4U87A

Crystal structure of the ba-soaked c2 crystal form of pmv158 replication initiator repb (p3221 space group)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
201
structure length
191
Chain Sequence
KEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHESKDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYDFIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein RepB
publication title Conformational plasticity of RepB, the replication initiator protein of promiscuous streptococcal plasmid pMV158.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Replication
total genus 57
structure length 191
sequence length 201
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01719 Rep_2 Plasmid replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4u87A02
3.40.1310.30 Alpha Beta 3-Layer(aba) Sandwich Replication Protein E1; Chain: A, Replication Protein E1; Chain: A, 4u87A01
3DKYA 3DKXA 4U87A
chains in the Genus database with same CATH superfamily
2COMA 4HX4A 3FM5A 1WJ5A 5D4SA 5J4YA 5FB2A 4PJ0C 3LSTA 2OZUA 5IP7J 1ZRDA 3S2DJ 2YU3A 4B4CA 1ZH5A 4Y52J 3SEZA 4J19A 3CCRI 2IBDA 1U9NA 1SFXA 5TJJA 5E3LA 2KP6A 2CYYA 4HOBA 1FBSA 2XSJC 2EFPA 3H5AA 3KE2A 2E2HJ 2E7XA 3MAJA 2E2JJ 2DMPA 4I09A 5DCFA 2B7EA 1XSXA 1R23A 4B48A 4YRVA 1VFCA 3B02A 1X58A 3LA7A 1Z91A 3KZYA 2ZB9A 2ZBKA 5J1RA 4E7JA 1ULYA 4XLNF 1HW1A 1R1VA 1EJ9A 2B63J 1ETQA 5LRSA 3S1QJ 2ZC2A 1O3TA 2HI3A 1MBKA 2A5YB 3DP7A 1VZ0A 4CCMA 4DJAA 4QTRA 4U7BA 2EFWA 5FRNA 4ZTJA 1O3RA 4XK4A 2DQLA 3BCAA 4BEHB 2V7FA 2JA8J 1D1CA 1JTXA 1G3YA 3CQZJ 1FNNA 4I0AA 3ZMTA 4HA8A 4M3DA 3DKWA 3OYJA 2QZ8A 2WAEA 2CQQA 5TRDA 3R0AA 3WTVC 2K3FA 3H3UA 1VQ8I 4KMUX 1QZYA 4FX0A 1ZTRA 2QLZA 3OR2C 3I9V2 5B1BH 2IJLA 3T0YA 3GUDA 3O6BB 1XN7A 2NVXJ 4KFCA 3HRSA 1FZPB 3OIPA 2VKEA 3AG2H 5DYMA 4Q48A 1IZ1A 2M45A 4II2A 2BXZA 2UUZA 3FF5A 2VT2A 3HBLA 5GAHJ 5LRRA 2P5KA 4MQVA 3GFLA 2E60A 2IA0A 3DTIA 2XF6A 3K1MA 1A6IA 2KMUA 3HSFA 3IH3A 4B3XA 2P8TA 2KDZA 2GOMA 2HQAA 2M2EA 2IPRA 2MC3A 4OOIA 1IW7F 3S2WA 3SZGA 4NUBA 1MD0A 2YS9A 3GTOJ 1LKXA 2BGCA 1ENHA 1VQ6I 2M4GA 3MD2A 4BDYA 1BN5A 5CLSA 4IPAA 1WRJA 2JJ7A 3A0HC 1C0WA 1T39A 3SEQA 1LDKB 2KFDA 2PG4A 5EEAA 3CF2A 3TDUC 3CCEI 2OA4A 1I3AA 2D1VA 1X1PA 2HDDA 2KRCA 1EH7A 2PMZA 2W48A 1BR2A 5J8CA 5LGNA 1UJ8A 2X9DA 5CKTA 2LK2A 4HSTA 2PMUA 4RDUA 3N97A 3ASOH 4XLFA 3HJEA 1ITYA 5E1WA 4K2EA 2KIFA 4UV8A 1FWZA 2VLAA 1MSEC 3TDZC 4BHBA 5CPRB 2LC2A 2Y0SN 3Q0UA 3GVAA 5IP6A 3RSNA 2BV6A 1SANA 4OINF 2V26A 3WTSC 2EIJH 5K5OA 5L3DA 4ZDPA 1FYMA 1UHWA 4A3JJ 1DP7P 4HSRA 3CMAI 1JUMA 1K6OA 3JRGA 2RN7A 1QVUA 4MFDA 3PSIA 1VQ4I 1X3WB 1E2XA 1YOVB 1W0TA 3V8JA 1O3SA 3A1YA 3BY6A 1KU7A 2BW3B 3KCCA 3LAPA 4GGGA 4D0PA 3O3KA 4PJLA 4XIDA 1FBUA 4RGSA 2CQ7A 3AKZA 1S7EA 2NOJB 4WF2A 3E6MA 4LG0B 4FTHA 4IX7A 3DXJF 2JRMA 2JUCA 1QPIA 4D5FA 1XMAA 2MH9A 1H89C 3FHZA 4PJMA 4PFOA 3QAHA 2DT7B 2R92J 3N05A 2PJPA 1WH5A 3FMRA 4BHPA 4QWQA 1MJBA 5EGOA 2NS7A 1UB9A 4E6KG 2BZTA 3W3CA 2X51A 1T33A 4KIBA 3MMYB 1Z05A 4LK1F 2UXNA 2W1OA 5HNHA 3BTCA 3TKYA 3OWTA 3C1DA 4DZJA 3PO3J 4DZPA 4HNUA 2Z2SB 2R7TA 2VJ4A 4ZC3A 2TCTA 1RZ9A 2LKPA 2WC2A 1HKSA 2AQEA 3DBLB 2HVSA 2WB1A 3D5LA 1F43A 2F5EA 1WKMA 1SD4A 2L9RA 4I99C 1BW6A 2DK5A 3ISPA 5D5XB 1UMQA 2HDWA 2QCOA 1FOYA 4XOTA 1DPUA 1S5LC 3PM1A 3MKWB 3JRBA 1YW7A 2UXXA 3WTUC 4E7LA 1B9MA 2LR8A 4C2UA 2LNBA 1FYLA 4BE2A 1Z6TA 2ZCWA 2DFFA 2VJIA 3V7SA 2L01A 4KJZA 2XB5A 3REOA 4D7MA 4DQ2A 1D0ZA 2FBIA 1ETWA 5FFZA 4XRMA 5D9IA 1ZN2A 3VPRA 3S8PA 2NS8A 1PUFA 3A4CA 3SQNA 2E5NA 2XSDC 3KP7A 3OY9A 2DT6A 1SC7A 2GOXB 4G12A 3LAJA 3BJ6A 1D5YA 4LITA 1NHAA 5E79C 1FMWA 2W00A 1IN6A 2ZNYA 4A2UA 2BEOA 4W1UA 3F3XA 1FMVA 1M1EB 1U5TC 4A0XA 4BJ5C 3RKQA 4C3IJ 2BY1A 1ZG1A 2FNAA 1PYVA 4EEFG 3L2WA 1MDMB 3AAFA 1K83J 5GP9A 1P4XA 4MHGA 4DGWB 5CQEA 2CUZA 4FX4A 4IHSA 4ZTFA 4HLYA 3L2QA 3RKWA 3WE3A 5LEKA 2DLLA 1H8AC 2X1CA 3GBGA 1FIAA 2DYRH 5CVVA 3K4LA 2IS6A 2CMPA 4KUMA 4MQ9F 1P4WA 4P55A 3PFYA 2IF9A 2ELJA 2WAQA 3ZPLA 4RB3C 3U2RA 4AVPA 3F8FA 4BJTA 1MMSA 1TQPA 4LD5A 4ENNA 2RC4A 3ABUA 1ACIA 3ZMZA 1LDJA 3TO6A 4GXOA 5TISC 1VQ9I 4BNCA 4M74A 3T8RA 3OR1C 1JJ6C 1A5JA 2ADUA 3Q5FA 2CFOA 2ITLA 4AC0A 3WU1B 4RB0A 3TOAA 2K7LA 2EWNA 5HDGA 2O8KA 1FOXA 1EA3A 2VONA 2CQKA 2FQ3A 4HQEA 1IXRC 1R5ID 2VQCA 2FNPA 4HV6A 4P96A 1VI0A 2QVOA 3M1CA 4ZDLA 4S05A 3CDHA 1YITI 3HUGA 1FP2A 3J7AY 3CCYA 2LOOA 1CF7B 3JSPA 2IA1A 1XGNA 3J81K 1OCTC 1R9WA 2M0MA 3BR1A 4GDFA 3IWZA 5KK1A 3E5XA 2XGDA 3GF2A 2PJRA 5BPDA 3ECOA 4DOZA 2FE3A 4UUSA 2K5CA 2HU9A 1J75A 1PUEE 2IAIA 3G1MA 3IUOA 2O9LA 1QZZA 1MBGA 3JTHA 4KITB 1G8XA 5K7ZA 3OL4A 4Q47A 2M8GX 5AIPA 2DO7A 4IRIA 1FSHA 1T38A 5E18F 2FX0A 2GQQA 3LQQA 2K3PA 2P7CB 3K10A 3A01B 3PUFA 1HW5A 1IN7A 3TP3A 5C4JJ 2H8WA 3GFJA 3GZ6A 4OAYA 2RVCA 4AWXB 3EYYA 3V8KA 2K9MA 2R5YB 1DDNA 1TLHB 2OAZA 3KFWX 5J1YA 3VYSB 1V55H 4KNYA 2VXZA 3IL2A 3GTQJ 2PBIA 1NG7A 3DEUA 4IZZA 1U5TB 3QPTA 4RB2C 4A3EJ 2ZJQF 2P0WA 2YPRA 5CVJA 5L3CA 2LMDA 2EZLA 3QQAA 2K02A 2NOGA 2MSYA 2GLOA 4ENKA 2WV1A 1QHHD 2HZTA 3CDLA 1H9TA 2L5QA 1FEXA 3HHGA 1F1ZA 4N0BA 1XMKA 4NC7A 5B66C 5JLWA 1OPCA 1TW3A 3H0DA 4XKWA 4NQWA 1QVTA 5DCMB 2NVTJ 2Y75A 4G6TB 5CQGA 2FSWA 2ESHA 3RIRA 3IV5A 1BOBA 2E71A 3FM3A 2DDAA 1Z3YA 3OIOA 5H20A 3BG9A 4AYBN 4IHVA 1TW2A 4LB5A 4O6JA 2F4OB 2HPIA 1TWCJ 2A5WA 4Y15A 2OQRA 4B1RA 1USSA 3GTJJ 2RDPA 3FWEA 1PVEA 2FQ4A 5GTIC 1SFOJ 1TWGJ 2LDUA 2EA4A 5IYBJ 3VEPA 3S2HJ 4AM3A 3K69A 3F6VA 4GYIA 3K4KA 3W2AA 1R1UA 3ZQ7A 2QF7A 4HNVA 2VN2A 3ABTA 1F5TA 1PDNC 4XM3A 1USTA 1T0FA 4LMYA 4IXAA 2CV1A 3IKVA 3S16J 2Z9OA 1YQAA 2XGXA 3ML6A 3W2VA 4WXHA 3FXQA 2V1NA 2JT1A 1MH4A 2DJIA 1XCBA 1ODDA 2JN6A 3SZPA 3OIQA 2M8EA 2BY3A 2HFHA 2BOLA 1JGGA 4MEXF 4DBRA 2HS5A 5F6FA 1PP7U 2CWEA 4AVZA 1W5SA 3M07A 3S32A 3OL3A 4Y17A 1MH3A 1MBFA 2VB6A 4EJTA 4BBSJ 3MQ0A 4CCLA 4ITVA 1X2MA 3LNQA 3CCLI 2DPDA 2QQ8A 1I1GA 1XDUA 4A3DJ 3L9FA 1GLNA 1MBEA 2ZMEA 1A36A 4NC6A 4WCGA 2EB7A 3QP5A 4KT6A 1QGPA 2JA2A 1TC3C 4N4NB 4QIWN 2NAZA 5DM7F 2LLKA 2R4GA 3J80K 1U8BA 2CW7A 4QPQA 5ILUA 3GFIA 1SAUA 5KAIC 5BYGA 5DUKA 2IS1A 1PP8F 5EZGA 2Q2EB 1UG0A 4PDKA 2B9SA 4U0VA 4ABZA 2MFZA 3DQVC 5EDNA 2OC6A 1KGSA 3BT9A 4IL6C 3F21A 4BE0A 4A3GJ 1Z77A 3ECHA 2VIXA 1S3JA 3RQ4A 5ICGA 3GLXA 1O3QA 4EJVA 5F08A 2YR2A 1R58A 2JVGA 3L7WA 4LIUA 1U8RA 4OIPF 3L09A 2DU9A 2L7ZA 2COBA 4OMYA 1OISA 3HGYA 1QPMA 3OYAA 3JRAA 3UKGA 1W36C 2M5WA 2GBYA 1O7FA 1XD7A 3HDDA 4BE1A 4G7HF 3MZYA 1ZR2A 1I6XA 1B72B 3CCVI 5E3OA 2VT3A 2HZDA 4BEHA 3KYCB 2DTRA 3IWFA 2D45A 5D6FA 1QBJA 2CSOA 3CP2A 2FD5A 2EQRA 1VQOI 4FQGA 3U1KA 1HKQA 3Q3SA 3J7YJ 3K70C 5JHFA 1ZKGA 2ZNZA 3ASNH 1KU3A 4M72A 5LHGA 3QP6A 5H2FC 3CCQI 1GV5A 1WQ2A 3KX2A 3GYHX 4II3A 3RI4A 4M3FA 1WSUA 2MGQA 2QYOA 4RGRA 4BKXA 5LLQA 4XICA 1ZG5A 3CJTB 1TP4A 5BNGA 4LLLA 4DYCA 4M71A 1BJAA 2E36A 1S7AA 3ABMH 3DU5A 5FD5A 3VFZA 5ICEA 1IGNA 3OYHA 1MBJA 1D8JA 4E70A 4CGZA 2DAOA 4WWCA 2B0LA 4HPQA 2Y48A 1HDPA 1Z1DB 4CCJA 4ESFA 2YUSA 1LFUP 1IXSB 5E17F 3BG6A 2MH2A 1KONA 2DA2A 1I50J 5DM6F 4ZYDA 3KETA 1YHQI 1A31A 1NG6A 3AL0C 5K5QA 1TQIA 4N4OB 4PGGA 3FXLA 4F92B 1S7OA 1P2FA 3H92A 1JKRC 4BUPA 4A3MJ 4BXUA 3FBNB 3DBHB 2K40A 3CJQB 2EFNA 1OCZH 1HW2A 5ILSA 2VPLA 2IA2A 2LVSA 1V54H 3CMYA 3S1NJ 4D7NA 4RAGA 2KZVA 2LG4A 5IOYA 1JHFA 4I7HA 4L5EA 3LSPA 4PJJA 1U3EM 3NARA 4FHTA 3IAS2 4XN0A 2IEKA 1YIOA 4EM0B 5M5XJ 1GVJA 4ENMA 4OIRF 3LSRA 5BQTA 2VUMJ 1WI9A 3K4JA 5HODA 1P4AA 2L2OA 1MNEA 1J9IA 1R22A 1XMXA 2ID3A 4ZO0A 4KT5C 3OMYA 1IJWC 5B1AH 3G6EI 2P5LC 1G6NA 2H1KA 5DS9A 4A3KJ 4DNCA 2I8DA 1LUJB 2MD5A 3VODA 3GTPJ 2LD5A 1IN5A 3I53A 5DTDA 1Z7UA 2HOAA 1RKWA 3KEOA 4BDZA 5KHDA 2DI3A 4UHTA 1LQ1A 2HYFA 1HF0A 4Q5SF 1L0OC 2AXLA 3F8BA 3ZMVA 4HYEA 4A5MA 5H6QA 4EATA 1RC9A 2EILH 2XF7A 2AO9A 2DDBA 2K9QA 2F4IA 3AG4H 3CLOA 3K1NA 3RDIA 2JWTA 3S93A 4FETA 2NL8A 1YYVA 2PMZN 3VWBA 1J7KA 4Y4RA 4V19K 5JR3A 5GPCA 2HVQA 2V9KA 2W25A 2X85A 1TZLA 2RQPA 2UV1A 3QYFA 4RS8A 5JHUA 3SFIA 2VOPA 2MABA 4J01A 2E35A 3MKLA 1WJDA 4IVNA 5B5EC 2NRAC 3KLOA 5KAFC 5J1UA 1OKRA 1HQCA 1HBXG 4CZZA 4ESBA 3JW4A 4YFXF 3P5JA 1U0JA 3B73A 5JI6A 1IO2A 1DGWY 4UXNA 4ESJA 2STWA 4A0ZA 4E7HA 2W57A 2JA7J 1YS6A 4XLEA 2V1XA 3NAUA 2VQLA 4LG0A 2EZKA 4A0YA 5GAEJ 3LL7A 3ZQCA 2H09A 3CDIA 2EPFA 4CHUA 1YW9A 3V7RA 1WJAA 4IOCF 3A0BC 3IP4B 5LBQA 4Y33A 2KIQA 1RPWA 3FXMA 1MSFC 4D5CA 1KSXA 3H3VK 4UB6C 2LYCA 5KVRA 1KYWA 3PJRA 3H0GJ 2BY2A 2DYSH 5EEHA 3JR9A 1FY7A 4QLCU 2FA5A 2LBFA 4EMSA 1T98A 3AL0B 3ESWB 4HBLA 5FFXA 2ELKA 2CUJA 4NBQA 2V79A 4V2GA 2HDCA 3LFUA 2ISYA 1IN8A 2QQBA 1EKEA 4UB8C 3CMEI 2L7KA 4IO9F 4WXDA 2KIMA 3ERED 3FK6A 1RKTA 4F55A 2LKXA 2A6EF 1Y6IA 3DFGA 3BZ6A 2R5ZB 2FUG2 1NH3A 3MWMA 2F5VA 3WTWC 1WGXA 3VOEA 2Y9ZA 2BVLA 2FF4A 5LGUA 2E2IJ 2YX4A 2NXNB 3CUOA 3ERMA 3CUQC 2PFBA 2JPBA 2ZSIB 5JFRA 1MGTA 1E3PA 4E7KA 3QRFF 4UVBA 1MMGA 5CVRA 5E20A 1A6QA 2EIKH 3WTXC 4MTEA 2STTA 4DW6A 3RJPA 2RREA 2Q8KA 4KW3A 4F3QA 5LD2C 2DA5A 4Y7NJ 4C2MJ 2A69F 4CXFA 3GWZA 1ON2A 2F6CA 2WB1N 1WZ2A 2Z16A 4KICA 3RKYA 2VBYA 4BXXJ 3KP2A 4RA2A 3I54A 1MIJA 4BACA 4IKFA 4ZH4F 5GTHC 2L54A 3J7ZI 4U0WA 3ZQGA 2YX7A 5EG0B 4R79A 5HLHA 4PK4A 4E4HA 3K4BA 1FJLA 2ZJ2A 3KZIC 5A2QK 3OYEA 3E97A 3EUHC 1QNTA 2EFOA 3MCZA 4PUSA 4A6DA 1XGSA 1YLFA 4LMDA 2OTJI 3OS1A 3W6VA 4MO7A 2K4JA 4XSXF 1DP3A 5IT9K 1JXSA 4A3BJ 2Y9YA 1MDMA 5IPAA 3GEZA 1QU3A 3O2PE 3KYLA 1VQ7I 4XKBA 1ETKA 3I58A 3DTKA 4UVAA 3F8CA 2GAUA 4CZCA 3ZCOA 4M3GA 4HX8A 1K61A 3IHUA 3GFMA 1ZRCA 3I59B 1XCVA 2M34A 4P9UA 1FT9A 3E6DA 3FBIB 5D6EA 1F9NA 2LFBA 1GXQA 3OS2A 1WPKA 1Z6RA 2LREA 1IXCA 2DODA 2R7QA 3A02A 5FKKA 4AD9A 2O8XA 2RKHA 2DXIA 5IYDJ 4C9YA 1L5IA 2CUEA 3DPTA 3WTZA 5EYRA 4YFNF 5HNFA 3BJAA 1TT0A 2XUBA 2NVQJ 4BAYA 2XAJA 1TWAJ 2CUFA 3I56I 4ZDOA 2LH9A 4ZZDA 4Y3OA 3HGGA 5C44J 3CO6C 3CC2I 6PAXA 3RZDJ 2P6TA 4PJNA 2RNGA 1T08B 1KA8A 5HOOA 2EFQA 5IOZA 2L7FP 3W2WA 2E1OA 3V8LA 3F22A 4EJUA 2O03A 2IGMA 2EH3A 4AIKA 1R6RA 2F2EA 2VC1A 4LK0F 3F9KA 1KU9A 3GTKJ 4G7ZF 2WAQN 2EBIA 2R7OA 2Y0SA 1BJZA 1KSYA 2FBHA 1S29A 2MBFA 2ZSHB 3QPLA 5FKMA 1T6SA 3LSIA 1FSEA 2VBWA 3ZQHA 3MFKA 3BTLA 2DOAA 3BG7A 3JAMZ 1CF7A 3G1LA 3ZQLA 2E19A 4ENJA 2XGCA 2JK3A 1GV2A 3DCFA 1MNDA 5JVGF 3OS0A 3CUQB 4IRHA 3TW7A 2E7WA 4HV5A 4JK1X 1WCMJ 3UNGC 2R0QC 1EV7A 3FZVA 2H27A 5KCMA 4FE7A 4GYGA 2ECBA 4QPOA 3QU3A 4KA4A 1XS9A 1NK2P 1VQLI 3GTLJ 1BM9A 3EYIA 3L2CA 4RBOA 1L3LA 3E0JB 1BI3A 1IV8A 1FPQA 4AIDA 3QU6A 1R71A 5HDKA 1Q1VA 2DFEA 3A01A 3PNTA 3ZN0A 1JGSA 1HXDA 2IVMA 3VYRB 3NRVA 4C3JJ 5EF6A 2R7DA 1K4SA 1XC5A 2A61A 1JTYA 2R5YA 1ZHFA 4X1EA 3HXLA 4JQFA 5IT3A 1S72I 4FE4A 5CVUA 4MLOA 2Y31A 4ZYHA 3CJNA 1U5TA 2DQRA 4G7OF 2MW8A 3WU2C 2FMLA 3GW2A 2HQNA 1ZRFA 3I4NJ 4L9TA 2EZHA 4HNTA 1ZGJA 1F36A 3PQKA 2IGOA 2IRFG 3DPUA 3D5RC 2UWMA 2VC0A 3BTJA 3NWTA 3KEYA 3TGNA 1ZYRF 2AHQA 1DUXC 1FOWA 2DOFA 3SHFA 1LVAA 2DCEA 5ED4A 4NHJA 5DCMA 1NK3P 4CA0A 5HLTA 3ZR8X 1VQKI 1STZA 1D8KA 3BJOA 2XAUA 1R36A 3H9JA 1ZGWA 3HTUA 2W7NA 1IUFA 1DPRA 2EV0A 3EUAA 4NNJA 5CJ9A 1RUOA 3GLLA 1MMNA 3FXJA 3SXYA 1FTTA 1TQMA 1ZLJA 3C2GA 2EJRA 5FLXZ 2NVUB 2R7XA 4U88A 3QPSA 5GPAA 3DU6A 1OR7C 3GXOA 3QYEA 4HF0A 1U2WA 3QPHA 2JSCA 2L7MP 3U21A 4ZYAA 1RETA 3ULQB 2VQGA 2HXIA 1UHSA 2IW5A 4CUGA 2E1NA 2TRTA 2ICWG 3ABLH 4S0HB 3E3VA 4O5VA 2XAFA 1ZELA 3DBRB 2HYJA 3VSLA 4IHXA 1ZARA 4M6VA 4C3HJ 2J5OA 1D1BA 2MYSA 3VSKA 3HHHA 3CZ6A 4PFPA 3VDXA 3MN2A 1MBHA 4M9SA 3LSMA 2QGUA 3RTRA 2OU2A 5F27A 4U7DA 2PQ8A 1ERDA 2M30A 1UG2A 1X1DA 2DFHA 3GTMJ 1R7JA 4BS9A 2HPMA 1Y1VJ 4QSHA 4AIJA 1W7PB 3ZGKA 1UELB 2CG4A 3WG9A 2VODA 4B09A 2NYXA 2P6SA 2L4MA 2QQAA 1IAWA 4IHWA 4XLCA 1RRJA 3ZRGA 2ETHA 2DMUA 1HDDC 1BR4A 4LB6B 3TEDA 2MC4A 3FMSA 1SMYF 3KP3A 2NTCA 2VKVA 2DJNA 4PSXA 2O7OA 3N4MA 2GZWA 3I55I 2FMYA 3F72A 4CDGA 3C2HA 1HA8A 3OYIA 4WX9A 1WHUA 1LFPA 2Q2EA 4HG2A 2X4HA 1SAXA 1B4AA 4DBQA 3LSHA 3HOXJ 3R61A 4F52A 1W4MA 5GAGJ 4YG2F 2QUFA 2XKOA 1VQ5I 2JUGA 1TWHJ 1YX3A 1Z7LA 1MNMC 4I98B 4EV0A 1JJ8C 1YW8A 1KZHA 4RAZA 1Y0NA 2G9WA 1Y8RB 2XIGA 4CCNA 4A69C 2K4BA 1KQ9A 3OYBA 3ZP5A 3WODF 1LEAA 1IF1A 1CGPA 1QA6A 1BC7C 1XG1A 3OSFA 4PZJA 1OCCH 1ORKA 1ZK8A 5FLVA 1I3QJ 1B72A 4HF1A 3HKZN 3BOQA 4BQAA 2CGPA 3RZOJ 5CYNA 3GO5A 2Y69H 1OJLA 4LFUA 4E7IA 5ICCA 5DUIA 1ETVA 1T8IA 1I27A 2NS0A 3BG3A 3G4SI 1XSDA 3CC4I 4XKVA 3W6KB 4S04A 1AHDP 1B9NA 3QODA 4RLQA 4HW0A 1ZREA 1FTZA 2M0CA 4A12A 1FBQA 1X2NA 1OYYA 3HIFA 4JP0A 3HOUJ 1B1BA 3LOCA 3MVPA 1G3WA 5J47A 2BVMA 2CS3A 1KQ0A 2X6WA 2LY1A 3HRTA 4MGRA 4BQQA 4B47A 3T1BA 2LF8A 1LB2A 1FYKA 5FGMA 4HLXA 3E6CC 2XDVA 3H9GA 1BI1A 1ZQ3P 1Z1DA 4LJZF 5KNLA 2FBKA 3FKIJ 1R00A 2OBPA 5FKLA 2QBYB 4A3CJ 2DMTA 2ME0A 2A07F 2EA2A 3NWSA 4UUSB 4IRGA 1HC8A 1J5YA 4FT8A 2CRGA 4L9JA 3OYKA 2BHYA 3TW6A 1L2MA 3HZJA 5C4XJ 3IH4A 3KZZA 1B59A 1Z0XA 5D5WB 2QENA 3W6JB 2ZXJA 4CCOA 2CW8A 2Z99A 4ASNA 3CCSI 3UR3C 2BYVE 2LY2A 2O5RA 3HOVJ 3WU0A 3E1SA 3IAM2 3SDGA 1O4XA 4L0ZB 9ANTA 5L3BA 3HB9A 3H1CA 2Z1DA 3ZQIA 1BIBA 1HCRA 1UZCA 3KIOA 2V4JC 4C2TA 3K6GA 2XF5A 2RAEA 4D9JA 1BIAA 2VBZA 3BR0A 4AYBA 2QA4I 1K78B 2EV6A 2LRDA 3F0CA 1M55A 1DQUA 2K9NA 5M5WJ 4GO1A 3VYUB 5DDGA 1V3FA 2X1EA 3KYDB 1WWXA 1TWFJ 5ILVA 5FLMJ 2IP2A 2M3AA 3FISA 1YS7A 3A03A 4IQJA 4AIHA 1Z3XA 1R5GA 2ISZA 3CO7C 1I1SA 5M5YJ 1WH7A 3EPZA 3IC7A 4IOAF 4BY1J 3K9TA 4NQWB 2XV4S 3WTTC 3HTSB 2XPVA 4EJWA 1BOAA 1WJBA 1X4OA 5HS9A 4HX7A 1SVMA 4GFBA 1RR8C 1GXPA 2DA1A 1O57A 1W5CC 4P5OA 3L2RA 2C6YA 2GXGA 3B6AA 2Z5UA 3HSEA 5E8GA 1W5TA 5L3GA 4WK8F 4A3IJ 1U78A 3O8GA 1VTNC 3JRIA 1X3UA 3I5UA 2WY8Q 2F5DA 2KJCA 4IQ4A 1XTAA 3BQZA 2ZKZA 2ZXWH 3H3ZA 4BXFA 5J3LA 5L3EA 5DV5A 4EVIA 3EUKL 1W0UA 2W82A 5FJ8J 3BZKA 3LFKA 3R0JA 2NNYA 2DA4A 2V6CA 3S1MJ 3DKYA 2TDXA 4PSWA 2HOSA 1R1TA 3COAC 4RGUA 5HLGA 4PCQA 2HKOA 3SZTA 5K5RA 1OQYA 3Q0VA 4I02A 3EQLF 5IT9Z 3CJRB 1YRNB 1IDZA 1J59A 1EH8A 2G7UA 1OYWA 5E1XA 4RLFA 5BMZA 4Z2YA 2QQ9A 1DU6A 3M1EA 3OOUA 2D5VA 1X1BA 3DLLF 3OOPA 2NNNA 1X3ZB 2RQQA 1N25A 3I4PA 1T2KA 2VPRA 3D1NI 1K79A 1XPXA 1RI7A 2E34A 5K7HA 3WTYC 5J6XA 1FIPA 1WI3A 4MNUA 3BPXA 3HOTA 3H5RA 3TO7A 5LHIA 3RPQA 2QKLB 4UV9A 3TMOA 2VXDA 4CO8A 4OMZA 1LEBA 4F7ZA 4Y13A 1RR7A 2DMNA 4EGYA 1B8IB 5E1ZB 3PNYA 3L2VA 1MW7A 2EK5A 2ZFUA 1SFKA 2LTPA 2WA0A 2WADA 2X6OA 4P1WA 3V4GA 4A6EA 2R93J 2WAFA 2LY9A 3K2AA 3HRMA 1D3YA 2ZJRF 2R5ZA 3QK2A 4CCKA 3D0SA 5FRMA 5B3SH 3IRQA 3VYTB 3G73A 1ZR4A 2HKXA 4EJOA 4L5JA 2V1UA 3HRUA 2DK8A 1ETOA 3E5QA 3FDYA 3WHCA 2DFIA 1Y8QB 3E5UA 2HEOA 4A5NA 2CU7A 4E7SA 1HSTA 4P9FA 2XC7A 2L9VA 1D0YA 3C3WA 5M3FJ 4LLGF 5F0FA 1IRZA 2FU4A 3F23A 2R7ZJ 3KP6A 4LG3A 1ZLKA 1O7LA 1QRYA 2PX9A 4ANJA 1FLIA 4G8XA 2JA6J 4OIOF 2QSHX 5F0HA 4BQNA 4X0GA 2R7FA 1BW5A 3BC8A 4HQMA 2AS5F 2A6HF 2AQFA 1YX5A 2KL4A 2XRLA 3BP8A 1LNWA 5EG0A 3S3OA 5K7FA 2M1BA 2FRHA 2VKHA 3PL8A 2VE9A 1AA7A 3CC7I 1JHHA 1U6GA 2MLGA 2KIUA 2KKOA 1F08A 2KHMA 3EETA 1YJNI 2GWRA 3BR3A 2M87A 2BW3A 2KLOA 2M7AA 3LSGA 3U1DA 1AKHB 1R4NB 1W1WE 1UHMA 3BPVA 4XRSG 1SEUA 1AWCA 2LKSA 4CSWA 2XRNA 1HLVA 2FEZA 5GADJ 5IP9J 2XPUA 3F8NA 1JT0A 2I10A 4NDLA 1IRXA 3OYDA 1LE8B 4UY8I 1VQPI 4XORA 2D1HA 1D1AA 1QO0D 3I59A 2H8RA 1X1CA 2R7WA 4CYCB 3HC7A 1JKQC 2K9LA 1TT5B 4BGDA 5H6RA 1H9GA 3RYRA 1BA5A 2N8GA 4A3FJ 1YI2I 2V1DA 2XAQA 4JYKA 4V2FA 3OSGA 3HOYJ 4AUXA 2A68F 3PIOF 1OCRH 2K27A 2K9SA 3C2BA 1POGA 1WFXA 4I76A 4ZYEA 2EZIA 1VQMI 3JRDA 4UUTA 3QOEA 3BQYA 2YSRA 2CO5A 4EQQA 2O6GE 4KISA 3PUBA 1U9OA 4L9VA 3E7LA 2HQ5A 4DYRA 1OMIA 3GZNB 5BS6A 3M8EA 2JRTA 4HAMA 4HZFA 4CYDA 3Q9VA 2JSPA 2XROA 3DPLC 1AU7A 4MEYF 1H0MA 1XB4A 3E6BA 3F8MA 4IHYA 2Y0MA 2IGKA 3DEEA 1MJAA 4NC8A 4MTDA 3LWFA 1TTYA 3S1RJ 5DCXA 2HVRA 4G94A 3AG1H 3D5SC 3TO9A 4F91B 1IRFA 3BTIA 4B8XA 4DIQA 1J0RA 2ME6A 2QWWA 1P9QC 2NVYJ 1Y0UA 3HPHA 2DA6A 5E3MA 2V9VA 4BYYA 2W4SA 2KISA 1G2HA 2OUMA 3L2UA 3C18A 2Z33A 4KDPA 2GXAA 3R6SA 1G59A 3T5XA 3I71A 3MZHA 1IUYA 4HRIA 3TP0A 3KP5A 3SFZA 3J81Z 4MIMA 4XMYA 1K7AA 3CUQA 3QN2A 5CYVA 1MMAA 2E1MC 4N9HA 4KMFA 3FIWA 5IYCJ 1JI8A 1S9HA 2DPUA 1NTCA 2FXAA 1A04A 4C30A 4H4KC 4M6YA 2X0LA 4NB5A 4RM2A 1TL8A 1RZ4A 1XX5A 2F48A 4L5IA 1RIOH 4UVCA 3JREA 1HSJA 1P7JA 3BDDA 2CH0A 1WJEA 2AXTC 3OYNA 1ZAOA 1Y39A 1DGRM 4X6AJ 4XBFA 2CJJA 1Z9CA 1Q1HA 1WVRA 3U9GA 2PLYA 3DEWA 2HWVA 4RAYA 2XPWA 3S14J 5D5UB 2BY0A 3EUHA 1JE8A 1REPC 1VNDA 3KEQA 1P92A 1YG2A 2M9HA 3HOWJ 1SVOA 4GRIA 2IGNA 4YIFA 5J8FA 4IEJA 5D4RA 5EZHA 1LPQA 2P7VB 3BR6A 2IS2A 1LDDA 2VJJA 3H9QA 5BOXA 2VQHA 2DN0A 4TV7A 4ZQ9A 1ETYA 3ZMDA 3R4KA 4U0YA 4HDUA 1E17A 3EDPA 2DW4A 2JTVA 2ZFWA 4D1QA 2VKDA 3H5NA 4I0BA 4A93J 3QFQA 2MD0A 2LBFB 3M4OJ 4RMNA 3L00A 2L0KA 2GIVA 1X4PA 4CICA 2CV2A 2R7UA 4FASD 4KN7X 5LGTA 3CTAA 2KZGA 4L9NA 3KPHA 4PGHA 2W85A 4BH9A 1S8NA 2L9SA 4F93B 4M9ZA 3X2QH 1Z21A 3TL4X 5D8KB 2XAGA 3PIPF 4FISA 5AIQA 2PI0A 3OYFA 3I64A 4MFEA 2IT0A 2VI6A 2KPMA 5F04A 3JCUC 4HDVA 3JTGA 2JA5J 1GHCA 2A05A 2X1DA 5D8LB 4EGZA 1TBXA 3FKJA 4G6QA 2KT0A 3ONQA 4LIVA 2LP0A 4I6ZA 5FO5A 2GM4A 4XNFA 2GIZA 1V4RA 1FX7A 1E0EA 1K4TA 1R49A 2XHKA 2CQNA 1T95A 1FC3A 1FOKA 5FD6A 1QZEA 1OLTA 1JUSA 2A3SA 2K86A 2OF7A 1MKMA 2O61A 1T56A 4XLPF 2Y30A 3VB2A 2E1MB 1W7PA 3CESA 1UUTA 1BBYA 3JRCA 3ZQQA 3GX4X 3BROA 2FJ1A 3GCMA 3B6CA 1W7PD 4YFKF 4ZYGA 1Y56A 1UFMA 3Q9SA 4R1HA 3V7CA 2FUFA 2HXOA 2W24A 4ETSA 2A6TA 2VL8A 3K7AJ 4YIIA 2Q0OA 2F4MB 1OCOH 3ZQFA 3CF5F 2L4AA 3CLQA 1SD5A 4OU0A 1V5FA 2GA1A 2DMQA 3G3ZA 5L3FA 3LSKA 4ZJZA 3J80Z 3MEXA 5F64A 4RB1A 1YTYA 4XL9A 2HTJA 2ZO4A 4XR6A 2X6XA 4A3LJ 2OD5A 3V42A 4XLAA 2ZXHA 2R7SA 3HG9A 3A2KA 1APLC 3PO2J 2FOKA 2EV5A 1OCPA 3PQJA 2XASA 5EGOB 3I3LA 4HEA2 3WGGA 1QQIA 1EH6A 2X48A 4LGWA 1TNTA 2M7BA 2K85A 1LFBA 2HQRA 5EJCA 4UNOA 2JVHA 2M4KA 3WHBA 2QM3A 5CVIA 4RAFA 2P5VA 4BHCA 1MJ9A 2MA3A 4YELA 4W97A 3BG5A 3CCUI 3BZCA 4XKCA 2P4WA 2WTEA 1Y1WJ 1G3TA 1RNLA 4RGXA 3HSRA 4ON0A 3ZMSA 2X6YA 2HOTA 5J40A 4IF4A 3LQRA 4M3EA 1YFHA 5F1JA 4BJ6C 2QSGX 3PSFA 2RGVA 4J00A 2CFXA 2CW0F 2W84A 3GTGJ 2WWYA 3HOZJ 3LA2A 2G7HA 3ZMUA 1YE9A 2H6CA 3CP8A 2BBYA 3OYCA 2ESNA 2PMHA 2J5PA 4G6DA 3H35A 4N9IA 1H88C 2DA3A 1OR7A 3CCJI 1GVDA 4M3BA 1YO5C 2RNJA 5M3MJ 2ID6A 4OWRB 1N78A 2OCCH 2Z3YA 3BLYA 4I01A 4XONA 3LSJA 5HLIA 1PUFB 4KN4X 3T8TA 2XKPA 2EINH 2E1CA 2QBYA 3DF8A 1GDTA 3LMMA 5F0CA 5F1RA 2QSFX 2H94A 4M9XA 1X19A 1G3SA 4JX5A 1AOYA 5HS8A 4JOMA 3NQOA 3HPGA 2VE8A 4B44A 1IV6A 3FXKA 2OCEA 4YIRX 2VOOA 5LEJA 1K6YA 2LSOA 2VASA 3HYIA 4OIQF 5DD8A 3SJMA 1IC8A 3FXRA 1GUUA 1D0XA 1YIJI 3G2BA 1E3HA 3BWGA 3F6OA 3FHNA 2JZYA 2ITJA 5JLXA 3P7NA 4LIFA 3M8FA 4G9YA 5K1YA 5C3EJ 1ZG3A 3K0LA 3I0TA 2DOEA 2OV7A 2O3FA 1K78A 4JX4A 3CMMA 3S3NA 2YU9J 1R5HA 3OYMA 3ELKA 5ICFA 3QWLA 5HVQC 3DKXA 1X1AA 2TBDA 3C7JA 2OPTA 1SFUA 3AG3H 2O0YA 1B6AA 4BBRJ 1D5VA 2RV8A 1MMDA 3HEFA 1UAAA 2F5FA 1LVKA 2EIMH 1WJCA 4LLNA 2D2WA 1ONVA 3RKXA 3P9CA 3WGIA 3I4MJ 5LHHA 1XSVA 2DA7A 2HGCA 3MKYB 4KIGA 3O8HA 1XDSA 1T0FC 2V9PA 3ROUA 1IN4A 3JSOA 2BXYA 1I5ZA 2P81A 4YEJA 1SD6A 3RQIA 3OYGA 3JRHA 3LA3A 1MZBA 5DD4A 3M3YJ 3WE2A 1HOMA 2G0EA 2ELHA 2KRHA 3FXUA 3JAMK 1HKTA 2DTZA 3BR5A 2L3DA 2PEXA 1UCRA 2R7RA 3J7AO 4FGNA 2ACJA 3HUGB 2OZ6A 3KLNA 2GXBA 3K4NA 2HTSA 1BC8C 1RESA 3K1PA 4JX6A 4GCVA 4UUVA 1OFCX 1ZGAA 5BPIA 3S17J 1V5GA 2PJRB 1BL0A 1OYIA 3GMEA 1SVLA 1BI2A 3H36A 3RCOA 3ZN1A 3HL2A 4L0YB 2CQXA 1QHGA 3BR2A 2XGEA 3K4CA 4KYWA 3M8JA 2KJBA 4U87A 2ZJPF 1BI0A 2H1LA 1YRNA 3ABKH 2F5CA 4B3AA 4DYQA 2ZMEC 4WXCA 4H0EA 2WY7Q 4CH7A 1PJRA 3QYBA 2Y2ZA 3M7GA 3DTEA 3G1OA 3P9IA 2ZXIA 4R8HA 2IXSA 2QEXI 4M73A 2BHZA 3WGHA 1LJ9A 4E7ZA 3L1PA 2JQ7A 5FKNA 5ERIA 4EM2A 3OYLA 1RUNA 2DBBA 4RM3A 1J09A 2BE5F 3S15J 1P6RA 3K4MA 1DU0A 3KP4A 3HM5A 3CCMI 1B8IA 1IG7A 1F4KA 3BCBA 3ZXSA 4OAZA 4I2OA 1XGMA 2HW0A 2FOWA 4LOCA 3FMQA 4M6XA 4XRFA 2JMWA 2XVCA 2L02A 1VF9A 2HR3A 2VBXA 2IS4A 3GZ5A 1ON1A 3K2ZA 1WJFA 5D5VB 3HKZA 2MLKA 1VQNI 2R3SA 2HNHA 1R9TJ 2R7VA 3AFHA 3IKTA 1N75A 4XSZF 3SYTA 4JBAA 4O3MA 5E8IA 5HS7A 3SDBA 1JKOC 3DLAA 4XN3A 1JUPA 2H6BA 5TGTA 2UZKA 4BU2A 1E3OC 1ETXA 3HOSA 5FLXK 1TBDA 2PN6A 4Q4ZF 3MKZA 4B43A 3TOBA 3TQNA 2E5ZA 2OTLI 3R60A 3FX3A 3MZ8A 2KDOA 3P9KA 4XOPA 4Z6YA 2Q1ZB 1W36D 4BY7J 1TNSA 1V5EA 3G71I 3CD6I 1J2XA 1FP1D 3S3MA 2GA2A 2VJ5A 4IHTA 2WBMA 1YJ9I 2LF7A 3FK7A 2MG4A 3IRRA 1SFEA 3OV8A 2OJED 1KU2A 2HYGD 1I39A 5FROA 2I5UA 1AKHA 2XAHA 1S6LA 5JVTA 1CQTA 5A2QZ 5EEGA 1JT6A 3K70D 2L9NA 3JRFA 3FXOA 5DEQA 3PNVA 5FKOA 1KQ8A 4KIFA 1P7IA 3DV8A 1LE8A 1A35A 4EM1A 1Z67A 2KQRA 5IY5H 3ZOBA 1XGOA 2OQGA 4ZZLA 1N77A 2DT5A 5E3NA 4XQFA 1EF4A 4XRSA 4CYCA 1I6HJ 3RYPA 4IJAA 3M9AA 3QOPA 5J4VA 2CV0A 1KYZA 1IDYA 2V6EA 4FCYA 2IPQX 3RPUA 3NEUA 1IRGA 4XLHA 4NBPA 2QKMB 3IH2A 5LFAA 4L18B 3DWLE 3Q0WA 4BQOA 2HOEA 4FB3A 5AONA 1G4DA 1SD7A 4BL0B 3RPUD 5HDNA 2WV0A 2XB0X 2JPCA 2ECCA 3TBIA 1GT0C 1R4MB 4HF2A 3PFIA 1SMTA 1JKPC 1BR1A 2KRFA 1YJWI 4AU7A 2ZMEB 3WG7H
chains in the Genus database with same CATH topology
3DPUA 3D5RC 4XM3A 2UWMA 1JI8A 1S9HA 3NWTA 2CV1A 3KEYA 1WJ5A 4C30A 4H4KC 3W2VA 3SEZA 2DCEA 4RM2A 4CA0A 2V1NA 5HLTA 3ZR8X 2KP6A 2XAUA 2XSJC 3H5AA 2DJIA 2CH0A 3H9JA 1WJEA 3OYNA 2W7NA 3EUAA 4NNJA 1DGRM 1MMNA 3OIQA 2BOLA 4DBRA 4B48A 4YRVA 3C2GA 2R7XA 4AVZA 3S32A 3DU6A 3OL3A 4E7JA 1OR7C 2VB6A 3QYEA 4CCLA 4ITVA 4DJAA 5FRNA 1VZ0A 4CCMA 3U21A 4ZYAA 4U7BA 4ZTJA 1GLNA 4GRIA 3BCAA 4BEHB 2V7FA 2VQGA 2IGNA 4KT6A 2JA2A 1D1CA 4N4NB 4CUGA 2IS2A 2VJJA 3H9QA 2R4GA 1ZELA 2VQHA 3VSLA 2CW7A 3OYJA 4QPQA 1D1BA 2MYSA 4ZQ9A 2WAEA 1SAUA 3VSKA 5BYGA 2IS1A 3CZ6A 4PFPA 2Q2EB 3VDXA 1UG0A 4D1QA 2VKDA 3H5NA 3LSMA 2MFZA 3DQVC 3OR2C 3RTRA 2OC6A 3I9V2 4BE0A 3QFQA 2MD0A 2LBFB 4RMNA 1ERDA 2VIXA 1X1DA 3RQ4A 3OIPA 4BS9A 1X4PA 2CV2A 2R7UA 4FASD 2HPMA 2JVGA 4LIUA 2L9SA 4F93B 3OYAA 1W36C 4II2A 1Z21A 3TL4X 3ZGKA 1UELB 3OYFA 2UUZA 4BE1A 2KPMA 4XLCA 3ZRGA 1BR4A 2E60A 2HZDA 3DTIA 4BEHA 2XF6A 2KMUA 2MC4A 2X1DA 4B3XA 2NTCA 3CP2A 3FKJA 4PSXA 3ONQA 2GOMA 3K70C 2HQAA 4LIVA 5JHFA 2IPRA 3C2HA 4XNFA 1HA8A 3OYIA 3SZGA 3KX2A 1LFPA 4HG2A 4NUBA 1E0EA 4II3A 1LKXA 1T95A 4DBQA 2M4GA 3LSHA 3MD2A 4F52A 1OLTA 4BDYA 2JUGA 3DU5A 1YX3A 1Z7LA 3OYHA 4CCNA 3SEQA 4HPQA 1LDKB 1Z1DB 2E1MB 3OYBA 3CESA 3CF2A 4CCJA 1UUTA 3ZQQA 3BG6A 1KONA 2KRCA 2PMZA 1NG6A 3AL0C 1BR2A 4N4OB 1Y56A 2FUFA 5CKTA 4F92B 4HSTA 2A6TA 2VL8A 5CYNA 4BUPA 4E7IA 3FBNB 3CJQB 4XLFA 1V5FA 2VLAA 2VPLA 4XKVA 3LSKA 5CPRB 3QODA 4RLQA 4ZJZA 2KZVA 4XL9A 2LC2A 2LG4A 4XR6A 2X6XA 4PJJA 3V42A 2R7SA 4XLAA 2ZXHA 3IAS2 4XN0A 3HG9A 3RSNA 3A2KA 2V26A 2BVMA 2CS3A 2X6WA 4ZDPA 2LY1A 4BQQA 4B47A 3I3LA 4HEA2 4HSRA 2XDVA 3H9GA 3K4JA 5KNLA 2M7BA 2L2OA 1MNEA 3PSIA 2JVHA 2M4KA 4ZO0A 3NWSA 3OMYA 3A1YA 2I8DA 2BW3B 4YELA 3OYKA 4XKCA 1L2MA 2X6YA 4PJLA 4BDZA 3AKZA 2NOJB 5KHDA 4CCOA 4BJ6C 2CW8A 3PSFA 4J00A 4IX7A 3UR3C 2LY2A 2O5RA 1YE9A 3CP8A 3E1SA 3IAM2 4PJMA 4EATA 3OYCA 2XF7A 3H35A 4PFOA 2F4IA 2DT7B 2Z1DA 3N05A 3S93A 4FETA 2NL8A 4C2TA 2V4JC 3VWBA 1N78A 4OWRB 3K6GA 4Y4RA 3BLYA 4E6KG 2HVQA 2V9KA 2X85A 2XF5A 1TZLA 3QYFA 2UV1A 2X51A 4XONA 3W3CA 4D9JA 4AYBA 2MABA 4J01A 3MMYB 2LRDA 1WJDA 1M55A 1DQUA 2W1OA 5HNHA 3LMMA 3VYUB 3OWTA 2R7TA 4HNUA 2Z2SB 2X1EA 1X19A 2VJ4A 4ZC3A 2M3AA 1RZ9A 1U0JA 2AQEA 2HVSA 3D5LA 2WB1A 4JOMA 1DGWY 4IQJA 1Z3XA 3HPGA 4E7HA 4B44A 3EPZA 4XLEA 1K6YA 2HDWA 2VASA 4NQWB 2VQLA 4XOTA 3MKWB 3LL7A 1WJBA 4E7LA 1X4OA 1D0XA 4C2UA 3G2BA 1WJAA 3FHNA 4BE2A 3IP4B 4P5OA 4Y33A 3L2RA 2ITJA 2VJIA 1KSXA 4LIFA 4KJZA 2LYCA 1D0ZA 3PJRA 5D9IA 2OV7A 2LBFA 2WY8Q 3AL0B 3CMMA 4IQ4A 3S8PA 3S3NA 3OYMA 3A4CA 2E5NA 4BXFA 5HVQC 3DKXA 2CUJA 1X1AA 2TBDA 3OY9A 2DT6A 3EUKL 2GOXB 2W82A 4LITA 3LFUA 3DKYA 1FMWA 2L7KA 2W00A 4PSWA 4F55A 1Y6IA 1UAAA 1MMDA 1FMVA 2FUG2 1LVKA 4BJ5C 1WJCA 2F5VA 2BVLA 3CJRB 1PYVA 3L2WA 3MKYB 2ZSIB 4RLFA 4E7KA 1T0FC 1MMGA 4DGWB 5CQEA 2CUZA 3OOUA 4ZTFA 2RREA 4KW3A 1X1BA 3L2QA 4YEJA 4F3QA 2RQQA 3OYGA 5LD2C 2X1CA 3GBGA 2F6CA 2KRHA 3K4LA 3HOTA 2Z16A 3H5RA 2IS6A 2QKLB 2R7RA 4FGNA 2CMPA 3HUGB 3TMOA 2VXDA 3K4NA 4BACA 3PFYA 2IF9A 2ELJA 4IKFA 2WAQA 3PNYA 3L2VA 1MW7A 2ZFUA 1SFKA 2WA0A 1V5GA 2WADA 4P1WA 4BJTA 2PJRB 4R79A 2WAFA 4PK4A 3RCOA 3K4BA 4E4HA 3HL2A 3QK2A 4CCKA 3OYEA 1QHGA 4PUSA 3EUHC 3K4CA 5FRMA 3M8JA 4U87A 3VYTB 4LMDA 3OR1C 3OS1A 2CFOA 2ITLA 1DP3A 3FDYA 2WY7Q 4CH7A 1PJRA 3QYBA 3KYLA 1QU3A 4XKBA 3DTKA 4CZCA 4E7SA 3DTEA 3ZCOA 2ZXIA 2XC7A 1D0YA 2IXSA 4E7ZA 1EA3A 3FBIB 2VQCA 4LG3A 3OYLA 3OS2A 3M1CA 4ZDLA 4ANJA 2LREA 4RM3A 1J09A 2R7QA 2DXIA 3J7AY 1L5IA 2LOOA 4BQNA 3K4MA 4C9YA 4X0GA 3BC8A 3DPTA 2AQFA 5HNFA 1R9WA 3BCBA 2M0MA 1TT0A 4GDFA 1YX5A 3ZXSA 2KL4A 4OAZA 2PJRA 3S3OA 2HW0A 2VKHA 3PL8A 1AA7A 4ZDOA 4DOZA 2LH9A 2K5CA 1F08A 2KHMA 2HU9A 4Y3OA 2BW3A 2KLOA 2M7AA 3IUOA 3LSGA 2IS4A 1WJFA 3HKZA 4PJNA 4KITB 1G8XA 2RNGA 2HNHA 4CSWA 3OL4A 5HOOA 2R7VA 3AFHA 1N75A 3W2WA 3SYTA 1IRXA 3OYDA 2IGMA 1R6RA 4XORA 2K3PA 3SDBA 3DLAA 4XN3A 3F9KA 1D1AA 3K10A 5TGTA 4BU2A 1X1CA 2R7WA 3HC7A 2R7OA 2Y0SA 4OAYA 3HOSA 1KSYA 2K9LA 2ZSHB 4BGDA 1TBDA 3LSIA 2K9MA 3MKZA 2DOAA 4B43A 3BG7A 2E5ZA 3VYSB 2VXZA 2KDOA 4XOPA 1NG7A 2Q1ZB 1W36D 4IZZA 1V5EA 1WFXA 3QOEA 3S3MA 2VJ5A 2P0WA 2WBMA 1MNDA 3OS0A 4KISA 3PUBA 3UNGC 5KCMA 5FROA 1QHHD 2L5QA 4QPOA 2JSPA 3DPLC 4NC7A 3K70D 2L9NA 3PNVA 3E0JB 3H0DA 2IGKA 3DEEA 4XKWA 4G6TB 2KQRA 5CQGA 4NC8A 1BOBA 5DCXA 1Z3YA 2HVRA 1N77A 4XQFA 3D5SC 4F91B 3PNTA 4DIQA 2HPIA 2A5WA 1P9QC 3VYRB 3HPHA 2CV0A 2V6EA 2W4SA 2OUMA 3L2UA 3HXLA 4JQFA 4XLHA 4NBPA 2QKMB 4MLOA 5LFAA 3DWLE 1G59A 4BQOA 4FB3A 4BL0B 3RPUD 3TBIA 4HRIA 3K4KA 4HNTA 3W2AA 1BR1A 4XMYA 3QN2A 4AU7A 1MMAA 2E1MC 2IGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKY A;  3DKX A;  4U87 A; 
#chains in the Genus database with same CATH topology
 2COM A;  4HX4 A;  3FM5 A;  1WJ5 A;  5D4S A;  5J4Y A;  5FB2 A;  4PJ0 C;  3LST A;  2OZU A;  5IP7 J;  1ZRD A;  3S2D J;  2YU3 A;  4B4C A;  1ZH5 A;  4Y52 J;  3SEZ A;  4J19 A;  3CCR I;  2IBD A;  1U9N A;  1SFX A;  5TJJ A;  5E3L A;  2KP6 A;  2CYY A;  4HOB A;  1FBS A;  2XSJ C;  2EFP A;  3H5A A;  3KE2 A;  2E2H J;  2E7X A;  3MAJ A;  2E2J J;  2DMP A;  4I09 A;  5DCF A;  2B7E A;  1XSX A;  1R23 A;  4B48 A;  4YRV A;  1VFC A;  3B02 A;  1X58 A;  3LA7 A;  1Z91 A;  3KZY A;  2ZB9 A;  2ZBK A;  5J1R A;  4E7J A;  1ULY A;  4XLN F;  1HW1 A;  1R1V A;  1EJ9 A;  2B63 J;  1ETQ A;  5LRS A;  3S1Q J;  2ZC2 A;  1O3T A;  2HI3 A;  1MBK A;  2A5Y B;  3DP7 A;  1VZ0 A;  4CCM A;  4DJA A;  4QTR A;  4U7B A;  2EFW A;  5FRN A;  4ZTJ A;  1O3R A;  4XK4 A;  2DQL A;  3BCA A;  4BEH B;  2V7F A;  2JA8 J;  1D1C A;  1JTX A;  1G3Y A;  3CQZ J;  1FNN A;  4I0A A;  3ZMT A;  4HA8 A;  4M3D A;  3DKW A;  3OYJ A;  2QZ8 A;  2WAE A;  2CQQ A;  5TRD A;  3R0A A;  3WTV C;  2K3F A;  3H3U A;  1VQ8 I;  4KMU X;  1QZY A;  4FX0 A;  1ZTR A;  2QLZ A;  3OR2 C;  3I9V 2;  5B1B H;  2IJL A;  3T0Y A;  3GUD A;  3O6B B;  1XN7 A;  2NVX J;  4KFC A;  3HRS A;  1FZP B;  3OIP A;  2VKE A;  3AG2 H;  5DYM A;  4Q48 A;  1IZ1 A;  2M45 A;  4II2 A;  2BXZ A;  2UUZ A;  3FF5 A;  2VT2 A;  3HBL A;  5GAH J;  5LRR A;  2P5K A;  4MQV A;  3GFL A;  2E60 A;  2IA0 A;  3DTI A;  2XF6 A;  3K1M A;  1A6I A;  2KMU A;  3HSF A;  3IH3 A;  4B3X A;  2P8T A;  2KDZ A;  2GOM A;  2HQA A;  2M2E A;  2IPR A;  2MC3 A;  4OOI A;  1IW7 F;  3S2W A;  3SZG A;  4NUB A;  1MD0 A;  2YS9 A;  3GTO J;  1LKX A;  2BGC A;  1ENH A;  1VQ6 I;  2M4G A;  3MD2 A;  4BDY A;  1BN5 A;  5CLS A;  4IPA A;  1WRJ A;  2JJ7 A;  3A0H C;  1C0W A;  1T39 A;  3SEQ A;  1LDK B;  2KFD A;  2PG4 A;  5EEA A;  3CF2 A;  3TDU C;  3CCE I;  2OA4 A;  1I3A A;  2D1V A;  1X1P A;  2HDD A;  2KRC A;  1EH7 A;  2PMZ A;  2W48 A;  1BR2 A;  5J8C A;  5LGN A;  1UJ8 A;  2X9D A;  5CKT A;  2LK2 A;  4HST A;  2PMU A;  4RDU A;  3N97 A;  3ASO H;  4XLF A;  3HJE A;  1ITY A;  5E1W A;  4K2E A;  2KIF A;  4UV8 A;  1FWZ A;  2VLA A;  1MSE C;  3TDZ C;  4BHB A;  5CPR B;  2LC2 A;  2Y0S N;  3Q0U A;  3GVA A;  5IP6 A;  3RSN A;  2BV6 A;  1SAN A;  4OIN F;  2V26 A;  3WTS C;  2EIJ H;  5K5O A;  5L3D A;  4ZDP A;  1FYM A;  1UHW A;  4A3J J;  1DP7 P;  4HSR A;  3CMA I;  1JUM A;  1K6O A;  3JRG A;  2RN7 A;  1QVU A;  4MFD A;  3PSI A;  1VQ4 I;  1X3W B;  1E2X A;  1YOV B;  1W0T A;  3V8J A;  1O3S A;  3A1Y A;  3BY6 A;  1KU7 A;  2BW3 B;  3KCC A;  3LAP A;  4GGG A;  4D0P A;  3O3K A;  4PJL A;  4XID A;  1FBU A;  4RGS A;  2CQ7 A;  3AKZ A;  1S7E A;  2NOJ B;  4WF2 A;  3E6M A;  4LG0 B;  4FTH A;  4IX7 A;  3DXJ F;  2JRM A;  2JUC A;  1QPI A;  4D5F A;  1XMA A;  2MH9 A;  1H89 C;  3FHZ A;  4PJM A;  4PFO A;  3QAH A;  2DT7 B;  2R92 J;  3N05 A;  2PJP A;  1WH5 A;  3FMR A;  4BHP A;  4QWQ A;  1MJB A;  5EGO A;  2NS7 A;  1UB9 A;  4E6K G;  2BZT A;  3W3C A;  2X51 A;  1T33 A;  4KIB A;  3MMY B;  1Z05 A;  4LK1 F;  2UXN A;  2W1O A;  5HNH A;  3BTC A;  3TKY A;  3OWT A;  3C1D A;  4DZJ A;  3PO3 J;  4DZP A;  4HNU A;  2Z2S B;  2R7T A;  2VJ4 A;  4ZC3 A;  2TCT A;  1RZ9 A;  2LKP A;  2WC2 A;  1HKS A;  2AQE A;  3DBL B;  2HVS A;  2WB1 A;  3D5L A;  1F43 A;  2F5E A;  1WKM A;  1SD4 A;  2L9R A;  4I99 C;  1BW6 A;  2DK5 A;  3ISP A;  5D5X B;  1UMQ A;  2HDW A;  2QCO A;  1FOY A;  4XOT A;  1DPU A;  1S5L C;  3PM1 A;  3MKW B;  3JRB A;  1YW7 A;  2UXX A;  3WTU C;  4E7L A;  1B9M A;  2LR8 A;  4C2U A;  2LNB A;  1FYL A;  4BE2 A;  1Z6T A;  2ZCW A;  2DFF A;  2VJI A;  3V7S A;  2L01 A;  4KJZ A;  2XB5 A;  3REO A;  4D7M A;  4DQ2 A;  1D0Z A;  2FBI A;  1ETW A;  5FFZ A;  4XRM A;  5D9I A;  1ZN2 A;  3VPR A;  3S8P A;  2NS8 A;  1PUF A;  3A4C A;  3SQN A;  2E5N A;  2XSD C;  3KP7 A;  3OY9 A;  2DT6 A;  1SC7 A;  2GOX B;  4G12 A;  3LAJ A;  3BJ6 A;  1D5Y A;  4LIT A;  1NHA A;  5E79 C;  1FMW A;  2W00 A;  1IN6 A;  2ZNY A;  4A2U A;  2BEO A;  4W1U A;  3F3X A;  1FMV A;  1M1E B;  1U5T C;  4A0X A;  4BJ5 C;  3RKQ A;  4C3I J;  2BY1 A;  1ZG1 A;  2FNA A;  1PYV A;  4EEF G;  3L2W A;  1MDM B;  3AAF A;  1K83 J;  5GP9 A;  1P4X A;  4MHG A;  4DGW B;  5CQE A;  2CUZ A;  4FX4 A;  4IHS A;  4ZTF A;  4HLY A;  3L2Q A;  3RKW A;  3WE3 A;  5LEK A;  2DLL A;  1H8A C;  2X1C A;  3GBG A;  1FIA A;  2DYR H;  5CVV A;  3K4L A;  2IS6 A;  2CMP A;  4KUM A;  4MQ9 F;  1P4W A;  4P55 A;  3PFY A;  2IF9 A;  2ELJ A;  2WAQ A;  3ZPL A;  4RB3 C;  3U2R A;  4AVP A;  3F8F A;  4BJT A;  1MMS A;  1TQP A;  4LD5 A;  4ENN A;  2RC4 A;  3ABU A;  1ACI A;  3ZMZ A;  1LDJ A;  3TO6 A;  4GXO A;  5TIS C;  1VQ9 I;  4BNC A;  4M74 A;  3T8R A;  3OR1 C;  1JJ6 C;  1A5J A;  2ADU A;  3Q5F A;  2CFO A;  2ITL A;  4AC0 A;  3WU1 B;  4RB0 A;  3TOA A;  2K7L A;  2EWN A;  5HDG A;  2O8K A;  1FOX A;  1EA3 A;  2VON A;  2CQK A;  2FQ3 A;  4HQE A;  1IXR C;  1R5I D;  2VQC A;  2FNP A;  4HV6 A;  4P96 A;  1VI0 A;  2QVO A;  3M1C A;  4ZDL A;  4S05 A;  3CDH A;  1YIT I;  3HUG A;  1FP2 A;  3J7A Y;  3CCY A;  2LOO A;  1CF7 B;  3JSP A;  2IA1 A;  1XGN A;  3J81 K;  1OCT C;  1R9W A;  2M0M A;  3BR1 A;  4GDF A;  3IWZ A;  5KK1 A;  3E5X A;  2XGD A;  3GF2 A;  2PJR A;  5BPD A;  3ECO A;  4DOZ A;  2FE3 A;  4UUS A;  2K5C A;  2HU9 A;  1J75 A;  1PUE E;  2IAI A;  3G1M A;  3IUO A;  2O9L A;  1QZZ A;  1MBG A;  3JTH A;  4KIT B;  1G8X A;  5K7Z A;  3OL4 A;  4Q47 A;  2M8G X;  5AIP A;  2DO7 A;  4IRI A;  1FSH A;  1T38 A;  5E18 F;  2FX0 A;  2GQQ A;  3LQQ A;  2K3P A;  2P7C B;  3K10 A;  3A01 B;  3PUF A;  1HW5 A;  1IN7 A;  3TP3 A;  5C4J J;  2H8W A;  3GFJ A;  3GZ6 A;  4OAY A;  2RVC A;  4AWX B;  3EYY A;  3V8K A;  2K9M A;  2R5Y B;  1DDN A;  1TLH B;  2OAZ A;  3KFW X;  5J1Y A;  3VYS B;  1V55 H;  4KNY A;  2VXZ A;  3IL2 A;  3GTQ J;  2PBI A;  1NG7 A;  3DEU A;  4IZZ A;  1U5T B;  3QPT A;  4RB2 C;  4A3E J;  2ZJQ F;  2P0W A;  2YPR A;  5CVJ A;  5L3C A;  2LMD A;  2EZL A;  3QQA A;  2K02 A;  2NOG A;  2MSY A;  2GLO A;  4ENK A;  2WV1 A;  1QHH D;  2HZT A;  3CDL A;  1H9T A;  2L5Q A;  1FEX A;  3HHG A;  1F1Z A;  4N0B A;  1XMK A;  4NC7 A;  5B66 C;  5JLW A;  1OPC A;  1TW3 A;  3H0D A;  4XKW A;  4NQW A;  1QVT A;  5DCM B;  2NVT J;  2Y75 A;  4G6T B;  5CQG A;  2FSW A;  2ESH A;  3RIR A;  3IV5 A;  1BOB A;  2E71 A;  3FM3 A;  2DDA A;  1Z3Y A;  3OIO A;  5H20 A;  3BG9 A;  4AYB N;  4IHV A;  1TW2 A;  4LB5 A;  4O6J A;  2F4O B;  2HPI A;  1TWC J;  2A5W A;  4Y15 A;  2OQR A;  4B1R A;  1USS A;  3GTJ J;  2RDP A;  3FWE A;  1PVE A;  2FQ4 A;  5GTI C;  1SFO J;  1TWG J;  2LDU A;  2EA4 A;  5IYB J;  3VEP A;  3S2H J;  4AM3 A;  3K69 A;  3F6V A;  4GYI A;  3K4K A;  3W2A A;  1R1U A;  3ZQ7 A;  2QF7 A;  4HNV A;  2VN2 A;  3ABT A;  1F5T A;  1PDN C;  4XM3 A;  1UST A;  1T0F A;  4LMY A;  4IXA A;  2CV1 A;  3IKV A;  3S16 J;  2Z9O A;  1YQA A;  2XGX A;  3ML6 A;  3W2V A;  4WXH A;  3FXQ A;  2V1N A;  2JT1 A;  1MH4 A;  2DJI A;  1XCB A;  1ODD A;  2JN6 A;  3SZP A;  3OIQ A;  2M8E A;  2BY3 A;  2HFH A;  2BOL A;  1JGG A;  4MEX F;  4DBR A;  2HS5 A;  5F6F A;  1PP7 U;  2CWE A;  4AVZ A;  1W5S A;  3M07 A;  3S32 A;  3OL3 A;  4Y17 A;  1MH3 A;  1MBF A;  2VB6 A;  4EJT A;  4BBS J;  3MQ0 A;  4CCL A;  4ITV A;  1X2M A;  3LNQ A;  3CCL I;  2DPD A;  2QQ8 A;  1I1G A;  1XDU A;  4A3D J;  3L9F A;  1GLN A;  1MBE A;  2ZME A;  1A36 A;  4NC6 A;  4WCG A;  2EB7 A;  3QP5 A;  4KT6 A;  1QGP A;  2JA2 A;  1TC3 C;  4N4N B;  4QIW N;  2NAZ A;  5DM7 F;  2LLK A;  2R4G A;  3J80 K;  1U8B A;  2CW7 A;  4QPQ A;  5ILU A;  3GFI A;  1SAU A;  5KAI C;  5BYG A;  5DUK A;  2IS1 A;  1PP8 F;  5EZG A;  2Q2E B;  1UG0 A;  4PDK A;  2B9S A;  4U0V A;  4ABZ A;  2MFZ A;  3DQV C;  5EDN A;  2OC6 A;  1KGS A;  3BT9 A;  4IL6 C;  3F21 A;  4BE0 A;  4A3G J;  1Z77 A;  3ECH A;  2VIX A;  1S3J A;  3RQ4 A;  5ICG A;  3GLX A;  1O3Q A;  4EJV A;  5F08 A;  2YR2 A;  1R58 A;  2JVG A;  3L7W A;  4LIU A;  1U8R A;  4OIP F;  3L09 A;  2DU9 A;  2L7Z A;  2COB A;  4OMY A;  1OIS A;  3HGY A;  1QPM A;  3OYA A;  3JRA A;  3UKG A;  1W36 C;  2M5W A;  2GBY A;  1O7F A;  1XD7 A;  3HDD A;  4BE1 A;  4G7H F;  3MZY A;  1ZR2 A;  1I6X A;  1B72 B;  3CCV I;  5E3O A;  2VT3 A;  2HZD A;  4BEH A;  3KYC B;  2DTR A;  3IWF A;  2D45 A;  5D6F A;  1QBJ A;  2CSO A;  3CP2 A;  2FD5 A;  2EQR A;  1VQO I;  4FQG A;  3U1K A;  1HKQ A;  3Q3S A;  3J7Y J;  3K70 C;  5JHF A;  1ZKG A;  2ZNZ A;  3ASN H;  1KU3 A;  4M72 A;  5LHG A;  3QP6 A;  5H2F C;  3CCQ I;  1GV5 A;  1WQ2 A;  3KX2 A;  3GYH X;  4II3 A;  3RI4 A;  4M3F A;  1WSU A;  2MGQ A;  2QYO A;  4RGR A;  4BKX A;  5LLQ A;  4XIC A;  1ZG5 A;  3CJT B;  1TP4 A;  5BNG A;  4LLL A;  4DYC A;  4M71 A;  1BJA A;  2E36 A;  1S7A A;  3ABM H;  3DU5 A;  5FD5 A;  3VFZ A;  5ICE A;  1IGN A;  3OYH A;  1MBJ A;  1D8J A;  4E70 A;  4CGZ A;  2DAO A;  4WWC A;  2B0L A;  4HPQ A;  2Y48 A;  1HDP A;  1Z1D B;  4CCJ A;  4ESF A;  2YUS A;  1LFU P;  1IXS B;  5E17 F;  3BG6 A;  2MH2 A;  1KON A;  2DA2 A;  1I50 J;  5DM6 F;  4ZYD A;  3KET A;  1YHQ I;  1A31 A;  1NG6 A;  3AL0 C;  5K5Q A;  1TQI A;  4N4O B;  4PGG A;  3FXL A;  4F92 B;  1S7O A;  1P2F A;  3H92 A;  1JKR C;  4BUP A;  4A3M J;  4BXU A;  3FBN B;  3DBH B;  2K40 A;  3CJQ B;  2EFN A;  1OCZ H;  1HW2 A;  5ILS A;  2VPL A;  2IA2 A;  2LVS A;  1V54 H;  3CMY A;  3S1N J;  4D7N A;  4RAG A;  2KZV A;  2LG4 A;  5IOY A;  1JHF A;  4I7H A;  4L5E A;  3LSP A;  4PJJ A;  1U3E M;  3NAR A;  4FHT A;  3IAS 2;  4XN0 A;  2IEK A;  1YIO A;  4EM0 B;  5M5X J;  1GVJ A;  4ENM A;  4OIR F;  3LSR A;  5BQT A;  2VUM J;  1WI9 A;  3K4J A;  5HOD A;  1P4A A;  2L2O A;  1MNE A;  1J9I A;  1R22 A;  1XMX A;  2ID3 A;  4ZO0 A;  4KT5 C;  3OMY A;  1IJW C;  5B1A H;  3G6E I;  2P5L C;  1G6N A;  2H1K A;  5DS9 A;  4A3K J;  4DNC A;  2I8D A;  1LUJ B;  2MD5 A;  3VOD A;  3GTP J;  2LD5 A;  1IN5 A;  3I53 A;  5DTD A;  1Z7U A;  2HOA A;  1RKW A;  3KEO A;  4BDZ A;  5KHD A;  2DI3 A;  4UHT A;  1LQ1 A;  2HYF A;  1HF0 A;  4Q5S F;  1L0O C;  2AXL A;  3F8B A;  3ZMV A;  4HYE A;  4A5M A;  5H6Q A;  4EAT A;  1RC9 A;  2EIL H;  2XF7 A;  2AO9 A;  2DDB A;  2K9Q A;  2F4I A;  3AG4 H;  3CLO A;  3K1N A;  3RDI A;  2JWT A;  3S93 A;  4FET A;  2NL8 A;  1YYV A;  2PMZ N;  3VWB A;  1J7K A;  4Y4R A;  4V19 K;  5JR3 A;  5GPC A;  2HVQ A;  2V9K A;  2W25 A;  2X85 A;  1TZL A;  2RQP A;  2UV1 A;  3QYF A;  4RS8 A;  5JHU A;  3SFI A;  2VOP A;  2MAB A;  4J01 A;  2E35 A;  3MKL A;  1WJD A;  4IVN A;  5B5E C;  2NRA C;  3KLO A;  5KAF C;  5J1U A;  1OKR A;  1HQC A;  1HBX G;  4CZZ A;  4ESB A;  3JW4 A;  4YFX F;  3P5J A;  1U0J A;  3B73 A;  5JI6 A;  1IO2 A;  1DGW Y;  4UXN A;  4ESJ A;  2STW A;  4A0Z A;  4E7H A;  2W57 A;  2JA7 J;  1YS6 A;  4XLE A;  2V1X A;  3NAU A;  2VQL A;  4LG0 A;  2EZK A;  4A0Y A;  5GAE J;  3LL7 A;  3ZQC A;  2H09 A;  3CDI A;  2EPF A;  4CHU A;  1YW9 A;  3V7R A;  1WJA A;  4IOC F;  3A0B C;  3IP4 B;  5LBQ A;  4Y33 A;  2KIQ A;  1RPW A;  3FXM A;  1MSF C;  4D5C A;  1KSX A;  3H3V K;  4UB6 C;  2LYC A;  5KVR A;  1KYW A;  3PJR A;  3H0G J;  2BY2 A;  2DYS H;  5EEH A;  3JR9 A;  1FY7 A;  4QLC U;  2FA5 A;  2LBF A;  4EMS A;  1T98 A;  3AL0 B;  3ESW B;  4HBL A;  5FFX A;  2ELK A;  2CUJ A;  4NBQ A;  2V79 A;  4V2G A;  2HDC A;  3LFU A;  2ISY A;  1IN8 A;  2QQB A;  1EKE A;  4UB8 C;  3CME I;  2L7K A;  4IO9 F;  4WXD A;  2KIM A;  3ERE D;  3FK6 A;  1RKT A;  4F55 A;  2LKX A;  2A6E F;  1Y6I A;  3DFG A;  3BZ6 A;  2R5Z B;  2FUG 2;  1NH3 A;  3MWM A;  2F5V A;  3WTW C;  1WGX A;  3VOE A;  2Y9Z A;  2BVL A;  2FF4 A;  5LGU A;  2E2I J;  2YX4 A;  2NXN B;  3CUO A;  3ERM A;  3CUQ C;  2PFB A;  2JPB A;  2ZSI B;  5JFR A;  1MGT A;  1E3P A;  4E7K A;  3QRF F;  4UVB A;  1MMG A;  5CVR A;  5E20 A;  1A6Q A;  2EIK H;  3WTX C;  4MTE A;  2STT A;  4DW6 A;  3RJP A;  2RRE A;  2Q8K A;  4KW3 A;  4F3Q A;  5LD2 C;  2DA5 A;  4Y7N J;  4C2M J;  2A69 F;  4CXF A;  3GWZ A;  1ON2 A;  2F6C A;  2WB1 N;  1WZ2 A;  2Z16 A;  4KIC A;  3RKY A;  2VBY A;  4BXX J;  3KP2 A;  4RA2 A;  3I54 A;  1MIJ A;  4BAC A;  4IKF A;  4ZH4 F;  5GTH C;  2L54 A;  3J7Z I;  4U0W A;  3ZQG A;  2YX7 A;  5EG0 B;  4R79 A;  5HLH A;  4PK4 A;  4E4H A;  3K4B A;  1FJL A;  2ZJ2 A;  3KZI C;  5A2Q K;  3OYE A;  3E97 A;  3EUH C;  1QNT A;  2EFO A;  3MCZ A;  4PUS A;  4A6D A;  1XGS A;  1YLF A;  4LMD A;  2OTJ I;  3OS1 A;  3W6V A;  4MO7 A;  2K4J A;  4XSX F;  1DP3 A;  5IT9 K;  1JXS A;  4A3B J;  2Y9Y A;  1MDM A;  5IPA A;  3GEZ A;  1QU3 A;  3O2P E;  3KYL A;  1VQ7 I;  4XKB A;  1ETK A;  3I58 A;  3DTK A;  4UVA A;  3F8C A;  2GAU A;  4CZC A;  3ZCO A;  4M3G A;  4HX8 A;  1K61 A;  3IHU A;  3GFM A;  1ZRC A;  3I59 B;  1XCV A;  2M34 A;  4P9U A;  1FT9 A;  3E6D A;  3FBI B;  5D6E A;  1F9N A;  2LFB A;  1GXQ A;  3OS2 A;  1WPK A;  1Z6R A;  2LRE A;  1IXC A;  2DOD A;  2R7Q A;  3A02 A;  5FKK A;  4AD9 A;  2O8X A;  2RKH A;  2DXI A;  5IYD J;  4C9Y A;  1L5I A;  2CUE A;  3DPT A;  3WTZ A;  5EYR A;  4YFN F;  5HNF A;  3BJA A;  1TT0 A;  2XUB A;  2NVQ J;  4BAY A;  2XAJ A;  1TWA J;  2CUF A;  3I56 I;  4ZDO A;  2LH9 A;  4ZZD A;  4Y3O A;  3HGG A;  5C44 J;  3CO6 C;  3CC2 I;  6PAX A;  3RZD J;  2P6T A;  4PJN A;  2RNG A;  1T08 B;  1KA8 A;  5HOO A;  2EFQ A;  5IOZ A;  2L7F P;  3W2W A;  2E1O A;  3V8L A;  3F22 A;  4EJU A;  2O03 A;  2IGM A;  2EH3 A;  4AIK A;  1R6R A;  2F2E A;  2VC1 A;  4LK0 F;  3F9K A;  1KU9 A;  3GTK J;  4G7Z F;  2WAQ N;  2EBI A;  2R7O A;  2Y0S A;  1BJZ A;  1KSY A;  2FBH A;  1S29 A;  2MBF A;  2ZSH B;  3QPL A;  5FKM A;  1T6S A;  3LSI A;  1FSE A;  2VBW A;  3ZQH A;  3MFK A;  3BTL A;  2DOA A;  3BG7 A;  3JAM Z;  1CF7 A;  3G1L A;  3ZQL A;  2E19 A;  4ENJ A;  2XGC A;  2JK3 A;  1GV2 A;  3DCF A;  1MND A;  5JVG F;  3OS0 A;  3CUQ B;  4IRH A;  3TW7 A;  2E7W A;  4HV5 A;  4JK1 X;  1WCM J;  3UNG C;  2R0Q C;  1EV7 A;  3FZV A;  2H27 A;  5KCM A;  4FE7 A;  4GYG A;  2ECB A;  4QPO A;  3QU3 A;  4KA4 A;  1XS9 A;  1NK2 P;  1VQL I;  3GTL J;  1BM9 A;  3EYI A;  3L2C A;  4RBO A;  1L3L A;  3E0J B;  1BI3 A;  1IV8 A;  1FPQ A;  4AID A;  3QU6 A;  1R71 A;  5HDK A;  1Q1V A;  2DFE A;  3A01 A;  3PNT A;  3ZN0 A;  1JGS A;  1HXD A;  2IVM A;  3VYR B;  3NRV A;  4C3J J;  5EF6 A;  2R7D A;  1K4S A;  1XC5 A;  2A61 A;  1JTY A;  2R5Y A;  1ZHF A;  4X1E A;  3HXL A;  4JQF A;  5IT3 A;  1S72 I;  4FE4 A;  5CVU A;  4MLO A;  2Y31 A;  4ZYH A;  3CJN A;  1U5T A;  2DQR A;  4G7O F;  2MW8 A;  3WU2 C;  2FML A;  3GW2 A;  2HQN A;  1ZRF A;  3I4N J;  4L9T A;  2EZH A;  4HNT A;  1ZGJ A;  1F36 A;  3PQK A;  2IGO A;  2IRF G;  3DPU A;  3D5R C;  2UWM A;  2VC0 A;  3BTJ A;  3NWT A;  3KEY A;  3TGN A;  1ZYR F;  2AHQ A;  1DUX C;  1FOW A;  2DOF A;  3SHF A;  1LVA A;  2DCE A;  5ED4 A;  4NHJ A;  5DCM A;  1NK3 P;  4CA0 A;  5HLT A;  3ZR8 X;  1VQK I;  1STZ A;  1D8K A;  3BJO A;  2XAU A;  1R36 A;  3H9J A;  1ZGW A;  3HTU A;  2W7N A;  1IUF A;  1DPR A;  2EV0 A;  3EUA A;  4NNJ A;  5CJ9 A;  1RUO A;  3GLL A;  1MMN A;  3FXJ A;  3SXY A;  1FTT A;  1TQM A;  1ZLJ A;  3C2G A;  2EJR A;  5FLX Z;  2NVU B;  2R7X A;  4U88 A;  3QPS A;  5GPA A;  3DU6 A;  1OR7 C;  3GXO A;  3QYE A;  4HF0 A;  1U2W A;  3QPH A;  2JSC A;  2L7M P;  3U21 A;  4ZYA A;  1RET A;  3ULQ B;  2VQG A;  2HXI A;  1UHS A;  2IW5 A;  4CUG A;  2E1N A;  2TRT A;  2ICW G;  3ABL H;  4S0H B;  3E3V A;  4O5V A;  2XAF A;  1ZEL A;  3DBR B;  2HYJ A;  3VSL A;  4IHX A;  1ZAR A;  4M6V A;  4C3H J;  2J5O A;  1D1B A;  2MYS A;  3VSK A;  3HHH A;  3CZ6 A;  4PFP A;  3VDX A;  3MN2 A;  1MBH A;  4M9S A;  3LSM A;  2QGU A;  3RTR A;  2OU2 A;  5F27 A;  4U7D A;  2PQ8 A;  1ERD A;  2M30 A;  1UG2 A;  1X1D A;  2DFH A;  3GTM J;  1R7J A;  4BS9 A;  2HPM A;  1Y1V J;  4QSH A;  4AIJ A;  1W7P B;  3ZGK A;  1UEL B;  2CG4 A;  3WG9 A;  2VOD A;  4B09 A;  2NYX A;  2P6S A;  2L4M A;  2QQA A;  1IAW A;  4IHW A;  4XLC A;  1RRJ A;  3ZRG A;  2ETH A;  2DMU A;  1HDD C;  1BR4 A;  4LB6 B;  3TED A;  2MC4 A;  3FMS A;  1SMY F;  3KP3 A;  2NTC A;  2VKV A;  2DJN A;  4PSX A;  2O7O A;  3N4M A;  2GZW A;  3I55 I;  2FMY A;  3F72 A;  4CDG A;  3C2H A;  1HA8 A;  3OYI A;  4WX9 A;  1WHU A;  1LFP A;  2Q2E A;  4HG2 A;  2X4H A;  1SAX A;  1B4A A;  4DBQ A;  3LSH A;  3HOX J;  3R61 A;  4F52 A;  1W4M A;  5GAG J;  4YG2 F;  2QUF A;  2XKO A;  1VQ5 I;  2JUG A;  1TWH J;  1YX3 A;  1Z7L A;  1MNM C;  4I98 B;  4EV0 A;  1JJ8 C;  1YW8 A;  1KZH A;  4RAZ A;  1Y0N A;  2G9W A;  1Y8R B;  2XIG A;  4CCN A;  4A69 C;  2K4B A;  1KQ9 A;  3OYB A;  3ZP5 A;  3WOD F;  1LEA A;  1IF1 A;  1CGP A;  1QA6 A;  1BC7 C;  1XG1 A;  3OSF A;  4PZJ A;  1OCC H;  1ORK A;  1ZK8 A;  5FLV A;  1I3Q J;  1B72 A;  4HF1 A;  3HKZ N;  3BOQ A;  4BQA A;  2CGP A;  3RZO J;  5CYN A;  3GO5 A;  2Y69 H;  1OJL A;  4LFU A;  4E7I A;  5ICC A;  5DUI A;  1ETV A;  1T8I A;  1I27 A;  2NS0 A;  3BG3 A;  3G4S I;  1XSD A;  3CC4 I;  4XKV A;  3W6K B;  4S04 A;  1AHD P;  1B9N A;  3QOD A;  4RLQ A;  4HW0 A;  1ZRE A;  1FTZ A;  2M0C A;  4A12 A;  1FBQ A;  1X2N A;  1OYY A;  3HIF A;  4JP0 A;  3HOU J;  1B1B A;  3LOC A;  3MVP A;  1G3W A;  5J47 A;  2BVM A;  2CS3 A;  1KQ0 A;  2X6W A;  2LY1 A;  3HRT A;  4MGR A;  4BQQ A;  4B47 A;  3T1B A;  2LF8 A;  1LB2 A;  1FYK A;  5FGM A;  4HLX A;  3E6C C;  2XDV A;  3H9G A;  1BI1 A;  1ZQ3 P;  1Z1D A;  4LJZ F;  5KNL A;  2FBK A;  3FKI J;  1R00 A;  2OBP A;  5FKL A;  2QBY B;  4A3C J;  2DMT A;  2ME0 A;  2A07 F;  2EA2 A;  3NWS A;  4UUS B;  4IRG A;  1HC8 A;  1J5Y A;  4FT8 A;  2CRG A;  4L9J A;  3OYK A;  2BHY A;  3TW6 A;  1L2M A;  3HZJ A;  5C4X J;  3IH4 A;  3KZZ A;  1B59 A;  1Z0X A;  5D5W B;  2QEN A;  3W6J B;  2ZXJ A;  4CCO A;  2CW8 A;  2Z99 A;  4ASN A;  3CCS I;  3UR3 C;  2BYV E;  2LY2 A;  2O5R A;  3HOV J;  3WU0 A;  3E1S A;  3IAM 2;  3SDG A;  1O4X A;  4L0Z B;  9ANT A;  5L3B A;  3HB9 A;  3H1C A;  2Z1D A;  3ZQI A;  1BIB A;  1HCR A;  1UZC A;  3KIO A;  2V4J C;  4C2T A;  3K6G A;  2XF5 A;  2RAE A;  4D9J A;  1BIA A;  2VBZ A;  3BR0 A;  4AYB A;  2QA4 I;  1K78 B;  2EV6 A;  2LRD A;  3F0C A;  1M55 A;  1DQU A;  2K9N A;  5M5W J;  4GO1 A;  3VYU B;  5DDG A;  1V3F A;  2X1E A;  3KYD B;  1WWX A;  1TWF J;  5ILV A;  5FLM J;  2IP2 A;  2M3A A;  3FIS A;  1YS7 A;  3A03 A;  4IQJ A;  4AIH A;  1Z3X A;  1R5G A;  2ISZ A;  3CO7 C;  1I1S A;  5M5Y J;  1WH7 A;  3EPZ A;  3IC7 A;  4IOA F;  4BY1 J;  3K9T A;  4NQW B;  2XV4 S;  3WTT C;  3HTS B;  2XPV A;  4EJW A;  1BOA A;  1WJB A;  1X4O A;  5HS9 A;  4HX7 A;  1SVM A;  4GFB A;  1RR8 C;  1GXP A;  2DA1 A;  1O57 A;  1W5C C;  4P5O A;  3L2R A;  2C6Y A;  2GXG A;  3B6A A;  2Z5U A;  3HSE A;  5E8G A;  1W5T A;  5L3G A;  4WK8 F;  4A3I J;  1U78 A;  3O8G A;  1VTN C;  3JRI A;  1X3U A;  3I5U A;  2WY8 Q;  2F5D A;  2KJC A;  4IQ4 A;  1XTA A;  3BQZ A;  2ZKZ A;  2ZXW H;  3H3Z A;  4BXF A;  5J3L A;  5L3E A;  5DV5 A;  4EVI A;  3EUK L;  1W0U A;  2W82 A;  5FJ8 J;  3BZK A;  3LFK A;  3R0J A;  2NNY A;  2DA4 A;  2V6C A;  3S1M J;  3DKY A;  2TDX A;  4PSW A;  2HOS A;  1R1T A;  3COA C;  4RGU A;  5HLG A;  4PCQ A;  2HKO A;  3SZT A;  5K5R A;  1OQY A;  3Q0V A;  4I02 A;  3EQL F;  5IT9 Z;  3CJR B;  1YRN B;  1IDZ A;  1J59 A;  1EH8 A;  2G7U A;  1OYW A;  5E1X A;  4RLF A;  5BMZ A;  4Z2Y A;  2QQ9 A;  1DU6 A;  3M1E A;  3OOU A;  2D5V A;  1X1B A;  3DLL F;  3OOP A;  2NNN A;  1X3Z B;  2RQQ A;  1N25 A;  3I4P A;  1T2K A;  2VPR A;  3D1N I;  1K79 A;  1XPX A;  1RI7 A;  2E34 A;  5K7H A;  3WTY C;  5J6X A;  1FIP A;  1WI3 A;  4MNU A;  3BPX A;  3HOT A;  3H5R A;  3TO7 A;  5LHI A;  3RPQ A;  2QKL B;  4UV9 A;  3TMO A;  2VXD A;  4CO8 A;  4OMZ A;  1LEB A;  4F7Z A;  4Y13 A;  1RR7 A;  2DMN A;  4EGY A;  1B8I B;  5E1Z B;  3PNY A;  3L2V A;  1MW7 A;  2EK5 A;  2ZFU A;  1SFK A;  2LTP A;  2WA0 A;  2WAD A;  2X6O A;  4P1W A;  3V4G A;  4A6E A;  2R93 J;  2WAF A;  2LY9 A;  3K2A A;  3HRM A;  1D3Y A;  2ZJR F;  2R5Z A;  3QK2 A;  4CCK A;  3D0S A;  5FRM A;  5B3S H;  3IRQ A;  3VYT B;  3G73 A;  1ZR4 A;  2HKX A;  4EJO A;  4L5J A;  2V1U A;  3HRU A;  2DK8 A;  1ETO A;  3E5Q A;  3FDY A;  3WHC A;  2DFI A;  1Y8Q B;  3E5U A;  2HEO A;  4A5N A;  2CU7 A;  4E7S A;  1HST A;  4P9F A;  2XC7 A;  2L9V A;  1D0Y A;  3C3W A;  5M3F J;  4LLG F;  5F0F A;  1IRZ A;  2FU4 A;  3F23 A;  2R7Z J;  3KP6 A;  4LG3 A;  1ZLK A;  1O7L A;  1QRY A;  2PX9 A;  4ANJ A;  1FLI A;  4G8X A;  2JA6 J;  4OIO F;  2QSH X;  5F0H A;  4BQN A;  4X0G A;  2R7F A;  1BW5 A;  3BC8 A;  4HQM A;  2AS5 F;  2A6H F;  2AQF A;  1YX5 A;  2KL4 A;  2XRL A;  3BP8 A;  1LNW A;  5EG0 A;  3S3O A;  5K7F A;  2M1B A;  2FRH A;  2VKH A;  3PL8 A;  2VE9 A;  1AA7 A;  3CC7 I;  1JHH A;  1U6G A;  2MLG A;  2KIU A;  2KKO A;  1F08 A;  2KHM A;  3EET A;  1YJN I;  2GWR A;  3BR3 A;  2M87 A;  2BW3 A;  2KLO A;  2M7A A;  3LSG A;  3U1D A;  1AKH B;  1R4N B;  1W1W E;  1UHM A;  3BPV A;  4XRS G;  1SEU A;  1AWC A;  2LKS A;  4CSW A;  2XRN A;  1HLV A;  2FEZ A;  5GAD J;  5IP9 J;  2XPU A;  3F8N A;  1JT0 A;  2I10 A;  4NDL A;  1IRX A;  3OYD A;  1LE8 B;  4UY8 I;  1VQP I;  4XOR A;  2D1H A;  1D1A A;  1QO0 D;  3I59 A;  2H8R A;  1X1C A;  2R7W A;  4CYC B;  3HC7 A;  1JKQ C;  2K9L A;  1TT5 B;  4BGD A;  5H6R A;  1H9G A;  3RYR A;  1BA5 A;  2N8G A;  4A3F J;  1YI2 I;  2V1D A;  2XAQ A;  4JYK A;  4V2F A;  3OSG A;  3HOY J;  4AUX A;  2A68 F;  3PIO F;  1OCR H;  2K27 A;  2K9S A;  3C2B A;  1POG A;  1WFX A;  4I76 A;  4ZYE A;  2EZI A;  1VQM I;  3JRD A;  4UUT A;  3QOE A;  3BQY A;  2YSR A;  2CO5 A;  4EQQ A;  2O6G E;  4KIS A;  3PUB A;  1U9O A;  4L9V A;  3E7L A;  2HQ5 A;  4DYR A;  1OMI A;  3GZN B;  5BS6 A;  3M8E A;  2JRT A;  4HAM A;  4HZF A;  4CYD A;  3Q9V A;  2JSP A;  2XRO A;  3DPL C;  1AU7 A;  4MEY F;  1H0M A;  1XB4 A;  3E6B A;  3F8M A;  4IHY A;  2Y0M A;  2IGK A;  3DEE A;  1MJA A;  4NC8 A;  4MTD A;  3LWF A;  1TTY A;  3S1R J;  5DCX A;  2HVR A;  4G94 A;  3AG1 H;  3D5S C;  3TO9 A;  4F91 B;  1IRF A;  3BTI A;  4B8X A;  4DIQ A;  1J0R A;  2ME6 A;  2QWW A;  1P9Q C;  2NVY J;  1Y0U A;  3HPH A;  2DA6 A;  5E3M A;  2V9V A;  4BYY A;  2W4S A;  2KIS A;  1G2H A;  2OUM A;  3L2U A;  3C18 A;  2Z33 A;  4KDP A;  2GXA A;  3R6S A;  1G59 A;  3T5X A;  3I71 A;  3MZH A;  1IUY A;  4HRI A;  3TP0 A;  3KP5 A;  3SFZ A;  3J81 Z;  4MIM A;  4XMY A;  1K7A A;  3CUQ A;  3QN2 A;  5CYV A;  1MMA A;  2E1M C;  4N9H A;  4KMF A;  3FIW A;  5IYC J;  1JI8 A;  1S9H A;  2DPU A;  1NTC A;  2FXA A;  1A04 A;  4C30 A;  4H4K C;  4M6Y A;  2X0L A;  4NB5 A;  4RM2 A;  1TL8 A;  1RZ4 A;  1XX5 A;  2F48 A;  4L5I A;  1RIO H;  4UVC A;  3JRE A;  1HSJ A;  1P7J A;  3BDD A;  2CH0 A;  1WJE A;  2AXT C;  3OYN A;  1ZAO A;  1Y39 A;  1DGR M;  4X6A J;  4XBF A;  2CJJ A;  1Z9C A;  1Q1H A;  1WVR A;  3U9G A;  2PLY A;  3DEW A;  2HWV A;  4RAY A;  2XPW A;  3S14 J;  5D5U B;  2BY0 A;  3EUH A;  1JE8 A;  1REP C;  1VND A;  3KEQ A;  1P92 A;  1YG2 A;  2M9H A;  3HOW J;  1SVO A;  4GRI A;  2IGN A;  4YIF A;  5J8F A;  4IEJ A;  5D4R A;  5EZH A;  1LPQ A;  2P7V B;  3BR6 A;  2IS2 A;  1LDD A;  2VJJ A;  3H9Q A;  5BOX A;  2VQH A;  2DN0 A;  4TV7 A;  4ZQ9 A;  1ETY A;  3ZMD A;  3R4K A;  4U0Y A;  4HDU A;  1E17 A;  3EDP A;  2DW4 A;  2JTV A;  2ZFW A;  4D1Q A;  2VKD A;  3H5N A;  4I0B A;  4A93 J;  3QFQ A;  2MD0 A;  2LBF B;  3M4O J;  4RMN A;  3L00 A;  2L0K A;  2GIV A;  1X4P A;  4CIC A;  2CV2 A;  2R7U A;  4FAS D;  4KN7 X;  5LGT A;  3CTA A;  2KZG A;  4L9N A;  3KPH A;  4PGH A;  2W85 A;  4BH9 A;  1S8N A;  2L9S A;  4F93 B;  4M9Z A;  3X2Q H;  1Z21 A;  3TL4 X;  5D8K B;  2XAG A;  3PIP F;  4FIS A;  5AIQ A;  2PI0 A;  3OYF A;  3I64 A;  4MFE A;  2IT0 A;  2VI6 A;  2KPM A;  5F04 A;  3JCU C;  4HDV A;  3JTG A;  2JA5 J;  1GHC A;  2A05 A;  2X1D A;  5D8L B;  4EGZ A;  1TBX A;  3FKJ A;  4G6Q A;  2KT0 A;  3ONQ A;  4LIV A;  2LP0 A;  4I6Z A;  5FO5 A;  2GM4 A;  4XNF A;  2GIZ A;  1V4R A;  1FX7 A;  1E0E A;  1K4T A;  1R49 A;  2XHK A;  2CQN A;  1T95 A;  1FC3 A;  1FOK A;  5FD6 A;  1QZE A;  1OLT A;  1JUS A;  2A3S A;  2K86 A;  2OF7 A;  1MKM A;  2O61 A;  1T56 A;  4XLP F;  2Y30 A;  3VB2 A;  2E1M B;  1W7P A;  3CES A;  1UUT A;  1BBY A;  3JRC A;  3ZQQ A;  3GX4 X;  3BRO A;  2FJ1 A;  3GCM A;  3B6C A;  1W7P D;  4YFK F;  4ZYG A;  1Y56 A;  1UFM A;  3Q9S A;  4R1H A;  3V7C A;  2FUF A;  2HXO A;  2W24 A;  4ETS A;  2A6T A;  2VL8 A;  3K7A J;  4YII A;  2Q0O A;  2F4M B;  1OCO H;  3ZQF A;  3CF5 F;  2L4A A;  3CLQ A;  1SD5 A;  4OU0 A;  1V5F A;  2GA1 A;  2DMQ A;  3G3Z A;  5L3F A;  3LSK A;  4ZJZ A;  3J80 Z;  3MEX A;  5F64 A;  4RB1 A;  1YTY A;  4XL9 A;  2HTJ A;  2ZO4 A;  4XR6 A;  2X6X A;  4A3L J;  2OD5 A;  3V42 A;  4XLA A;  2ZXH A;  2R7S A;  3HG9 A;  3A2K A;  1APL C;  3PO2 J;  2FOK A;  2EV5 A;  1OCP A;  3PQJ A;  2XAS A;  5EGO B;  3I3L A;  4HEA 2;  3WGG A;  1QQI A;  1EH6 A;  2X48 A;  4LGW A;  1TNT A;  2M7B A;  2K85 A;  1LFB A;  2HQR A;  5EJC A;  4UNO A;  2JVH A;  2M4K A;  3WHB A;  2QM3 A;  5CVI A;  4RAF A;  2P5V A;  4BHC A;  1MJ9 A;  2MA3 A;  4YEL A;  4W97 A;  3BG5 A;  3CCU I;  3BZC A;  4XKC A;  2P4W A;  2WTE A;  1Y1W J;  1G3T A;  1RNL A;  4RGX A;  3HSR A;  4ON0 A;  3ZMS A;  2X6Y A;  2HOT A;  5J40 A;  4IF4 A;  3LQR A;  4M3E A;  1YFH A;  5F1J A;  4BJ6 C;  2QSG X;  3PSF A;  2RGV A;  4J00 A;  2CFX A;  2CW0 F;  2W84 A;  3GTG J;  2WWY A;  3HOZ J;  3LA2 A;  2G7H A;  3ZMU A;  1YE9 A;  2H6C A;  3CP8 A;  2BBY A;  3OYC A;  2ESN A;  2PMH A;  2J5P A;  4G6D A;  3H35 A;  4N9I A;  1H88 C;  2DA3 A;  1OR7 A;  3CCJ I;  1GVD A;  4M3B A;  1YO5 C;  2RNJ A;  5M3M J;  2ID6 A;  4OWR B;  1N78 A;  2OCC H;  2Z3Y A;  3BLY A;  4I01 A;  4XON A;  3LSJ A;  5HLI A;  1PUF B;  4KN4 X;  3T8T A;  2XKP A;  2EIN H;  2E1C A;  2QBY A;  3DF8 A;  1GDT A;  3LMM A;  5F0C A;  5F1R A;  2QSF X;  2H94 A;  4M9X A;  1X19 A;  1G3S A;  4JX5 A;  1AOY A;  5HS8 A;  4JOM A;  3NQO A;  3HPG A;  2VE8 A;  4B44 A;  1IV6 A;  3FXK A;  2OCE A;  4YIR X;  2VOO A;  5LEJ A;  1K6Y A;  2LSO A;  2VAS A;  3HYI A;  4OIQ F;  5DD8 A;  3SJM A;  1IC8 A;  3FXR A;  1GUU A;  1D0X A;  1YIJ I;  3G2B A;  1E3H A;  3BWG A;  3F6O A;  3FHN A;  2JZY A;  2ITJ A;  5JLX A;  3P7N A;  4LIF A;  3M8F A;  4G9Y A;  5K1Y A;  5C3E J;  1ZG3 A;  3K0L A;  3I0T A;  2DOE A;  2OV7 A;  2O3F A;  1K78 A;  4JX4 A;  3CMM A;  3S3N A;  2YU9 J;  1R5H A;  3OYM A;  3ELK A;  5ICF A;  3QWL A;  5HVQ C;  3DKX A;  1X1A A;  2TBD A;  3C7J A;  2OPT A;  1SFU A;  3AG3 H;  2O0Y A;  1B6A A;  4BBR J;  1D5V A;  2RV8 A;  1MMD A;  3HEF A;  1UAA A;  2F5F A;  1LVK A;  2EIM H;  1WJC A;  4LLN A;  2D2W A;  1ONV A;  3RKX A;  3P9C A;  3WGI A;  3I4M J;  5LHH A;  1XSV A;  2DA7 A;  2HGC A;  3MKY B;  4KIG A;  3O8H A;  1XDS A;  1T0F C;  2V9P A;  3ROU A;  1IN4 A;  3JSO A;  2BXY A;  1I5Z A;  2P81 A;  4YEJ A;  1SD6 A;  3RQI A;  3OYG A;  3JRH A;  3LA3 A;  1MZB A;  5DD4 A;  3M3Y J;  3WE2 A;  1HOM A;  2G0E A;  2ELH A;  2KRH A;  3FXU A;  3JAM K;  1HKT A;  2DTZ A;  3BR5 A;  2L3D A;  2PEX A;  1UCR A;  2R7R A;  3J7A O;  4FGN A;  2ACJ A;  3HUG B;  2OZ6 A;  3KLN A;  2GXB A;  3K4N A;  2HTS A;  1BC8 C;  1RES A;  3K1P A;  4JX6 A;  4GCV A;  4UUV A;  1OFC X;  1ZGA A;  5BPI A;  3S17 J;  1V5G A;  2PJR B;  1BL0 A;  1OYI A;  3GME A;  1SVL A;  1BI2 A;  3H36 A;  3RCO A;  3ZN1 A;  3HL2 A;  4L0Y B;  2CQX A;  1QHG A;  3BR2 A;  2XGE A;  3K4C A;  4KYW A;  3M8J A;  2KJB A;  4U87 A;  2ZJP F;  1BI0 A;  2H1L A;  1YRN A;  3ABK H;  2F5C A;  4B3A A;  4DYQ A;  2ZME C;  4WXC A;  4H0E A;  2WY7 Q;  4CH7 A;  1PJR A;  3QYB A;  2Y2Z A;  3M7G A;  3DTE A;  3G1O A;  3P9I A;  2ZXI A;  4R8H A;  2IXS A;  2QEX I;  4M73 A;  2BHZ A;  3WGH A;  1LJ9 A;  4E7Z A;  3L1P A;  2JQ7 A;  5FKN A;  5ERI A;  4EM2 A;  3OYL A;  1RUN A;  2DBB A;  4RM3 A;  1J09 A;  2BE5 F;  3S15 J;  1P6R A;  3K4M A;  1DU0 A;  3KP4 A;  3HM5 A;  3CCM I;  1B8I A;  1IG7 A;  1F4K A;  3BCB A;  3ZXS A;  4OAZ A;  4I2O A;  1XGM A;  2HW0 A;  2FOW A;  4LOC A;  3FMQ A;  4M6X A;  4XRF A;  2JMW A;  2XVC A;  2L02 A;  1VF9 A;  2HR3 A;  2VBX A;  2IS4 A;  3GZ5 A;  1ON1 A;  3K2Z A;  1WJF A;  5D5V B;  3HKZ A;  2MLK A;  1VQN I;  2R3S A;  2HNH A;  1R9T J;  2R7V A;  3AFH A;  3IKT A;  1N75 A;  4XSZ F;  3SYT A;  4JBA A;  4O3M A;  5E8I A;  5HS7 A;  3SDB A;  1JKO C;  3DLA A;  4XN3 A;  1JUP A;  2H6B A;  5TGT A;  2UZK A;  4BU2 A;  1E3O C;  1ETX A;  3HOS A;  5FLX K;  1TBD A;  2PN6 A;  4Q4Z F;  3MKZ A;  4B43 A;  3TOB A;  3TQN A;  2E5Z A;  2OTL I;  3R60 A;  3FX3 A;  3MZ8 A;  2KDO A;  3P9K A;  4XOP A;  4Z6Y A;  2Q1Z B;  1W36 D;  4BY7 J;  1TNS A;  1V5E A;  3G71 I;  3CD6 I;  1J2X A;  1FP1 D;  3S3M A;  2GA2 A;  2VJ5 A;  4IHT A;  2WBM A;  1YJ9 I;  2LF7 A;  3FK7 A;  2MG4 A;  3IRR A;  1SFE A;  3OV8 A;  2OJE D;  1KU2 A;  2HYG D;  1I39 A;  5FRO A;  2I5U A;  1AKH A;  2XAH A;  1S6L A;  5JVT A;  1CQT A;  5A2Q Z;  5EEG A;  1JT6 A;  3K70 D;  2L9N A;  3JRF A;  3FXO A;  5DEQ A;  3PNV A;  5FKO A;  1KQ8 A;  4KIF A;  1P7I A;  3DV8 A;  1LE8 A;  1A35 A;  4EM1 A;  1Z67 A;  2KQR A;  5IY5 H;  3ZOB A;  1XGO A;  2OQG A;  4ZZL A;  1N77 A;  2DT5 A;  5E3N A;  4XQF A;  1EF4 A;  4XRS A;  4CYC A;  1I6H J;  3RYP A;  4IJA A;  3M9A A;  3QOP A;  5J4V A;  2CV0 A;  1KYZ A;  1IDY A;  2V6E A;  4FCY A;  2IPQ X;  3RPU A;  3NEU A;  1IRG A;  4XLH A;  4NBP A;  2QKM B;  3IH2 A;  5LFA A;  4L18 B;  3DWL E;  3Q0W A;  4BQO A;  2HOE A;  4FB3 A;  5AON A;  1G4D A;  1SD7 A;  4BL0 B;  3RPU D;  5HDN A;  2WV0 A;  2XB0 X;  2JPC A;  2ECC A;  3TBI A;  1GT0 C;  1R4M B;  4HF2 A;  3PFI A;  1SMT A;  1JKP C;  1BR1 A;  2KRF A;  1YJW I;  4AU7 A;  2ZME B;  3WG7 H; 
#chains in the Genus database with same CATH homology
 3DPU A;  3D5R C;  4XM3 A;  2UWM A;  1JI8 A;  1S9H A;  3NWT A;  2CV1 A;  3KEY A;  1WJ5 A;  4C30 A;  4H4K C;  3W2V A;  3SEZ A;  2DCE A;  4RM2 A;  4CA0 A;  2V1N A;  5HLT A;  3ZR8 X;  2KP6 A;  2XAU A;  2XSJ C;  3H5A A;  2DJI A;  2CH0 A;  3H9J A;  1WJE A;  3OYN A;  2W7N A;  3EUA A;  4NNJ A;  1DGR M;  1MMN A;  3OIQ A;  2BOL A;  4DBR A;  4B48 A;  4YRV A;  3C2G A;  2R7X A;  4AVZ A;  3S32 A;  3DU6 A;  3OL3 A;  4E7J A;  1OR7 C;  2VB6 A;  3QYE A;  4CCL A;  4ITV A;  4DJA A;  5FRN A;  1VZ0 A;  4CCM A;  3U21 A;  4ZYA A;  4U7B A;  4ZTJ A;  1GLN A;  4GRI A;  3BCA A;  4BEH B;  2V7F A;  2VQG A;  2IGN A;  4KT6 A;  2JA2 A;  1D1C A;  4N4N B;  4CUG A;  2IS2 A;  2VJJ A;  3H9Q A;  2R4G A;  1ZEL A;  2VQH A;  3VSL A;  2CW7 A;  3OYJ A;  4QPQ A;  1D1B A;  2MYS A;  4ZQ9 A;  2WAE A;  1SAU A;  3VSK A;  5BYG A;  2IS1 A;  3CZ6 A;  4PFP A;  2Q2E B;  3VDX A;  1UG0 A;  4D1Q A;  2VKD A;  3H5N A;  3LSM A;  2MFZ A;  3DQV C;  3OR2 C;  3RTR A;  2OC6 A;  3I9V 2;  4BE0 A;  3QFQ A;  2MD0 A;  2LBF B;  4RMN A;  1ERD A;  2VIX A;  1X1D A;  3RQ4 A;  3OIP A;  4BS9 A;  1X4P A;  2CV2 A;  2R7U A;  4FAS D;  2HPM A;  2JVG A;  4LIU A;  2L9S A;  4F93 B;  3OYA A;  1W36 C;  4II2 A;  1Z21 A;  3TL4 X;  3ZGK A;  1UEL B;  3OYF A;  2UUZ A;  4BE1 A;  2KPM A;  4XLC A;  3ZRG A;  1BR4 A;  2E60 A;  2HZD A;  3DTI A;  4BEH A;  2XF6 A;  2KMU A;  2MC4 A;  2X1D A;  4B3X A;  2NTC A;  3CP2 A;  3FKJ A;  4PSX A;  3ONQ A;  2GOM A;  3K70 C;  2HQA A;  4LIV A;  5JHF A;  2IPR A;  3C2H A;  4XNF A;  1HA8 A;  3OYI A;  3SZG A;  3KX2 A;  1LFP A;  4HG2 A;  4NUB A;  1E0E A;  4II3 A;  1LKX A;  1T95 A;  4DBQ A;  2M4G A;  3LSH A;  3MD2 A;  4F52 A;  1OLT A;  4BDY A;  2JUG A;  3DU5 A;  1YX3 A;  1Z7L A;  3OYH A;  4CCN A;  3SEQ A;  4HPQ A;  1LDK B;  1Z1D B;  2E1M B;  3OYB A;  3CES A;  3CF2 A;  4CCJ A;  1UUT A;  3ZQQ A;  3BG6 A;  1KON A;  2KRC A;  2PMZ A;  1NG6 A;  3AL0 C;  1BR2 A;  4N4O B;  1Y56 A;  2FUF A;  5CKT A;  4F92 B;  4HST A;  2A6T A;  2VL8 A;  5CYN A;  4BUP A;  4E7I A;  3FBN B;  3CJQ B;  4XLF A;  1V5F A;  2VLA A;  2VPL A;  4XKV A;  3LSK A;  5CPR B;  3QOD A;  4RLQ A;  4ZJZ A;  2KZV A;  4XL9 A;  2LC2 A;  2LG4 A;  4XR6 A;  2X6X A;  4PJJ A;  3V42 A;  2R7S A;  4XLA A;  2ZXH A;  3IAS 2;  4XN0 A;  3HG9 A;  3RSN A;  3A2K A;  2V26 A;  2BVM A;  2CS3 A;  2X6W A;  4ZDP A;  2LY1 A;  4BQQ A;  4B47 A;  3I3L A;  4HEA 2;  4HSR A;  2XDV A;  3H9G A;  3K4J A;  5KNL A;  2M7B A;  2L2O A;  1MNE A;  3PSI A;  2JVH A;  2M4K A;  4ZO0 A;  3NWS A;  3OMY A;  3A1Y A;  2I8D A;  2BW3 B;  4YEL A;  3OYK A;  4XKC A;  1L2M A;  2X6Y A;  4PJL A;  4BDZ A;  3AKZ A;  2NOJ B;  5KHD A;  4CCO A;  4BJ6 C;  2CW8 A;  3PSF A;  4J00 A;  4IX7 A;  3UR3 C;  2LY2 A;  2O5R A;  1YE9 A;  3CP8 A;  3E1S A;  3IAM 2;  4PJM A;  4EAT A;  3OYC A;  2XF7 A;  3H35 A;  4PFO A;  2F4I A;  2DT7 B;  2Z1D A;  3N05 A;  3S93 A;  4FET A;  2NL8 A;  4C2T A;  2V4J C;  3VWB A;  1N78 A;  4OWR B;  3K6G A;  4Y4R A;  3BLY A;  4E6K G;  2HVQ A;  2V9K A;  2X85 A;  2XF5 A;  1TZL A;  3QYF A;  2UV1 A;  2X51 A;  4XON A;  3W3C A;  4D9J A;  4AYB A;  2MAB A;  4J01 A;  3MMY B;  2LRD A;  1WJD A;  1M55 A;  1DQU A;  2W1O A;  5HNH A;  3LMM A;  3VYU B;  3OWT A;  2R7T A;  4HNU A;  2Z2S B;  2X1E A;  1X19 A;  2VJ4 A;  4ZC3 A;  2M3A A;  1RZ9 A;  1U0J A;  2AQE A;  2HVS A;  3D5L A;  2WB1 A;  4JOM A;  1DGW Y;  4IQJ A;  1Z3X A;  3HPG A;  4E7H A;  4B44 A;  3EPZ A;  4XLE A;  1K6Y A;  2HDW A;  2VAS A;  4NQW B;  2VQL A;  4XOT A;  3MKW B;  3LL7 A;  1WJB A;  4E7L A;  1X4O A;  1D0X A;  4C2U A;  3G2B A;  1WJA A;  3FHN A;  4BE2 A;  3IP4 B;  4P5O A;  4Y33 A;  3L2R A;  2ITJ A;  2VJI A;  1KSX A;  4LIF A;  4KJZ A;  2LYC A;  1D0Z A;  3PJR A;  5D9I A;  2OV7 A;  2LBF A;  2WY8 Q;  3AL0 B;  3CMM A;  4IQ4 A;  3S8P A;  3S3N A;  3OYM A;  3A4C A;  2E5N A;  4BXF A;  5HVQ C;  3DKX A;  2CUJ A;  1X1A A;  2TBD A;  3OY9 A;  2DT6 A;  3EUK L;  2GOX B;  2W82 A;  4LIT A;  3LFU A;  3DKY A;  1FMW A;  2L7K A;  2W00 A;  4PSW A;  4F55 A;  1Y6I A;  1UAA A;  1MMD A;  1FMV A;  2FUG 2;  1LVK A;  4BJ5 C;  1WJC A;  2F5V A;  2BVL A;  3CJR B;  1PYV A;  3L2W A;  3MKY B;  2ZSI B;  4RLF A;  4E7K A;  1T0F C;  1MMG A;  4DGW B;  5CQE A;  2CUZ A;  3OOU A;  4ZTF A;  2RRE A;  4KW3 A;  1X1B A;  3L2Q A;  4YEJ A;  4F3Q A;  2RQQ A;  3OYG A;  5LD2 C;  2X1C A;  3GBG A;  2F6C A;  2KRH A;  3K4L A;  3HOT A;  2Z16 A;  3H5R A;  2IS6 A;  2QKL B;  2R7R A;  4FGN A;  2CMP A;  3HUG B;  3TMO A;  2VXD A;  3K4N A;  4BAC A;  3PFY A;  2IF9 A;  2ELJ A;  4IKF A;  2WAQ A;  3PNY A;  3L2V A;  1MW7 A;  2ZFU A;  1SFK A;  2WA0 A;  1V5G A;  2WAD A;  4P1W A;  4BJT A;  2PJR B;  4R79 A;  2WAF A;  4PK4 A;  3RCO A;  3K4B A;  4E4H A;  3HL2 A;  3QK2 A;  4CCK A;  3OYE A;  1QHG A;  4PUS A;  3EUH C;  3K4C A;  5FRM A;  3M8J A;  4U87 A;  3VYT B;  4LMD A;  3OR1 C;  3OS1 A;  2CFO A;  2ITL A;  1DP3 A;  3FDY A;  2WY7 Q;  4CH7 A;  1PJR A;  3QYB A;  3KYL A;  1QU3 A;  4XKB A;  3DTK A;  4CZC A;  4E7S A;  3DTE A;  3ZCO A;  2ZXI A;  2XC7 A;  1D0Y A;  2IXS A;  4E7Z A;  1EA3 A;  3FBI B;  2VQC A;  4LG3 A;  3OYL A;  3OS2 A;  3M1C A;  4ZDL A;  4ANJ A;  2LRE A;  4RM3 A;  1J09 A;  2R7Q A;  2DXI A;  3J7A Y;  1L5I A;  2LOO A;  4BQN A;  3K4M A;  4C9Y A;  4X0G A;  3BC8 A;  3DPT A;  2AQF A;  5HNF A;  1R9W A;  3BCB A;  2M0M A;  1TT0 A;  4GDF A;  1YX5 A;  3ZXS A;  2KL4 A;  4OAZ A;  2PJR A;  3S3O A;  2HW0 A;  2VKH A;  3PL8 A;  1AA7 A;  4ZDO A;  4DOZ A;  2LH9 A;  2K5C A;  1F08 A;  2KHM A;  2HU9 A;  4Y3O A;  2BW3 A;  2KLO A;  2M7A A;  3IUO A;  3LSG A;  2IS4 A;  1WJF A;  3HKZ A;  4PJN A;  4KIT B;  1G8X A;  2RNG A;  2HNH A;  4CSW A;  3OL4 A;  5HOO A;  2R7V A;  3AFH A;  1N75 A;  3W2W A;  3SYT A;  1IRX A;  3OYD A;  2IGM A;  1R6R A;  4XOR A;  2K3P A;  3SDB A;  3DLA A;  4XN3 A;  3F9K A;  1D1A A;  3K10 A;  5TGT A;  4BU2 A;  1X1C A;  2R7W A;  3HC7 A;  2R7O A;  2Y0S A;  4OAY A;  3HOS A;  1KSY A;  2K9L A;  2ZSH B;  4BGD A;  1TBD A;  3LSI A;  2K9M A;  3MKZ A;  2DOA A;  4B43 A;  3BG7 A;  2E5Z A;  3VYS B;  2VXZ A;  2KDO A;  4XOP A;  1NG7 A;  2Q1Z B;  1W36 D;  4IZZ A;  1V5E A;  1WFX A;  3QOE A;  3S3M A;  2VJ5 A;  2P0W A;  2WBM A;  1MND A;  3OS0 A;  4KIS A;  3PUB A;  3UNG C;  5KCM A;  5FRO A;  1QHH D;  2L5Q A;  4QPO A;  2JSP A;  3DPL C;  4NC7 A;  3K70 D;  2L9N A;  3PNV A;  3E0J B;  3H0D A;  2IGK A;  3DEE A;  4XKW A;  4G6T B;  2KQR A;  5CQG A;  4NC8 A;  1BOB A;  5DCX A;  1Z3Y A;  2HVR A;  1N77 A;  4XQF A;  3D5S C;  4F91 B;  3PNT A;  4DIQ A;  2HPI A;  2A5W A;  1P9Q C;  3VYR B;  3HPH A;  2CV0 A;  2V6E A;  2W4S A;  2OUM A;  3L2U A;  3HXL A;  4JQF A;  4XLH A;  4NBP A;  2QKM B;  4MLO A;  5LFA A;  3DWL E;  1G59 A;  4BQO A;  4FB3 A;  4BL0 B;  3RPU D;  3TBI A;  4HRI A;  3K4K A;  4HNT A;  3W2A A;  1BR1 A;  4XMY A;  3QN2 A;  4AU7 A;  1MMA A;  2E1M C;  2IGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...