E A;  3EPZ A;  4Y33 A;  3A1Y A;  3CES A;  2LY2 A;  4BE0 A;  1TBD A;  4XON A;  1BOB A;  2DT7 B;  4PK4 A;  4HG2 A;  3OYK A;  4KW3 A;  1KON A;  1NG6 A;  3BG7 A;  3OYD A;  2DCE A;  2VKD A;  4BQO A;  4ZTF A;  4ZQ9 A;  4IQJ A;  3ZR8 X;  4FET A;  4BEH B;  3LL7 A;  2VL8 A;  4XR6 A;  2R7T A;  3OMY A;  4BEH A;  3SEZ A;  2R7O A;  2IF9 A;  1Y6I A;  1SAU A;  4JOM A;  2JUG A;  3SEQ A;  4HNT A;  1K6Y A;  3OWT A;  3HOS A;  2RRE A;  5CKT A;  4F3Q A;  2IGK A;  4J00 A;  2ZXH A;  3ZCO A;  2R7Q A;  5HLT A;  2V26 A;  3QK2 A;  2HDW A;  4J01 A;  2BVM A;  3LMM A;  2AQF A;  3K4B A;  1LVK A;  2XF6 A;  2JVH A;  3HG9 A;  4PJJ A;  1G59 A;  1BR1 A;  1R9W A;  2IGN A;  4XKW A;  2CW8 A;  3K4N A;  3VWB A;  4BJT A;  2LY1 A;  3EUK L;  3F9K A;  2HPM A;  4KJZ A;  3DPL C;  4XL9 A;  4BAC A;  2WAE A;  1UUT A;  1BR2 A;  1TT0 A;  4IQ4 A;  4XLH A;  3G2B A;  4LIT A;  2HVQ A;  4XNF A;  1AA7 A;  3PSF A;  4C30 A;  2DT6 A;  2XF7 A;  2CUZ A;  1DGR M;  2VIX A;  2LBF B;  3K4L A;  1WJB A;  3L2Q A;  4MLO A;  2E1M C;  1M55 A;  2LBF A;  3CJQ B;  3AFH A;  3OL3 A;  3TL4 X;  4E7S A;  1MNE A;  2M7B A;  3OYL A;  3OYI A;  3OYA A;  4Y4R A;  3AKZ A;  2K5C A;  3OYG A;  2PMZ A;  3M1C A;  2VQG A;  5HNH A;  4E7Z A;  3OY9 A;  4CUG A;  2MFZ A;  2L9N A;  4U87 A;  1UEL B;  2BW3 B;  2KQR A;  4DGW B;  1MW7 A;  5CQG A;  3A4C A;  3ONQ A;  4GDF A;  5FRN A;  2MC4 A;  2BW3 A;  1D1C A;  2WY7 Q;  3MKY B;  2TBD A;  4XOP A;  5FRM A;  2A6T A;  3KYL A;  2VJJ A;  1X4O A;  4PJL A;  3ZGK A;  3OR1 C;  3K70 D;  4E7J A;  2X1E A;  3E0J B;  4XLA A;  3AL0 B;  4N4O B;  2ITJ A;  3C2G A;  3H35 A;  3FHN A;  3DWL E;  3RTR A;  4PSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...