4U87A

Crystal structure of the ba-soaked c2 crystal form of pmv158 replication initiator repb (p3221 space group)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
201
structure length
191
Chain Sequence
KEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHESKDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYDFIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity of RepB, the replication initiator protein of promiscuous streptococcal plasmid pMV158.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Replication
molecule keywords Replication protein RepB
total genus 57
structure length 191
sequence length 201
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01719 Rep_2 Plasmid replication protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1480 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4u87A02
3.40.1310.30 Alpha Beta 3-Layer(aba) Sandwich Replication Protein E1; Chain: A, Replication Protein E1; Chain: A, 4u87A01
3DKXA 3DKYA 4U87A
chains in the Genus database with same CATH superfamily
4ZTFA 1YG2A 3FXUA 2CUZA 2KJCA 3OL4A 3Q5FA 2ID6A 2P4WA 5CVRA 5K5RA 2XROA 3N97A 1A5JA 1BI0A 1XGOA 3DBHB 4OMYA 1A6IA 5LD2C 2P0WA 2KLOA 1BR4A 2V9VA 5TGTA 3ECOA 1KA8A 4M74A 2COBA 3S3OA 1XCBA 4MHGA 4BS9A 2X6OA 1IN6A 1JT6A 1X1DA 5K7HA 1PDNC 4RM2A 5H2FC 3M1EA 1FTTA 1ONVA 4IHSA 3EYIA 2NNNA 3OR2C 1NK2P 1SVOA 1BN5A 3DTKA 1TTYA 4LIVA 1T8IA 1HKSA 4N9IA 2YX7A 1REPC 3L00A 1ETKA 2A5WA 3M9AA 1CQTA 2OJED 2LMDA 4UVCA 1SMYF 1LFUP 4HAMA 1SD5A 2ME6A 3DEUA 1YJNI 4CYCA 3EUAA 4BBSJ 1X1AA 5ILUA 3S1QJ 2JT1A 4LG3A 3HB9A 3BJ6A 1WSUA 3CLQA 1YW9A 2CQ7A 4EJOA 3BTCA 1SAUA 2VLAA 2GIZA 1BOBA 2RNJA 3F6OA 3VOEA 4CXFA 2RKHA 1LE8B 4BXFA 3WE3A 2J5OA 2M4GA 5GP9A 1TW3A 4EGZA 1JJ8C 4E7LA 3S8PA 1Y8QB 1JT0A 4RDUA 1DGWY 3F22A 1RNLA 2PMHA 2Y31A 2HPIA 4H4KC 2FA5A 2UXXA 2L4AA 1XMKA 2FJ1A 3LA2A 4B3AA 1IUFA 4Y4RA 3CESA 2FE3A 1BI1A 2JRMA 3AG4H 4I7HA 3TKYA 3GZ6A 3QU3A 3S2WA 3L2RA 2JMWA 1XDSA 4J00A 2EZKA 1U5TC 2X48A 4PK4A 4FISA 2ZNZA 4EGYA 2W57A 2I5UA 1VFCA 2HYGD 3HTSB 3FISA 4A3FJ 2HXIA 2L2OA 1ODDA 3BDDA 3MQ0A 1MBGA 3ZOBA 3ZQGA 4A0ZA 1ETYA 4I02A 3FHNA 1LDKB 4F3QA 1A04A 1TP4A 3NQOA 1BJAA 4M3BA 4OIQF 1IRXA 2HR3A 1FJLA 1OCTC 4DQ2A 2KHMA 1DP3A 5L3DA 3GX4X 2DQRA 2CRGA 2K7LA 1B59A 3MZYA 2EIMH 2W25A 3TOAA 5GAGJ 2ESHA 1FIPA 4G94A 4IHVA 4OIRF 2K9QA 2GOMA 2VQCA 3DU5A 2XKPA 5IYBJ 2R7FA 4UY8I 1XDUA 1XGMA 3O8HA 5FKMA 1BW6A 3H3UA 5KVRA 2MLGA 1FYKA 5M3FJ 2LREA 5B5EC 2E35A 3HZJA 3LA7A 1F08A 5KHDA 4IHYA 1R9WA 1YS7A 3RKQA 1ZHFA 3E6CC 1PP7U 4BNCA 3MKLA 3CDIA 3FXJA 2PMZA 3ZQHA 2KZVA 2WBMA 3HHHA 4BL0B 1MMSA 4I0BA 4NC8A 5EEGA 3E5QA 5C44J 3WTVC 3BQYA 5D6FA 3TO9A 1W36D 1OFCX 4IF4A 2PLYA 2P6SA 4Q47A 1E3HA 3AL0C 1WJCA 5L3BA 2LLKA 1B8IA 4XIDA 1LJ9A 3RIRA 1RC9A 5LGUA 3SEQA 1G2HA 2VKHA 3B6CA 1LEBA 3KPHA 4XKVA 1FSEA 2LKPA 3VSKA 4HLYA 2DA7A 5DCXA 3O2PE 5AIQA 2DA5A 3V8KA 3FXOA 2IEKA 1TLHB 2NOJB 1K7AA 1T0FA 2ISZA 4PGHA 1F43A 4LLNA 5ILSA 3RYRA 2V1UA 3FXMA 1YW8A 3ML6A 2VL8A 1E2XA 2A3SA 4HOBA 3UR3C 2OU2A 2PMZN 4EM1A 4EM2A 4J01A 3F9KA 1LFBA 3V8LA 2PJPA 3JAMZ 3S2HJ 1FBQA 3U21A 4A0XA 3D5RC 3OSFA 4QIWN 1OISA 1WPKA 2CG4A 3FM3A 2ISYA 1W7PA 4IEJA 2WV1A 4M6VA 1X58A 3E6MA 4YRVA 1MGTA 3F8NA 3W2VA 1VQOI 4UUTA 3P7NA 3S15J 1VTNC 2X9DA 3ESWB 3EYYA 4KW3A 5FLVA 4ZZLA 4Y33A 1IN5A 4Z6YA 3M3YJ 2OQRA 1T08B 1P92A 5BPDA 1LFPA 2HXOA 3U2RA 1MBKA 1YRNB 3ECHA 2KIFA 3ZQIA 4AIJA 2JUCA 3I0TA 5E3OA 1BI2A 2QF7A 4F92B 2M3AA 3RDIA 2CYYA 3RQ4A 4GDFA 1EF4A 3K9TA 5KNLA 2LY1A 3DKXA 1A36A 1HKTA 2UXNA 5LGNA 1E3PA 3BPVA 1R1VA 4AM3A 3IC7A 2XF5A 1VNDA 3SYTA 4G12A 3M8EA 3TP3A 3ZMZA 3CCUI 3CP2A 1XS9A 2QWWA 2Z9OA 2IPQX 2NS0A 3KEOA 5BNGA 1W0UA 1OKRA 4HNTA 2HQRA 3DBRB 1VQKI 4FETA 2QYOA 1FP1D 1AU7A 2Y0SA 3FIWA 1X4PA 2M9HA 3E7LA 5HNFA 1YRNA 1K83J 5ICGA 4F91B 3WG9A 1RR8C 1IG7A 1ZGAA 2W4SA 2MW8A 2CV2A 2KFDA 1P2FA 3PO2J 5J6XA 4IVNA 2OTLI 4CDGA 2YR2A 3O6BB 5E3NA 1I6XA 2X6WA 4LIUA 3BZCA 4UV8A 1QO0D 3BG9A 3FBIB 4OINF 2DPDA 3IWFA 4MQVA 1NG6A 4UUSB 5CLSA 4A3JJ 1BC7C 2F5FA 3GFIA 2DFFA 1HBXG 3WTUC 2LKXA 4BGDA 4B44A 5J4VA 2DQLA 1D3YA 2A61A 2I8DA 3QWLA 1XCVA 3BG6A 4B43A 2MGQA 3BR6A 4IRHA 2GOXB 1GV5A 2Z99A 3DXJF 2JRTA 4NDLA 4HX4A 2VKVA 2GA2A 3ULQB 2BW3B 2ZMEA 1JUSA 2QQBA 4NBPA 2R7XA 4YELA 2XAFA 3QAHA 4RB0A 1WI9A 3ZMDA 4LJZF 2EA2A 2ZO4A 3EDPA 1V5GA 3ZN0A 2R7VA 2PN6A 3MKYB 4HNVA 5A2QK 1ACIA 3HEFA 4GYGA 2YUSA 1D1CA 1S7AA 2HYFA 4O6JA 1MNDA 1YO5C 2LVSA 5JVTA 2CJJA 3U9GA 3BCBA 2DA3A 3JRGA 3QPSA 1R4MB 2ZMEB 1OCZH 2VT3A 5JLXA 3KZYA 3VB2A 2V9KA 1IXCA 2R4GA 4ZO0A 2ZJ2A 2UWMA 5CQEA 1R5GA 4R8HA 4U87A 2RVCA 4ZDLA 5FJ8J 4E7JA 5BPIA 4RAYA 3E6DA 1W4MA 1ZLJA 4C3HJ 4HZFA 2H6CA 4XONA 5K7FA 3SFZA 1LB2A 4XKBA 2MH2A 4JYKA 1OCPA 2M8GX 3WU0A 1UUTA 1PUEE 2MD5A 3FWEA 1N75A 1OR7A 2FX0A 4II2A 3DLLF 4FHTA 3LFKA 5JHFA 4D5FA 4L5EA 3OYAA 5J4YA 1BW5A 5E18F 2KRHA 1FX7A 5J47A 3GLLA 2LNBA 2DOEA 2B7EA 3KEYA 3GW2A 2HPMA 2GLOA 5L3GA 1STZA 2X85A 3GZ5A 2XPVA 3S3MA 1IZ1A 4KN7X 1MJBA 4XLEA 2OCEA 2L7FP 4IRGA 4E70A 4HSRA 1H0MA 4UHTA 1UJ8A 2XHKA 3H9GA 2R7DA 3FX3A 5FB2A 5LFAA 2KRFA 1LDJA 2H94A 2JVHA 2MC3A 3I4PA 3VODA 5A2QZ 1A6QA 4X6AJ 2NVUB 2R7TA 1YTYA 1VQ5I 1ZYRF 4CYDA 3R0AA 2NVTJ 1ON2A 4RB1A 4IX7A 1SFOJ 1N77A 2VONA 1PUFA 5IP6A 1SMTA 2QQAA 1DP7P 1OQYA 1Z3YA 1BL0A 3HPGA 1I39A 4RGSA 2RGVA 1AHDP 5EJCA 1E0EA 2P6TA 3IHUA 4FCYA 3CUQB 3BP8A 1TC3C 4A6EA 4M9SA 2DJNA 2QUFA 2CWEA 1Z67A 4DNCA 1L2MA 1PP8F 4RAZA 3QPTA 3Q3SA 1LVAA 3BR0A 3DPTA 3FXQA 4YIIA 3S32A 2M8EA 3SHFA 3MEXA 4WXHA 5F64A 2HYJA 3IH2A 3TOBA 3FK7A 4AUXA 4HF2A 3T1BA 1O3TA 4MTEA 1Y56A 4A3DJ 4NHJA 3VEPA 4RLFA 3G6EI 4IPAA 4A2UA 5J8FA 3CMAI 1K4TA 1KSXA 4MNUA 5F08A 3ZQLA 3TQNA 1WCMJ 3I5UA 3U1DA 1A31A 3LFUA 2K27A 2D1VA 3VDXA 3Q9VA 4CUGA 2TCTA 2O7OA 2DW4A 3CCMI 5E20A 1KGSA 1IJWC 2EJRA 1HW2A 1ZK8A 3KE2A 1UHSA 3RZDJ 4IQ4A 3OOPA 3BZKA 2EFPA 3PQKA 3H9QA 3OYMA 3OS1A 2BY0A 1HQCA 3LSPA 3EUHC 2L9RA 3PJRA 2HGCA 2KJBA 4B48A 5EF6A 5GADJ 2W00A 4Z2YA 4G7ZF 3RZOJ 5IT9K 1K78B 3VSLA 4AVPA 5HLHA 3SEZA 1QRYA 5AONA 2ZJQF 5FRMA 1ETOA 5D4RA 3W2WA 2ELJA 3O3KA 2QBYB 4ASNA 1LDDA 2DO7A 2KQRA 4X1EA 5F0FA 4ITVA 4XQFA 3PNVA 4L9VA 2H6BA 1BM9A 3D5LA 3DEWA 3OY9A 2KDOA 2VUMJ 1OMIA 3R60A 4WF2A 2R7UA 3C3WA 3HL2A 2NS8A 2VBXA 2XUBA 2KIQA 5CVVA 1JE8A 3B02A 2BOLA 4M72A 1O3QA 1KU7A 3WTTC 3ZP5A 5DTDA 1L3LA 1Z3XA 5DUKA 4A3EJ 1TWAJ 1VQ4I 2JQ7A 3MCZA 3PQJA 4BHPA 1LVKA 5EG0B 1P4AA 4EJVA 2MA3A 1D1AA 2OA4A 5BS6A 4IKFA 4FASD 2W84A 3A02A 5CQGA 5D4SA 3EETA 1Z1DA 1W5CC 4NQWB 1OYYA 4XRSA 4XLCA 4E7SA 1PJRA 1J09A 2VJIA 3NAUA 1R22A 2JWTA 4HG2A 4A3GJ 2P5KA 4PJJA 3T5XA 1Z05A 1DQUA 1FPQA 1WRJA 3M8JA 2M30A 4ON0A 3VPRA 3LSMA 1TQPA 3OYLA 1IN7A 5E3LA 3W6JB 5C4XJ 1HOMA 3GFMA 1MJ9A 3PO3J 4MO7A 1SC7A 2L54A 2K86A 3GTOJ 3ZQQA 3GO5A 2VKDA 3BG7A 4PFOA 2VODA 1B4AA 4RGRA 4OU0A 3IP4B 3OIPA 3NRVA 5EZGA 5DDGA 3CCQI 2W24A 2HTJA 2M34A 1QA6A 1VQ7I 2EFQA 4FQGA 3P9KA 3F72A 4JOMA 2Q1ZB 4BE1A 3J80K 3DWLE 2DPUA 5KCMA 5CPRB 3RSNA 1FP2A 1OYIA 1HLVA 2VOOA 1YI2I 1SAXA 4UVBA 4G9YA 5FROA 4N4NB 3GBGA 1F9NA 2D5VA 4I6ZA 2E2HJ 2XV4S 1UCRA 2B0LA 2IF9A 3CO6C 3LQQA 1MW7A 2KIMA 3J7YJ 3BC8A 5FKKA 5LHGA 5H20A 1HW1A 3L1PA 4EJTA 4L0ZB 2DI3A 4XLNF 3F0CA 4G6QA 3BY6A 5DS9A 2A6EF 5FFZA 4V19K 1CF7A 4DOZA 3HDDA 5CYVA 2STTA 3QYBA 3ABMH 3ABUA 1GUUA 1POGA 1U5TB 1USSA 2ZC2A 3E5XA 3F8CA 2HWVA 3MZ8A 3T8TA 3COAC 3OSGA 3W6VA 5AIPA 2IGOA 2HVRA 1WJAA 2DYRH 1RIOH 4WWCA 4Y17A 5FGMA 1Z21A 5HS9A 4XBFA 2EV5A 2IA0A 1KZHA 3TO6A 1LEAA 3QOPA 4D1QA 3L2CA 2HOAA 1HXDA 2EILH 3BR5A 3FF5A 1EV7A 3GVAA 5DM7F 2A68F 2N8GA 4XL9A 3MN2A 2ZXHA 2O5RA 3WHBA 4XLPF 3D0SA 1ZR2A 2O9LA 2HZTA 2Q0OA 3K1MA 4QSHA 4A69C 1YITI 1C0WA 2CGPA 3PM1A 3ZPLA 3KP6A 1G3TA 2LDUA 1Z1DB 2OPTA 1UHMA 1V3FA 2FU4A 4JQFA 5D5WB 4BACA 3FKIJ 2UZKA 4OIPF 5TISC 2DU9A 2VKEA 1IF1A 1O7LA 1P6RA 3ERMA 1O57A 2X1DA 1G3SA 1G8XA 2FEZA 2BY1A 2JJ7A 3E6BA 2EIJH 4XORA 2JSCA 2STWA 1HKQA 2DODA 3DV8A 3LSIA 4J19A 2RN7A 1QZZA 3HOXJ 4CCKA 1MBFA 1HDPA 2HQNA 3ZMUA 3DPUA 3K6GA 3CCLI 3WTWC 1R36A 1B6AA 3H0DA 2MBFA 4XSZF 5DCFA 2HTSA 4UB8C 2RDPA 5CVIA 2YPRA 3W3CA 4YG2F 4A93J 1RPWA 4DZPA 1K6OA 1K6YA 2K40A 4D0PA 2L7MP 2O8KA 5IT3A 4XN3A 4XRSG 1LPQA 2GZWA 3KP5A 3GTKJ 3HIFA 3IH4A 4C30A 3K70D 4A3LJ 1TQMA 3BZ6A 2VQLA 3HUGB 1DDNA 2VBZA 2HEOA 2ZXIA 4QPOA 2M87A 1XN7A 2WAEA 2RV8A 1SFUA 5IP7J 3GUDA 2RC4A 1Q1VA 4UUSA 2EFWA 4D5CA 3FZVA 2HS5A 1QZYA 1HSJA 2KRCA 4G7OF 2ZSHB 1FWZA 4MGRA 2A07F 3JSPA 1AKHB 4XLAA 4AU7A 2QLZA 3BJOA 1QHGA 2L9NA 2Y0MA 1FT9A 4ESFA 2L02A 2FOKA 2H27A 4JBAA 2CFXA 3JCUC 1I3QJ 3IH3A 1WQ2A 5JI6A 2G7HA 3RI4A 1MMGA 3ZN1A 1FOXA 1S7OA 4XNFA 3HJEA 4N9HA 3C2BA 2FXAA 1ZN2A 2GBYA 2MD0A 4AYBN 3AKZA 2D2WA 4HNUA 2XSDC 1U0JA 5E79C 1R49A 3H35A 4P9FA 4ZYEA 1ZGWA 1RESA 4BQQA 2DT5A 1ETWA 1H9TA 4S05A 2JA2A 2KIUA 2BW3A 2CV1A 2Q2EA 5B3SH 3C7JA 4KIFA 3G73A 1QVTA 1R5HA 5DYMA 4HLXA 3OYBA 4BY7J 4IO9F 4LLGF 1MKMA 4GRIA 2ACJA 2F5DA 4AIDA 4HQMA 4KDPA 3DPLC 1FTZA 1HF0A 2EA4A 4KIGA 5HLTA 2Y9ZA 3IKTA 6PAXA 1QQIA 2HKXA 3HG9A 3ONQA 2LTPA 3CTAA 1I3AA 3HTUA 4IXAA 1O7FA 5DD8A 1VQ8I 2K02A 1A35A 4P55A 3ERED 1WH7A 3DTEA 2A6TA 1MSFC 2LY2A 2F2EA 3ASOH 1YYVA 5EGOB 3MVPA 3H9JA 4BDYA 1IRGA 2FNPA 3RCOA 4AD9A 4PZJA 3K1PA 1Z7LA 4F52A 3HSRA 1FYMA 2GXBA 2WC2A 4PCQA 4XKCA 2TRTA 3GTQJ 4KICA 3CO7C 4KA4A 4C3JJ 2NRAC 1KQ8A 1RKWA 1Z6TA 3PUBA 3QRFF 4XN0A 1WFXA 2PX9A 1RZ9A 5E17F 3J81K 2CQQA 3T0YA 4E7ZA 1T39A 3G1MA 3TBIA 3I58A 4BJ6C 3ZGKA 3WTXC 1BA5A 3PNTA 4QPQA 3EUKL 3OYEA 4I76A 2PQ8A 4B8XA 4G6DA 3KX2A 5K5OA 4BE0A 1YFHA 2DAOA 5J1UA 2L3DA 1P4XA 5E1ZB 3JSOA 3QK2A 1N25A 2DMTA 1Z6RA 4P96A 2LBFB 3HOTA 4JX5A 1XMXA 2F4MB 2QVOA 4O3MA 1NH3A 1FBSA 4FX0A 4LFUA 3HM5A 3CUQA 3HOVJ 4BYYA 3JTGA 3JW4A 3CJTB 4PJNA 2MG4A 3DU6A 1IDYA 2BEOA 4U0YA 3F23A 3BROA 3W6KB 4E4HA 1LE8A 1ZRFA 1JTYA 1R6RA 3JRCA 2IP2A 1IN4A 1FIAA 5J1RA 1N78A 4CCLA 3GTGJ 1ZKGA 4I09A 2JN6A 3I53A 4PFPA 2M0CA 3HC7A 3QQAA 3A0BC 2E1CA 3LOCA 2GM4A 2XPUA 3PSIA 4FT8A 4PDKA 1U3EM 3F8BA 4FX4A 2IS6A 1JTXA 2ZBKA 1B1BA 4PGGA 2DJIA 4CZZA 3CQZJ 2NTCA 3CC7I 4XK4A 1DUXC 4HW0A 1MDMA 3BOQA 4Q4ZF 4PSXA 3H1CA 2M4KA 2HI3A 2L7KA 4HRIA 2FBIA 2QKLB 2W85A 3J7AO 1TW2A 3DQVC 3AFHA 2PFBA 2FD5A 1WJEA 4FGNA 1AOYA 2KZGA 2GWRA 3BR1A 5D8LB 5F1RA 4IOCF 2C6YA 4CHUA 2R5YB 4YFKF 3F8FA 3VYUB 1IDZA 3OYCA 2IPRA 3KP2A 3WTYC 1IRFA 1IXRC 3K4BA 4CO8A 3G1OA 4OIOF 3FBNB 2HOEA 1VQNI 3K1NA 4MEXF 2WTEA 2VXDA 1BOAA 1BJZA 1KQ0A 1XPXA 1IGNA 4FE7A 1P4WA 4TV7A 4EMSA 2QCOA 2DFHA 4ESJA 1UZCA 2JVGA 2GXGA 4L9NA 2EFNA 2R92J 5J3LA 4EQQA 3EQLF 2EZHA 2QSFX 4P5OA 3O8GA 4A3MJ 3KP4A 1UB9A 4YEJA 2Y2ZA 4PUSA 3L7WA 2JK3A 4MQ9F 4I2OA 3CF5F 4L9JA 1TNSA 4E7KA 2DBBA 3K2AA 3FXLA 3H0GJ 1ERDA 3E1SA 1R58A 2ZNYA 3G3ZA 2M1BA 4DGWB 4E6KG 4E7HA 2DDAA 3GTLJ 5HS7A 4MLOA 2WB1N 4HEA2 4LLLA 3FK6A 5D6EA 3RQIA 2X0LA 3ZQCA 1RETA 3D1NI 1MNEA 1XSVA 2O0YA 4CSWA 2F48A 3KYLA 1U8RA 3GTJJ 3PNYA 3KLNA 2AXLA 4LB6B 3HRSA 2ELHA 1GVJA 2BY3A 1UG0A 2OV7A 4GYIA 5EG0A 3BG5A 2R5YA 3LSJA 3LSKA 1OYWA 1U78A 2HDCA 1OCCH 1XGNA 1NK3P 2EV0A 1VZ0A 3HOZJ 3BTIA 1JGSA 4D7NA 4P1WA 3OYIA 4Y3OA 1XB4A 4C3IJ 1HSTA 4L5IA 3M07A 1H8AC 3A03A 2ETHA 4ABZA 3SZGA 2LK2A 1KQ9A 1BC8C 5TJJA 1WJDA 4UUVA 4PJ0C 2JA8J 1Y6IA 5DEQA 3OYFA 1X2NA 4XRFA 2BBYA 4MFEA 1ORKA 3JRIA 2BHZA 3WGIA 4CCJA 2CV0A 1J7KA 5J8CA 4PJLA 1B72A 3D5SC 4IHXA 5HVQC 1IUYA 3MWMA 2FOWA 1W5SA 1JKQC 1QPMA 2K3PA 2XF6A 4M3GA 3VFZA 4K2EA 4YIFA 3OL3A 2ECBA 1JXSA 1APLC 1VF9A 1B9NA 2FNAA 3HGYA 3BLYA 3C2HA 3JRDA 1DPRA 4GO1A 1B9MA 3PFYA 2ZJRF 3TP0A 3H3ZA 2LC2A 2GA1A 4M3DA 3NWTA 4BHCA 2IT0A 1MBHA 1QHHD 1IV6A 2BHYA 2IA1A 2NVXJ 3J7AY 1U5TA 2R7WA 1XD7A 3MMYB 4XMYA 3KYDB 3C2GA 3S93A 3AAFA 2IBDA 1WKMA 2A5YB 2P5LC 2QA4I 2LSOA 3E3VA 1X19A 4OOIA 5F27A 2BY2A 2NNYA 2LF8A 2GIVA 5CKTA 2CW7A 4AIKA 2W82A 2LBFA 5EYRA 3OYJA 1SEUA 4BQAA 1R5ID 4XICA 2R7OA 2VJJA 2B63J 5DCMB 2FSWA 1EH8A 2DA2A 4YFNF 1SVLA 3KP3A 3ROUA 2P7VB 1S8NA 4BE2A 2MSYA 5F0CA 4DYQA 4XOTA 1DGRM 1T98A 1MIJA 5E8GA 3RPUA 1ZQ3P 4BDZA 4ZYDA 5F6FA 2V1NA 3UKGA 5LHHA 3OR1C 4G7HF 2ZB9A 1IO2A 5M5WJ 1S72I 4UB6C 3ZXSA 3B73A 1WHUA 3ZMSA 2LFBA 4U0WA 1Z7UA 1J9IA 2CSOA 3ZRGA 3S16J 4ZDOA 5K5QA 2NXNB 3KFWX 2NVYJ 1MMDA 1EKEA 5EZHA 3EPZA 1I50J 2CU7A 3IWZA 1ZRCA 1UMQA 4W1UA 1ON1A 2H1LA 3FMQA 3L09A 5EGOA 2Q8KA 3GF2A 2AQFA 1SVMA 1Y8RB 4OMZA 5ILVA 2PJRB 2VXZA 2DA6A 3OYGA 3BTLA 2OQGA 3U1KA 5KK1A 5B1BH 2E7WA 4DYCA 4QWQA 1UAAA 2E36A 3K4KA 4DYRA 4H0EA 2YS9A 2QSHX 4CCNA 2ZJPF 4HBLA 1FBUA 2E34A 2OTJI 5D9IA 4RLQA 1KU3A 3IV5A 4OWRB 1KYWA 4BEHB 5KAFC 3KCCA 1S29A 5FKLA 5K1YA 1Y39A 4M6YA 1SD6A 1XX5A 5HDGA 2P81A 1EH6A 2QSGX 4FE4A 2PJRA 2NS7A 1AWCA 4V2GA 3CMMA 3BT9A 3DFGA 2XPWA 5IP9J 2CFOA 4I0AA 4L0YB 1Y1VJ 5DD4A 4BUPA 4LOCA 2VE9A 3OYHA 1TBDA 3GTPJ 1F36A 2CUFA 1B72B 4AYBA 1F5TA 4G6TB 2ID3A 2IS1A 1P7IA 2CUEA 3JR9A 3H5NA 1PVEA 4XKWA 2QQ8A 2ZFUA 2XB0X 4EJWA 1YX3A 5ICEA 4IJAA 2WAFA 1OLTA 2DOFA 5B66C 2DMUA 4HPQA 1GXQA 2FQ3A 3A01A 4EM0B 2MH9A 3PUFA 1W0TA 1DPUA 1R71A 1TWCJ 1Y0NA 2E1OA 4HYEA 5LRSA 1WI3A 2RAEA 5IOZA 4ZTJA 4F7ZA 1KYZA 1USTA 1CGPA 1OCOH 2CS3A 1Z9CA 5FD6A 4WXDA 3IL2A 2XC7A 4IRIA 2FBKA 1YQAA 1XGSA 4LB5A 2F6CA 2JPBA 2BZTA 2CQNA 3GEZA 1R23A 4NC7A 4UVAA 3SXYA 2BXYA 3HPHA 4DW6A 4NUBA 3F21A 4F93B 3AL0B 4HSTA 1WJFA 2J5PA 3DCFA 1YJ9I 5LBQA 3KLOA 4KYWA 1T0FC 4M9ZA 2Z33A 2LH9A 2R0QC 3OYDA 1ZG1A 4IZZA 3CMEI 5DCMA 1MH4A 3OWTA 2XGCA 5GPAA 2DA1A 4CICA 1VQ9I 1FEXA 2E1NA 2K4BA 3LAJA 4XM3A 2VC0A 3CF2A 3S1RJ 1YOVB 2JSPA 3F3XA 2IW5A 2DK8A 3NEUA 4N0BA 4NQWA 2BGCA 3HRTA 3AG2H 5JVGF 2ADUA 3L2UA 1EH7A 1BBYA 2Q2EB 2X6YA 3Q9SA 4ZJZA 3K70C 2A05A 2VBYA 4ZH4F 2FBHA 2LRDA 1D0XA 2EV6A 2E71A 1RRJA 4A12A 3I64A 2EINH 1NG7A 1IC8A 3TDUC 1YS6A 2EK5A 5FLMJ 3LMMA 2CMPA 3I3LA 4KT6A 4C2TA 2V4JC 5IY5H 2WB1A 2ZSIB 4XLHA 2JPCA 3SFIA 3HOWJ 5E3MA 1YJWI 3BPXA 3SDGA 5HNHA 3OS0A 2F4OB 3A1YA 4YFXF 1FNNA 5F04A 1S3JA 2P8TA 4WCGA 3JTHA 5IPAA 3IRQA 1R9TJ 1K78A 3I4MJ 3S14J 3MKWB 1OJLA 4KMFA 3N4MA 4MFDA 1L0OC 1MDMB 2JZYA 3CCVI 4YIRX 2W7NA 1OPCA 4BKXA 4CZCA 1ETVA 2X6XA 2TDXA 5HDNA 3CCYA 4HDUA 4NB5A 2W1OA 1ZG3A 2XSJC 3LSHA 2IXSA 2KISA 4HV6A 2R7QA 2KKOA 4HA8A 2CQKA 4DBRA 2V1XA 1BI3A 3BG3A 2CW0F 1XTAA 4DIQA 2E5NA 3BTJA 3DTIA 1RKTA 2EQRA 2YX4A 3FXRA 4RM3A 4ANJA 1WWXA 4BHBA 5HLIA 4RB3C 2L4MA 3S1NJ 4C9YA 3Q0UA 2WA0A 3E0JB 3I54A 5ED4A 4LK0F 1MD0A 5ICFA 4FTHA 3PL8A 3DKYA 3BCAA 1TBXA 3K0LA 1JHHA 1VQ6I 4U7BA 2M7BA 3N05A 2ZCWA 4HDVA 3KETA 4DJAA 2LG4A 5FO5A 3M4OJ 2V1DA 2IRFG 2VIXA 4DBQA 2E60A 5JR3A 1ZELA 1QGPA 3CCRI 2DLLA 2VQGA 2ZMEC 1TQIA 2CH0A 4N4OB 1ZLKA 3V4GA 3WHCA 5LEKA 2IVMA 1XSDA 1S7EA 1I1GA 2DT7B 1MSEC 5KAIC 2K4JA 3K4NA 1F1ZA 1Z0XA 3GLXA 5LHIA 3DP7A 1YIJI 1QVUA 4KITB 1TWHJ 2XAQA 3B6AA 2L9SA 3IAS2 4M73A 4AC0A 4UNOA 1YE9A 3A4CA 1H89C 2DXIA 3AG3H 2KPMA 3R0JA 4HQEA 1NHAA 3RTRA 4A3CJ 5D5VB 4JP0A 4BU2A 1FMWA 2IA2A 2DA4A 2K3FA 3L2WA 2MC4A 2RNGA 2WWYA 1W1WE 4LG0A 2G0EA 3JRHA 2PEXA 3HOUJ 2QGUA 2R7ZJ 3ABLH 4ZQ9A 1MBJA 2F5EA 2Y75A 2XAHA 4QLCU 1G59A 4MTDA 1FMVA 2IS4A 2PG4A 3VYTB 1HA8A 3JRFA 3ISPA 3CJRB 3A2KA 3HGGA 1SD4A 2Z2SB 3I56I 4O5VA 3V7SA 2VASA 2G7UA 2Z1DA 1P9QC 3KEQA 2LR8A 2VQHA 1ETQA 3BR3A 3CMYA 3QP5A 1T6SA 5LGTA 5HOOA 4EATA 1VI0A 2VB6A 1T95A 4WX9A 2DT6A 5BQTA 3LWFA 3G2BA 3MD2A 1QBJA 4RBOA 1HW5A 1S9HA 1O3SA 4CH7A 3F8MA 1TT5B 1BIAA 2H8RA 1MJAA 4KISA 5GAEJ 3GCMA 1OR7C 2XF7A 4C2MJ 3J81Z 1TWFJ 2Y30A 1NTCA 3RJPA 3GXOA 2HNHA 4B09A 3LL7A 1MMNA 3IKVA 2XAJA 4M3EA 1S5LC 1G3YA 3CC4I 5L3EA 4M6XA 2ICWG 1O3RA 1S6LA 3L9FA 2ECCA 1W7PD 1GXPA 1D0YA 1Q1HA 2QEXI 2EZLA 3L2QA 4ZDPA 2XGDA 1DU0A 3H3VK 1W7PB 4Q48A 1ZRDA 4ZC3A 1FC3A 2NAZA 2XDVA 4OAZA 3RYPA 2MYSA 3FMSA 2YSRA 2R5ZB 1WH5A 2XAGA 1HDDC 5FD5A 3SZTA 3HBLA 3M7GA 3S1MJ 1ULYA 3IAM2 4CYCB 3QN2A 3V8JA 3PFIA 2DK5A 3WODF 4EEFG 2RQQA 2XASA 3DF8A 3HKZN 3VYSB 3QYFA 2OZ6A 3ABKH 3HOYJ 3M1CA 1QNTA 1UELB 1GDTA 1PYVA 4KMUX 3I9V2 5L3CA 5F0HA 4OAYA 4LD5A 4JX6A 4XLFA 1ITYA 5FLXZ 1IN8A 3WU2C 1X1CA 5EEAA 2DMQA 3KYCB 3ZCOA 4NNJA 3WU1B 2BV6A 3PSFA 4PJMA 3L2VA 1HC8A 4KNYA 2O3FA 2RQPA 3BR2A 4M9XA 1JKRC 2HFHA 2OAZA 2TBDA 5CYNA 3V7RA 1BIBA 5IOYA 3TEDA 1SANA 3HOSA 1T2KA 1D8JA 1MZBA 4UV9A 3JREA 4BQOA 4ENMA 4L9TA 5HS8A 1HCRA 4S04A 4KJZA 5D5XB 5HDKA 1U9OA 1V55H 2COMA 2KL4A 4A5MA 3LSRA 1IAWA 1L5IA 3DBLB 4G8XA 4LITA 2OZUA 2ESNA 2IGKA 2ZKZA 3GZNB 3CDHA 1J2XA 4LG0B 3P5JA 2ELKA 2XGEA 3RPUD 2PMUA 4IHTA 2K9MA 2QENA 4LIFA 3K69A 5H6QA 1LQ1A 1K79A 2CO5A 2L5QA 2VBWA 4CCOA 2XB5A 1ZR4A 3TDZC 1FOWA 3LA3A 4IHWA 1VQPI 1K61A 2V7FA 4F55A 3CJQB 3CP8A 1LUJB 1CF7B 4LMDA 3WG7H 3FXKA 2D45A 1FYLA 1T38A 1Z77A 2E7XA 4BH9A 3MFKA 2P7CB 3RKWA 2V79A 1I6HJ 1UG2A 1ZAOA 2O8XA 2PI0A 2LY9A 2WADA 5IT9Z 5HODA 2VJ5A 3SJMA 1IRZA 3M8FA 4RA2A 3KP7A 3S2DJ 3UNGC 2Z5UA 3EUHA 2XGXA 1KU9A 3FKJA 1EJ9A 1AKHA 3ELKA 5E8IA 3CDLA 3V42A 1JUMA 3DKWA 5BMZA 1JKOC 4ZYHA 3GWZA 1XMAA 5CVJA 2OF7A 5E1XA 3TW7A 5E1WA 5GPCA 3QU6A 3FHZA 3R6SA 2A6HF 1K4SA 1J0RA 3RKYA 3A01B 4R79A 1X3ZB 3KZIC 3HYIA 3VYRB 5FRNA 2FMYA 3ZMVA 3HRUA 4GFBA 4UXNA 5HLGA 3J7ZI 1M1EB 3FMRA 4RS8A 4ETSA 2DTZA 1R7JA 4RAGA 4HX8A 4JK1X 2V6EA 2KMUA 3OV8A 2IGMA 2LF7A 2DN0A 1W5TA 2EPFA 4WK8F 3LQRA 5M5YJ 4ENJA 4CGZA 3QODA 2L0KA 1FZPB 1DU6A 3BQZA 2L9VA 2QKMB 5L3FA 1X3WB 3TO7A 3Q0VA 1UFMA 2L01A 3R4KA 2KDZA 1W36C 1JI8A 4L5JA 2EIKH 3RPQA 1V5FA 4U7DA 2Z3YA 1H9GA 4GGGA 3PIPF 1I1SA 5M5XJ 2LYCA 1ZARA 3QP6A 2ME0A 1JKPC 3C18A 1VQLI 1T33A 3CD6I 2IS2A 2AO9A 1Y0UA 2F5CA 4LK1F 3OYNA 3BWGA 1JUPA 2K85A 2JA5J 3RKXA 3TW6A 2LKSA 5ICCA 2IAIA 3X2QH 4BAYA 1R1TA 2UUZA 2BVMA 3ZQFA 4BXUA 2IJLA 2LOOA 9ANTA 2B9SA 3J80Z 2WAQA 5IYCJ 1P7JA 3WTZA 4M71A 1R00A 2M45A 3I71A 3MAJA 2LD5A 4HF0A 4PSWA 4IOAF 4A3IJ 1U9NA 2W48A 2V26A 3GFLA 2NL8A 2EWNA 3E97A 5EEHA 3G4SI 2E2JJ 4A5NA 5JHUA 4BJTA 2JTVA 3GFJA 1ENHA 3QPHA 3WGHA 3CCJI 2EZIA 2GXAA 3CZ6A 2E5ZA 3JRBA 4KFCA 3MZHA 2K5CA 3K4LA 4I01A 2QBYA 5J1YA 3CJNA 4IQJA 2NVQJ 1I5ZA 3BJAA 1JHFA 2LP0A 1ZH5A 3GMEA 1D5VA 2XIGA 3WE2A 1IW7F 2HZDA 3OOUA 1BR2A 2AQEA 5DUIA 2BE5F 2FUG2 2QQ9A 2R7RA 2M0MA 2R5ZA 2WY7Q 2OC6A 2HDDA 1I27A 3P9IA 1YIOA 5GAHJ 2JA6J 2DFEA 3P9CA 5LEJA 1XC5A 2EB7A 4HX7A 2X1EA 3AG1H 2VI6A 2AS5F 5C4JJ 2HW0A 4E7IA 4XOPA 4EJUA 1YHQI 4KT5C 2GQQA 5EDNA 1M55A 1FSHA 4IL6C 4A3BJ 3H5RA 4HV5A 3ZR8X 4RB2C 2MLKA 3OIOA 2Y48A 4LMYA 3F6VA 2E19A 2HQAA 3A0HC 2CW8A 2HOSA 3IUOA 1E17A 4AWXB 3CCSI 1V5EA 1G3WA 3CUOA 2P5VA 4AVZA 1EA3A 4CA0A 1MMAA 3G71I 2F4IA 4XR6A 4U88A 3ABTA 5FKNA 4A0YA 4LGWA 5TRDA 4Y13A 3NWSA 2O61A 3REOA 3WGGA 3FM5A 3Q0WA 1T56A 4WXCA 1V54H 2XAUA 3HHGA 1X4OA 3FDYA 3OS2A 3H92A 4EV0A 4RMNA 4Q5SF 5D8KB 2RREA 4DZJA 4S0HB 3HSEA 3KIOA 2MABA 4P9UA 3HKZA 3CCEI 1Y1WJ 2K9LA 4ENNA 1RUNA 3I59B 4CCMA 1YW7A 2D1HA 3OYKA 5GTIC 4II3A 1MBEA 2R93J 2VOPA 5IYDJ 2VC1A 2OUMA 1FLIA 5FKOA 1KSYA 1X1BA 2XKOA 1SFKA 1AA7A 3JAMK 2XVCA 2MFZA 2DTRA 4RGUA 2FQ4A 2ITLA 1RUOA 1OCRH 2KP6A 3LAPA 4BY1J 4NBQA 3OIQA 1BR1A 3KZZA 5J40A 1XSXA 2EFOA 2Y9YA 2M2EA 5LRRA 3WTSC 1TNTA 3JRAA 2XRNA 2JUGA 2V9PA 4C2UA 2VPLA 3K4JA 2O6GE 4KUMA 3H5AA 2ZXWH 1J5YA 1U8BA 2BXZA 1X3UA 2K9NA 2X1CA 1IXSB 4ESBA 2I10A 1E3OC 1V4RA 3V7CA 1FOKA 2R7SA 2HOTA 2CUJA 1RI7A 4B47A 1GV2A 4KN4X 1VQMI 1D0ZA 2L7ZA 3I59A 3SZPA 2VPRA 2O03A 1MH3A 1YX5A 2NYXA 2E1MC 1J59A 3CC2I 3K10A 4D7MA 5K7ZA 2G9WA 1WGXA 3R61A 4ZZDA 3ZMTA 4B1RA 2HVQA 1D8KA 4B3XA 2ITJA 1D1BA 1KU2A 5JFRA 3MKZA 1JGGA 3TL4X 1SFXA 1ZG5A 1KONA 1UHWA 3QPLA 5FFXA 2VN2A 3S3NA 2QM3A 4HF1A 2DMPA 4EVIA 3CLOA 2DMNA 1MNMC 1WZ2A 2GAUA 4U0VA 2Y69H 2AHQA 1GHCA 5BOXA 3I4NJ 1ETXA 4XSXF 1TZLA 1U2WA 4NC6A 3NARA 3HXLA 3SQNA 4QTRA 3LNQA 1F4KA 4BEHA 3PIOF 2H1KA 4XRMA 4ENKA 1ZTRA 2EH3A 2AXTC 2M7AA 2DCEA 2WAQN 2HDWA 3ZQ7A 2FUFA 2BVLA 4RAFA 4V2FA 4BXXJ 3LSGA 3HUGA 5B1AH 2FMLA 2X4HA 4R1HA 2M5WA 1QZEA 2ZFWA 1WJ5A 2NOGA 3QFQA 4GCVA 1D5YA 3OMYA 4KIBA 3DLAA 2E1MB 1O4XA 2BYVE 4Y7NJ 2E2IJ 2A69F 3GTMJ 3HSFA 3E5UA 2Z16A 1ZREA 2QZ8A 3DEEA 4BQNA 3W2AA 1FOYA 2OCCH 2R3SA 2DDBA 1J75A 1QPIA 2X51A 5LLQA 2DYSH 2VE8A 1WJBA 3C1DA 2F5VA 3G1LA 4I99C 2HU9A 5CVUA 2JA7J 5H6RA 1GVDA 1RZ4A 1IV8A 1R4NB 4MEYF 3ASNH 1H88C 2DFIA 1GLNA 1G4DA 2HVSA 1Z91A 3IRRA 3QYEA 2K9SA 1U6GA 4RGXA 2YU3A 5CJ9A 4BJ5C 1B8IB 2FF4A 1YLFA 1G6NA 2UV1A 5FLXK 3T8RA 1WVRA 5GTHC 5C3EJ 5BYGA 4JX4A 3VWBA 4B4CA 4W97A 1LNWA 3K4CA 1TL8A 4M3FA 2XRLA 4BBRJ 4ZYAA 3HRMA 5M3MJ 4A6DA 5DV5A 1X2MA 2FRHA 3K7AJ 3H36A 4FB3A 1R1UA 2IGNA 4I98B 1LKXA 5ERIA 2ZXJA 3K2ZA 4L18B 2OD5A 5JLWA 1GT0C 5DM6F 3CUQC 3TGNA 2HKOA 3K4MA 2KT0A 1TWGJ 2V6CA 2VJ4A 3SDBA 3LSTA 1ZGJA 5D5UB 3S17J 1X1PA 2CQXA 4Y15A 4X0GA 1SFEA 4A3KJ 2YU9J 2HQ5A 5F1JA 1TT0A 1JJ6C 4MIMA 3TMOA 2WY8Q 1SD7A 2H09A 2H8WA 2OBPA 3GYHX 2Y0SN 4ZYGA 4AIHA 2DOAA 2WV0A 4GXOA 2EBIA 2VT2A 1QU3A 1XG1A 2PBIA 1FY7A 1PUFB 4Y52J 1RR7A 4D9JA 3QOEA 3I55I
chains in the Genus database with same CATH topology
2OV7A 4ZTFA 3VYSB 3QYFA 2CUZA 3H9QA 3OYMA 3OS1A 3OL4A 3PJRA 3EUHC 3M1CA 4B48A 3LSKA 1UELB 2W00A 1PYVA 3I9V2 1VZ0A 5LD2C 2P0WA 4OAYA 2KLOA 1BR4A 5TGTA 3VSLA 4P1WA 3OYIA 4XLFA 4Y3OA 3SEZA 3S3OA 5FRMA 1X1CA 3W2WA 2ELJA 3ZCOA 4NNJA 4BS9A 3SZGA 1X1DA 3PSFA 4PJMA 3L2VA 2KQRA 1WJDA 4ITVA 4XQFA 3PNVA 1Y6IA 4RM2A 2TBDA 3OY9A 3D5LA 3OYFA 5CYNA 2KDOA 3OR2C 3HOSA 4CCJA 3DTKA 2CV0A 4BQOA 2R7UA 4LIVA 4PJLA 3D5SC 3HL2A 5HVQC 4KJZA 2BOLA 2K3PA 2KL4A 2XF6A 1L5IA 3OL3A 2A5WA 4LITA 1Z3XA 2IGKA 3BLYA 1LVKA 3C2HA 3RPUD 1D1AA 3PFYA 2K9MA 3EUAA 4IKFA 4FASD 2LC2A 5CQGA 4LIFA 3NWTA 1X1AA 4NQWB 4XLCA 4LG3A 2L5QA 4E7SA 1QHHD 1PJRA 4CCOA 1J09A 2VJIA 3J7AY 4HG2A 2R7WA 1SAUA 2VLAA 2V7FA 4PJJA 1BOBA 3MMYB 4XMYA 3CJQB 3CP8A 4F55A 3C2GA 3S93A 4BXFA 1DQUA 2M4GA 4LMDA 4E7LA 3S8PA 3M8JA 3LSMA 1DGWY 1X19A 3OYLA 2HPIA 4H4KC 5CKTA 3ZQQA 4Y4RA 2CW7A 2VKDA 3BG7A 3CESA 4PFOA 2W82A 2LBFA 3OYJA 2WADA 2R7OA 3L2RA 2VJJA 2VJ5A 3IP4B 3OIPA 4BE2A 4J00A 3UNGC 4XOTA 1DGRM 3FKJA 2Q1ZB 4JOMA 4BE1A 4PK4A 3DWLE 4BDZA 2V1NA 5KCMA 5CPRB 3RSNA 3V42A 3OR1C 2L2OA 3ZXSA 5FROA 4N4NB 3GBGA 3FHNA 1LDKB 4F3QA 3ZRGA 2IF9A 4ZDOA 1MW7A 1IRXA 3BC8A 1MMDA 2KHMA 1DP3A 3EPZA 4R79A 3VYRB 5FRNA 4DOZA 2V6EA 3QYBA 2AQFA 2KMUA 2IGMA 2PJRB 2VXZA 3OYGA 2IGOA 3QODA 2GOMA 2VQCA 3DU5A 2HVRA 1WJAA 2QKMB 1UAAA 1JI8A 1W36C 3K4KA 1Z21A 1V5FA 4D1QA 2LREA 4CCNA 1F08A 5KHDA 4XL9A 2LYCA 2ZXHA 2O5RA 1R9WA 5D9IA 4RLQA 4OWRB 4BEHB 2IS2A 2PMZA 2KZVA 2WBMA 3OYNA 4BL0B 1Z1DB 4NC8A 4JQFA 4BACA 2PJRA 2UUZA 2X1DA 2BVMA 3CMMA 1W36D 1G8XA 3AL0C 1WJCA 2CFOA 2LOOA 4XORA 2WAQA 4BUPA 1TBDA 3OYHA 3SEQA 3LSIA 4PSWA 4AYBA 2VKHA 4CCKA 2V26A 4G6TB 2NL8A 2IS1A 3H5NA 3DPUA 3K6GA 4XKWA 4XKVA 4BJTA 3VSKA 2ZFUA 5DCXA 3H0DA 3CZ6A 2E5ZA 1YX3A 2WAFA 1OLTA 2NOJB 2K5CA 3K4LA 3W3CA 4IQJA 4HPQA 1K6YA 4XN3A 2VL8A 2HZDA 3UR3C 3OOUA 1BR2A 4J01A 3F9KA 2AQEA 3K70D 4C30A 2FUG2 4ZTJA 3U21A 2R7RA 2VQLA 2M0MA 3HUGB 3D5RC 2WY7Q 2ZXIA 2OC6A 4QPOA 2CS3A 2WAEA 2XC7A 2X1EA 4YRVA 2F6CA 2KRCA 3W2VA 4NC7A 2ZSHB 3HPHA 2HW0A 4NUBA 4F93B 3AL0B 4E7IA 4HSTA 4XOPA 1WJFA 4XLAA 4AU7A 1M55A 3H5RA 3ZR8X 1T0FC 4KW3A 2LH9A 1QHGA 2L9NA 4Y33A 3OYDA 4IZZA 1LFPA 2HQAA 3OWTA 2CW8A 3IUOA 1V5EA 4AVZA 1EA3A 3CF2A 4XM3A 4CA0A 4F92B 1MMAA 1MMGA 2JSPA 2F4IA 2M3AA 4XR6A 4XNFA 3RQ4A 4GDFA 5KNLA 2LY1A 3DKXA 3NWSA 2MD0A 3AKZA 3L2UA 2Q2EB 2X6YA 2XAUA 4HNUA 1U0JA 4ZJZA 3K70C 1X4OA 2XF5A 3H35A 3FDYA 3OS2A 4BQQA 3SYTA 4RMNA 2JA2A 2LRDA 2RREA 2BW3A 3CP2A 2CV1A 1D0XA 2MABA 3HKZA 2K9LA 4CCMA 3OYKA 1NG7A 4II3A 4HNTA 3OYBA 4GRIA 3LMMA 2OUMA 4FETA 1KSYA 1X1BA 2CMPA 3DPLC 1SFKA 3I3LA 1AA7A 4KT6A 4C2TA 2V4JC 2WB1A 2MFZA 2Y0SA 2ITLA 1X4PA 2KP6A 2ZSIB 5HNFA 5HLTA 4XLHA 3ONQA 3HG9A 1BR1A 3OIQA 4F91B 2W4SA 5HNHA 2CV2A 3OS0A 3A1YA 2JUGA 4C2UA 2VPLA 3K4JA 3DTEA 2A6TA 3H5AA 2LY2A 2X6WA 4LIUA 3FBIB 3MKWB 1NG6A 2X1CA 3H9JA 4BDYA 3RCOA 2W7NA 4CZCA 4BGDA 2X6XA 4B44A 1Z7LA 2R7SA 2CUJA 4F52A 4B47A 2I8DA 2W1OA 3BG6A 4B43A 2XSJC 3LSHA 1D0ZA 2IXSA 4XKCA 2R7QA 2GOXB 4DBRA 2BW3B 4DIQA 2E5NA 3PUBA 1YX5A 3DTIA 2E1MC 4RM3A 4YELA 2R7XA 4NBPA 4XN0A 4ANJA 1WFXA 3K10A 1RZ9A 2HVQA 4C9YA 4E7ZA 2WA0A 3E0JB 1V5GA 3TBIA 4B3XA 2ITJA 4BJ6C 1D1BA 3ZGKA 3PNTA 4QPQA 3EUKL 3PL8A 3MKYB 3MKZA 3OYEA 3DKYA 3BCAA 3TL4X 2R7VA 1KONA 3KX2A 4BE0A 4U7BA 3S3NA 2M7BA 3N05A 3QK2A 1D1CA 1MNDA 4DJAA 2LBFB 2LG4A 3HOTA 3BCBA 2VIXA 4DBQA 2E60A 1ZELA 1TZLA 2VQGA 2V9KA 2R4GA 4ZO0A 2UWMA 2CH0A 5CQEA 4N4OB 3HXLA 4PJNA 3DU6A 4U87A 4BEHA 2DT7B 4ZDLA 2M7AA 4E7JA 4E4HA 3K4NA 2DCEA 1R6RA 2HDWA 1N78A 4CCLA 2FUFA 2BVLA 4KITB 2L9SA 4XONA 3IAS2 3HC7A 3LSGA 4PFPA 1YE9A 4XKBA 3A4CA 2DXIA 1UUTA 2KPMA 3PSIA 1WJ5A 3RTRA 3QFQA 2IS6A 1N75A 4II2A 3OMYA 3DLAA 5JHFA 4BU2A 2DJIA 1FMWA 2E1MB 3OYAA 3L2WA 2NTCA 2MC4A 2RNGA 2Z16A 2KRHA 3DEEA 4BQNA 4PSXA 3W2AA 2M4KA 2L7KA 4HRIA 3KEYA 2X51A 2HPMA 4ZQ9A 2X85A 3S3MA 1WJBA 2QKLB 2F5VA 4XLEA 3DQVC 2HU9A 3AFHA 1G59A 4HSRA 1FMVA 2IS4A 1WJEA 3VYTB 2HVSA 1HA8A 1GLNA 3H9GA 4FGNA 3CJRB 5LFAA 3A2KA 3QYEA 2JVHA 2Z2SB 4BJ5C 2VASA 2R7TA 2Z1DA 3VYUB 3OYCA 2IPRA 1P9QC 2VQHA 2UV1A 3K4BA 4IX7A 5HOOA 4EATA 1N77A 2VB6A 1T95A 3FBNB 2DT6A 1Z3YA 3HPGA 1E0EA 5BYGA 3G2BA 3MD2A 1S9HA 3VWBA 4CH7A 2VXDA 3K4CA 4ZYAA 1L2MA 4KISA 2JVGA 4FB3A 1OR7C 2IGNA 2XF7A 1LKXA 3DPTA 2HNHA 4P5OA 3LL7A 3S32A 1MMNA 4YEJA 4PUSA 3K4MA 1Y56A 2VJ4A 3SDBA 1D0YA 4X0GA 4E7KA 4RLFA 1KSXA 3L2QA 4ZDPA 1TT0A 1ERDA 3E1SA 4ZC3A 2XDVA 4OAZA 2WY8Q 3TMOA 4DGWB 3LFUA 4E6KG 2MYSA 4E7HA 4MLOA 4HEA2 3VDXA 4CUGA 2DOAA 1MNEA 4CSWA 1QU3A 3KYLA 3IAM2 4IQ4A 4D9JA 3PNYA 3QOEA 3QN2A 1UG0A 2RQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKX A;  3DKY A;  4U87 A; 
#chains in the Genus database with same CATH topology
 4ZTF A;  1YG2 A;  3FXU A;  2CUZ A;  2KJC A;  3OL4 A;  3Q5F A;  2ID6 A;  2P4W A;  5CVR A;  5K5R A;  2XRO A;  3N97 A;  1A5J A;  1BI0 A;  1XGO A;  3DBH B;  4OMY A;  1A6I A;  5LD2 C;  2P0W A;  2KLO A;  1BR4 A;  2V9V A;  5TGT A;  3ECO A;  1KA8 A;  4M74 A;  2COB A;  3S3O A;  1XCB A;  4MHG A;  4BS9 A;  2X6O A;  1IN6 A;  1JT6 A;  1X1D A;  5K7H A;  1PDN C;  4RM2 A;  5H2F C;  3M1E A;  1FTT A;  1ONV A;  4IHS A;  3EYI A;  2NNN A;  3OR2 C;  1NK2 P;  1SVO A;  1BN5 A;  3DTK A;  1TTY A;  4LIV A;  1T8I A;  1HKS A;  4N9I A;  2YX7 A;  1REP C;  3L00 A;  1ETK A;  2A5W A;  3M9A A;  1CQT A;  2OJE D;  2LMD A;  4UVC A;  1SMY F;  1LFU P;  4HAM A;  1SD5 A;  2ME6 A;  3DEU A;  1YJN I;  4CYC A;  3EUA A;  4BBS J;  1X1A A;  5ILU A;  3S1Q J;  2JT1 A;  4LG3 A;  3HB9 A;  3BJ6 A;  1WSU A;  3CLQ A;  1YW9 A;  2CQ7 A;  4EJO A;  3BTC A;  1SAU A;  2VLA A;  2GIZ A;  1BOB A;  2RNJ A;  3F6O A;  3VOE A;  4CXF A;  2RKH A;  1LE8 B;  4BXF A;  3WE3 A;  2J5O A;  2M4G A;  5GP9 A;  1TW3 A;  4EGZ A;  1JJ8 C;  4E7L A;  3S8P A;  1Y8Q B;  1JT0 A;  4RDU A;  1DGW Y;  3F22 A;  1RNL A;  2PMH A;  2Y31 A;  2HPI A;  4H4K C;  2FA5 A;  2UXX A;  2L4A A;  1XMK A;  2FJ1 A;  3LA2 A;  4B3A A;  1IUF A;  4Y4R A;  3CES A;  2FE3 A;  1BI1 A;  2JRM A;  3AG4 H;  4I7H A;  3TKY A;  3GZ6 A;  3QU3 A;  3S2W A;  3L2R A;  2JMW A;  1XDS A;  4J00 A;  2EZK A;  1U5T C;  2X48 A;  4PK4 A;  4FIS A;  2ZNZ A;  4EGY A;  2W57 A;  2I5U A;  1VFC A;  2HYG D;  3HTS B;  3FIS A;  4A3F J;  2HXI A;  2L2O A;  1ODD A;  3BDD A;  3MQ0 A;  1MBG A;  3ZOB A;  3ZQG A;  4A0Z A;  1ETY A;  4I02 A;  3FHN A;  1LDK B;  4F3Q A;  1A04 A;  1TP4 A;  3NQO A;  1BJA A;  4M3B A;  4OIQ F;  1IRX A;  2HR3 A;  1FJL A;  1OCT C;  4DQ2 A;  2KHM A;  1DP3 A;  5L3D A;  3GX4 X;  2DQR A;  2CRG A;  2K7L A;  1B59 A;  3MZY A;  2EIM H;  2W25 A;  3TOA A;  5GAG J;  2ESH A;  1FIP A;  4G94 A;  4IHV A;  4OIR F;  2K9Q A;  2GOM A;  2VQC A;  3DU5 A;  2XKP A;  5IYB J;  2R7F A;  4UY8 I;  1XDU A;  1XGM A;  3O8H A;  5FKM A;  1BW6 A;  3H3U A;  5KVR A;  2MLG A;  1FYK A;  5M3F J;  2LRE A;  5B5E C;  2E35 A;  3HZJ A;  3LA7 A;  1F08 A;  5KHD A;  4IHY A;  1R9W A;  1YS7 A;  3RKQ A;  1ZHF A;  3E6C C;  1PP7 U;  4BNC A;  3MKL A;  3CDI A;  3FXJ A;  2PMZ A;  3ZQH A;  2KZV A;  2WBM A;  3HHH A;  4BL0 B;  1MMS A;  4I0B A;  4NC8 A;  5EEG A;  3E5Q A;  5C44 J;  3WTV C;  3BQY A;  5D6F A;  3TO9 A;  1W36 D;  1OFC X;  4IF4 A;  2PLY A;  2P6S A;  4Q47 A;  1E3H A;  3AL0 C;  1WJC A;  5L3B A;  2LLK A;  1B8I A;  4XID A;  1LJ9 A;  3RIR A;  1RC9 A;  5LGU A;  3SEQ A;  1G2H A;  2VKH A;  3B6C A;  1LEB A;  3KPH A;  4XKV A;  1FSE A;  2LKP A;  3VSK A;  4HLY A;  2DA7 A;  5DCX A;  3O2P E;  5AIQ A;  2DA5 A;  3V8K A;  3FXO A;  2IEK A;  1TLH B;  2NOJ B;  1K7A A;  1T0F A;  2ISZ A;  4PGH A;  1F43 A;  4LLN A;  5ILS A;  3RYR A;  2V1U A;  3FXM A;  1YW8 A;  3ML6 A;  2VL8 A;  1E2X A;  2A3S A;  4HOB A;  3UR3 C;  2OU2 A;  2PMZ N;  4EM1 A;  4EM2 A;  4J01 A;  3F9K A;  1LFB A;  3V8L A;  2PJP A;  3JAM Z;  3S2H J;  1FBQ A;  3U21 A;  4A0X A;  3D5R C;  3OSF A;  4QIW N;  1OIS A;  1WPK A;  2CG4 A;  3FM3 A;  2ISY A;  1W7P A;  4IEJ A;  2WV1 A;  4M6V A;  1X58 A;  3E6M A;  4YRV A;  1MGT A;  3F8N A;  3W2V A;  1VQO I;  4UUT A;  3P7N A;  3S15 J;  1VTN C;  2X9D A;  3ESW B;  3EYY A;  4KW3 A;  5FLV A;  4ZZL A;  4Y33 A;  1IN5 A;  4Z6Y A;  3M3Y J;  2OQR A;  1T08 B;  1P92 A;  5BPD A;  1LFP A;  2HXO A;  3U2R A;  1MBK A;  1YRN B;  3ECH A;  2KIF A;  3ZQI A;  4AIJ A;  2JUC A;  3I0T A;  5E3O A;  1BI2 A;  2QF7 A;  4F92 B;  2M3A A;  3RDI A;  2CYY A;  3RQ4 A;  4GDF A;  1EF4 A;  3K9T A;  5KNL A;  2LY1 A;  3DKX A;  1A36 A;  1HKT A;  2UXN A;  5LGN A;  1E3P A;  3BPV A;  1R1V A;  4AM3 A;  3IC7 A;  2XF5 A;  1VND A;  3SYT A;  4G12 A;  3M8E A;  3TP3 A;  3ZMZ A;  3CCU I;  3CP2 A;  1XS9 A;  2QWW A;  2Z9O A;  2IPQ X;  2NS0 A;  3KEO A;  5BNG A;  1W0U A;  1OKR A;  4HNT A;  2HQR A;  3DBR B;  1VQK I;  4FET A;  2QYO A;  1FP1 D;  1AU7 A;  2Y0S A;  3FIW A;  1X4P A;  2M9H A;  3E7L A;  5HNF A;  1YRN A;  1K83 J;  5ICG A;  4F91 B;  3WG9 A;  1RR8 C;  1IG7 A;  1ZGA A;  2W4S A;  2MW8 A;  2CV2 A;  2KFD A;  1P2F A;  3PO2 J;  5J6X A;  4IVN A;  2OTL I;  4CDG A;  2YR2 A;  3O6B B;  5E3N A;  1I6X A;  2X6W A;  4LIU A;  3BZC A;  4UV8 A;  1QO0 D;  3BG9 A;  3FBI B;  4OIN F;  2DPD A;  3IWF A;  4MQV A;  1NG6 A;  4UUS B;  5CLS A;  4A3J J;  1BC7 C;  2F5F A;  3GFI A;  2DFF A;  1HBX G;  3WTU C;  2LKX A;  4BGD A;  4B44 A;  5J4V A;  2DQL A;  1D3Y A;  2A61 A;  2I8D A;  3QWL A;  1XCV A;  3BG6 A;  4B43 A;  2MGQ A;  3BR6 A;  4IRH A;  2GOX B;  1GV5 A;  2Z99 A;  3DXJ F;  2JRT A;  4NDL A;  4HX4 A;  2VKV A;  2GA2 A;  3ULQ B;  2BW3 B;  2ZME A;  1JUS A;  2QQB A;  4NBP A;  2R7X A;  4YEL A;  2XAF A;  3QAH A;  4RB0 A;  1WI9 A;  3ZMD A;  4LJZ F;  2EA2 A;  2ZO4 A;  3EDP A;  1V5G A;  3ZN0 A;  2R7V A;  2PN6 A;  3MKY B;  4HNV A;  5A2Q K;  1ACI A;  3HEF A;  4GYG A;  2YUS A;  1D1C A;  1S7A A;  2HYF A;  4O6J A;  1MND A;  1YO5 C;  2LVS A;  5JVT A;  2CJJ A;  3U9G A;  3BCB A;  2DA3 A;  3JRG A;  3QPS A;  1R4M B;  2ZME B;  1OCZ H;  2VT3 A;  5JLX A;  3KZY A;  3VB2 A;  2V9K A;  1IXC A;  2R4G A;  4ZO0 A;  2ZJ2 A;  2UWM A;  5CQE A;  1R5G A;  4R8H A;  4U87 A;  2RVC A;  4ZDL A;  5FJ8 J;  4E7J A;  5BPI A;  4RAY A;  3E6D A;  1W4M A;  1ZLJ A;  4C3H J;  4HZF A;  2H6C A;  4XON A;  5K7F A;  3SFZ A;  1LB2 A;  4XKB A;  2MH2 A;  4JYK A;  1OCP A;  2M8G X;  3WU0 A;  1UUT A;  1PUE E;  2MD5 A;  3FWE A;  1N75 A;  1OR7 A;  2FX0 A;  4II2 A;  3DLL F;  4FHT A;  3LFK A;  5JHF A;  4D5F A;  4L5E A;  3OYA A;  5J4Y A;  1BW5 A;  5E18 F;  2KRH A;  1FX7 A;  5J47 A;  3GLL A;  2LNB A;  2DOE A;  2B7E A;  3KEY A;  3GW2 A;  2HPM A;  2GLO A;  5L3G A;  1STZ A;  2X85 A;  3GZ5 A;  2XPV A;  3S3M A;  1IZ1 A;  4KN7 X;  1MJB A;  4XLE A;  2OCE A;  2L7F P;  4IRG A;  4E70 A;  4HSR A;  1H0M A;  4UHT A;  1UJ8 A;  2XHK A;  3H9G A;  2R7D A;  3FX3 A;  5FB2 A;  5LFA A;  2KRF A;  1LDJ A;  2H94 A;  2JVH A;  2MC3 A;  3I4P A;  3VOD A;  5A2Q Z;  1A6Q A;  4X6A J;  2NVU B;  2R7T A;  1YTY A;  1VQ5 I;  1ZYR F;  4CYD A;  3R0A A;  2NVT J;  1ON2 A;  4RB1 A;  4IX7 A;  1SFO J;  1N77 A;  2VON A;  1PUF A;  5IP6 A;  1SMT A;  2QQA A;  1DP7 P;  1OQY A;  1Z3Y A;  1BL0 A;  3HPG A;  1I39 A;  4RGS A;  2RGV A;  1AHD P;  5EJC A;  1E0E A;  2P6T A;  3IHU A;  4FCY A;  3CUQ B;  3BP8 A;  1TC3 C;  4A6E A;  4M9S A;  2DJN A;  2QUF A;  2CWE A;  1Z67 A;  4DNC A;  1L2M A;  1PP8 F;  4RAZ A;  3QPT A;  3Q3S A;  1LVA A;  3BR0 A;  3DPT A;  3FXQ A;  4YII A;  3S32 A;  2M8E A;  3SHF A;  3MEX A;  4WXH A;  5F64 A;  2HYJ A;  3IH2 A;  3TOB A;  3FK7 A;  4AUX A;  4HF2 A;  3T1B A;  1O3T A;  4MTE A;  1Y56 A;  4A3D J;  4NHJ A;  3VEP A;  4RLF A;  3G6E I;  4IPA A;  4A2U A;  5J8F A;  3CMA I;  1K4T A;  1KSX A;  4MNU A;  5F08 A;  3ZQL A;  3TQN A;  1WCM J;  3I5U A;  3U1D A;  1A31 A;  3LFU A;  2K27 A;  2D1V A;  3VDX A;  3Q9V A;  4CUG A;  2TCT A;  2O7O A;  2DW4 A;  3CCM I;  5E20 A;  1KGS A;  1IJW C;  2EJR A;  1HW2 A;  1ZK8 A;  3KE2 A;  1UHS A;  3RZD J;  4IQ4 A;  3OOP A;  3BZK A;  2EFP A;  3PQK A;  3H9Q A;  3OYM A;  3OS1 A;  2BY0 A;  1HQC A;  3LSP A;  3EUH C;  2L9R A;  3PJR A;  2HGC A;  2KJB A;  4B48 A;  5EF6 A;  5GAD J;  2W00 A;  4Z2Y A;  4G7Z F;  3RZO J;  5IT9 K;  1K78 B;  3VSL A;  4AVP A;  5HLH A;  3SEZ A;  1QRY A;  5AON A;  2ZJQ F;  5FRM A;  1ETO A;  5D4R A;  3W2W A;  2ELJ A;  3O3K A;  2QBY B;  4ASN A;  1LDD A;  2DO7 A;  2KQR A;  4X1E A;  5F0F A;  4ITV A;  4XQF A;  3PNV A;  4L9V A;  2H6B A;  1BM9 A;  3D5L A;  3DEW A;  3OY9 A;  2KDO A;  2VUM J;  1OMI A;  3R60 A;  4WF2 A;  2R7U A;  3C3W A;  3HL2 A;  2NS8 A;  2VBX A;  2XUB A;  2KIQ A;  5CVV A;  1JE8 A;  3B02 A;  2BOL A;  4M72 A;  1O3Q A;  1KU7 A;  3WTT C;  3ZP5 A;  5DTD A;  1L3L A;  1Z3X A;  5DUK A;  4A3E J;  1TWA J;  1VQ4 I;  2JQ7 A;  3MCZ A;  3PQJ A;  4BHP A;  1LVK A;  5EG0 B;  1P4A A;  4EJV A;  2MA3 A;  1D1A A;  2OA4 A;  5BS6 A;  4IKF A;  4FAS D;  2W84 A;  3A02 A;  5CQG A;  5D4S A;  3EET A;  1Z1D A;  1W5C C;  4NQW B;  1OYY A;  4XRS A;  4XLC A;  4E7S A;  1PJR A;  1J09 A;  2VJI A;  3NAU A;  1R22 A;  2JWT A;  4HG2 A;  4A3G J;  2P5K A;  4PJJ A;  3T5X A;  1Z05 A;  1DQU A;  1FPQ A;  1WRJ A;  3M8J A;  2M30 A;  4ON0 A;  3VPR A;  3LSM A;  1TQP A;  3OYL A;  1IN7 A;  5E3L A;  3W6J B;  5C4X J;  1HOM A;  3GFM A;  1MJ9 A;  3PO3 J;  4MO7 A;  1SC7 A;  2L54 A;  2K86 A;  3GTO J;  3ZQQ A;  3GO5 A;  2VKD A;  3BG7 A;  4PFO A;  2VOD A;  1B4A A;  4RGR A;  4OU0 A;  3IP4 B;  3OIP A;  3NRV A;  5EZG A;  5DDG A;  3CCQ I;  2W24 A;  2HTJ A;  2M34 A;  1QA6 A;  1VQ7 I;  2EFQ A;  4FQG A;  3P9K A;  3F72 A;  4JOM A;  2Q1Z B;  4BE1 A;  3J80 K;  3DWL E;  2DPU A;  5KCM A;  5CPR B;  3RSN A;  1FP2 A;  1OYI A;  1HLV A;  2VOO A;  1YI2 I;  1SAX A;  4UVB A;  4G9Y A;  5FRO A;  4N4N B;  3GBG A;  1F9N A;  2D5V A;  4I6Z A;  2E2H J;  2XV4 S;  1UCR A;  2B0L A;  2IF9 A;  3CO6 C;  3LQQ A;  1MW7 A;  2KIM A;  3J7Y J;  3BC8 A;  5FKK A;  5LHG A;  5H20 A;  1HW1 A;  3L1P A;  4EJT A;  4L0Z B;  2DI3 A;  4XLN F;  3F0C A;  4G6Q A;  3BY6 A;  5DS9 A;  2A6E F;  5FFZ A;  4V19 K;  1CF7 A;  4DOZ A;  3HDD A;  5CYV A;  2STT A;  3QYB A;  3ABM H;  3ABU A;  1GUU A;  1POG A;  1U5T B;  1USS A;  2ZC2 A;  3E5X A;  3F8C A;  2HWV A;  3MZ8 A;  3T8T A;  3COA C;  3OSG A;  3W6V A;  5AIP A;  2IGO A;  2HVR A;  1WJA A;  2DYR H;  1RIO H;  4WWC A;  4Y17 A;  5FGM A;  1Z21 A;  5HS9 A;  4XBF A;  2EV5 A;  2IA0 A;  1KZH A;  3TO6 A;  1LEA A;  3QOP A;  4D1Q A;  3L2C A;  2HOA A;  1HXD A;  2EIL H;  3BR5 A;  3FF5 A;  1EV7 A;  3GVA A;  5DM7 F;  2A68 F;  2N8G A;  4XL9 A;  3MN2 A;  2ZXH A;  2O5R A;  3WHB A;  4XLP F;  3D0S A;  1ZR2 A;  2O9L A;  2HZT A;  2Q0O A;  3K1M A;  4QSH A;  4A69 C;  1YIT I;  1C0W A;  2CGP A;  3PM1 A;  3ZPL A;  3KP6 A;  1G3T A;  2LDU A;  1Z1D B;  2OPT A;  1UHM A;  1V3F A;  2FU4 A;  4JQF A;  5D5W B;  4BAC A;  3FKI J;  2UZK A;  4OIP F;  5TIS C;  2DU9 A;  2VKE A;  1IF1 A;  1O7L A;  1P6R A;  3ERM A;  1O57 A;  2X1D A;  1G3S A;  1G8X A;  2FEZ A;  2BY1 A;  2JJ7 A;  3E6B A;  2EIJ H;  4XOR A;  2JSC A;  2STW A;  1HKQ A;  2DOD A;  3DV8 A;  3LSI A;  4J19 A;  2RN7 A;  1QZZ A;  3HOX J;  4CCK A;  1MBF A;  1HDP A;  2HQN A;  3ZMU A;  3DPU A;  3K6G A;  3CCL I;  3WTW C;  1R36 A;  1B6A A;  3H0D A;  2MBF A;  4XSZ F;  5DCF A;  2HTS A;  4UB8 C;  2RDP A;  5CVI A;  2YPR A;  3W3C A;  4YG2 F;  4A93 J;  1RPW A;  4DZP A;  1K6O A;  1K6Y A;  2K40 A;  4D0P A;  2L7M P;  2O8K A;  5IT3 A;  4XN3 A;  4XRS G;  1LPQ A;  2GZW A;  3KP5 A;  3GTK J;  3HIF A;  3IH4 A;  4C30 A;  3K70 D;  4A3L J;  1TQM A;  3BZ6 A;  2VQL A;  3HUG B;  1DDN A;  2VBZ A;  2HEO A;  2ZXI A;  4QPO A;  2M87 A;  1XN7 A;  2WAE A;  2RV8 A;  1SFU A;  5IP7 J;  3GUD A;  2RC4 A;  1Q1V A;  4UUS A;  2EFW A;  4D5C A;  3FZV A;  2HS5 A;  1QZY A;  1HSJ A;  2KRC A;  4G7O F;  2ZSH B;  1FWZ A;  4MGR A;  2A07 F;  3JSP A;  1AKH B;  4XLA A;  4AU7 A;  2QLZ A;  3BJO A;  1QHG A;  2L9N A;  2Y0M A;  1FT9 A;  4ESF A;  2L02 A;  2FOK A;  2H27 A;  4JBA A;  2CFX A;  3JCU C;  1I3Q J;  3IH3 A;  1WQ2 A;  5JI6 A;  2G7H A;  3RI4 A;  1MMG A;  3ZN1 A;  1FOX A;  1S7O A;  4XNF A;  3HJE A;  4N9H A;  3C2B A;  2FXA A;  1ZN2 A;  2GBY A;  2MD0 A;  4AYB N;  3AKZ A;  2D2W A;  4HNU A;  2XSD C;  1U0J A;  5E79 C;  1R49 A;  3H35 A;  4P9F A;  4ZYE A;  1ZGW A;  1RES A;  4BQQ A;  2DT5 A;  1ETW A;  1H9T A;  4S05 A;  2JA2 A;  2KIU A;  2BW3 A;  2CV1 A;  2Q2E A;  5B3S H;  3C7J A;  4KIF A;  3G73 A;  1QVT A;  1R5H A;  5DYM A;  4HLX A;  3OYB A;  4BY7 J;  4IO9 F;  4LLG F;  1MKM A;  4GRI A;  2ACJ A;  2F5D A;  4AID A;  4HQM A;  4KDP A;  3DPL C;  1FTZ A;  1HF0 A;  2EA4 A;  4KIG A;  5HLT A;  2Y9Z A;  3IKT A;  6PAX A;  1QQI A;  2HKX A;  3HG9 A;  3ONQ A;  2LTP A;  3CTA A;  1I3A A;  3HTU A;  4IXA A;  1O7F A;  5DD8 A;  1VQ8 I;  2K02 A;  1A35 A;  4P55 A;  3ERE D;  1WH7 A;  3DTE A;  2A6T A;  1MSF C;  2LY2 A;  2F2E A;  3ASO H;  1YYV A;  5EGO B;  3MVP A;  3H9J A;  4BDY A;  1IRG A;  2FNP A;  3RCO A;  4AD9 A;  4PZJ A;  3K1P A;  1Z7L A;  4F52 A;  3HSR A;  1FYM A;  2GXB A;  2WC2 A;  4PCQ A;  4XKC A;  2TRT A;  3GTQ J;  4KIC A;  3CO7 C;  4KA4 A;  4C3J J;  2NRA C;  1KQ8 A;  1RKW A;  1Z6T A;  3PUB A;  3QRF F;  4XN0 A;  1WFX A;  2PX9 A;  1RZ9 A;  5E17 F;  3J81 K;  2CQQ A;  3T0Y A;  4E7Z A;  1T39 A;  3G1M A;  3TBI A;  3I58 A;  4BJ6 C;  3ZGK A;  3WTX C;  1BA5 A;  3PNT A;  4QPQ A;  3EUK L;  3OYE A;  4I76 A;  2PQ8 A;  4B8X A;  4G6D A;  3KX2 A;  5K5O A;  4BE0 A;  1YFH A;  2DAO A;  5J1U A;  2L3D A;  1P4X A;  5E1Z B;  3JSO A;  3QK2 A;  1N25 A;  2DMT A;  1Z6R A;  4P96 A;  2LBF B;  3HOT A;  4JX5 A;  1XMX A;  2F4M B;  2QVO A;  4O3M A;  1NH3 A;  1FBS A;  4FX0 A;  4LFU A;  3HM5 A;  3CUQ A;  3HOV J;  4BYY A;  3JTG A;  3JW4 A;  3CJT B;  4PJN A;  2MG4 A;  3DU6 A;  1IDY A;  2BEO A;  4U0Y A;  3F23 A;  3BRO A;  3W6K B;  4E4H A;  1LE8 A;  1ZRF A;  1JTY A;  1R6R A;  3JRC A;  2IP2 A;  1IN4 A;  1FIA A;  5J1R A;  1N78 A;  4CCL A;  3GTG J;  1ZKG A;  4I09 A;  2JN6 A;  3I53 A;  4PFP A;  2M0C A;  3HC7 A;  3QQA A;  3A0B C;  2E1C A;  3LOC A;  2GM4 A;  2XPU A;  3PSI A;  4FT8 A;  4PDK A;  1U3E M;  3F8B A;  4FX4 A;  2IS6 A;  1JTX A;  2ZBK A;  1B1B A;  4PGG A;  2DJI A;  4CZZ A;  3CQZ J;  2NTC A;  3CC7 I;  4XK4 A;  1DUX C;  4HW0 A;  1MDM A;  3BOQ A;  4Q4Z F;  4PSX A;  3H1C A;  2M4K A;  2HI3 A;  2L7K A;  4HRI A;  2FBI A;  2QKL B;  2W85 A;  3J7A O;  1TW2 A;  3DQV C;  3AFH A;  2PFB A;  2FD5 A;  1WJE A;  4FGN A;  1AOY A;  2KZG A;  2GWR A;  3BR1 A;  5D8L B;  5F1R A;  4IOC F;  2C6Y A;  4CHU A;  2R5Y B;  4YFK F;  3F8F A;  3VYU B;  1IDZ A;  3OYC A;  2IPR A;  3KP2 A;  3WTY C;  1IRF A;  1IXR C;  3K4B A;  4CO8 A;  3G1O A;  4OIO F;  3FBN B;  2HOE A;  1VQN I;  3K1N A;  4MEX F;  2WTE A;  2VXD A;  1BOA A;  1BJZ A;  1KQ0 A;  1XPX A;  1IGN A;  4FE7 A;  1P4W A;  4TV7 A;  4EMS A;  2QCO A;  2DFH A;  4ESJ A;  1UZC A;  2JVG A;  2GXG A;  4L9N A;  2EFN A;  2R92 J;  5J3L A;  4EQQ A;  3EQL F;  2EZH A;  2QSF X;  4P5O A;  3O8G A;  4A3M J;  3KP4 A;  1UB9 A;  4YEJ A;  2Y2Z A;  4PUS A;  3L7W A;  2JK3 A;  4MQ9 F;  4I2O A;  3CF5 F;  4L9J A;  1TNS A;  4E7K A;  2DBB A;  3K2A A;  3FXL A;  3H0G J;  1ERD A;  3E1S A;  1R58 A;  2ZNY A;  3G3Z A;  2M1B A;  4DGW B;  4E6K G;  4E7H A;  2DDA A;  3GTL J;  5HS7 A;  4MLO A;  2WB1 N;  4HEA 2;  4LLL A;  3FK6 A;  5D6E A;  3RQI A;  2X0L A;  3ZQC A;  1RET A;  3D1N I;  1MNE A;  1XSV A;  2O0Y A;  4CSW A;  2F48 A;  3KYL A;  1U8R A;  3GTJ J;  3PNY A;  3KLN A;  2AXL A;  4LB6 B;  3HRS A;  2ELH A;  1GVJ A;  2BY3 A;  1UG0 A;  2OV7 A;  4GYI A;  5EG0 A;  3BG5 A;  2R5Y A;  3LSJ A;  3LSK A;  1OYW A;  1U78 A;  2HDC A;  1OCC H;  1XGN A;  1NK3 P;  2EV0 A;  1VZ0 A;  3HOZ J;  3BTI A;  1JGS A;  4D7N A;  4P1W A;  3OYI A;  4Y3O A;  1XB4 A;  4C3I J;  1HST A;  4L5I A;  3M07 A;  1H8A C;  3A03 A;  2ETH A;  4ABZ A;  3SZG A;  2LK2 A;  1KQ9 A;  1BC8 C;  5TJJ A;  1WJD A;  4UUV A;  4PJ0 C;  2JA8 J;  1Y6I A;  5DEQ A;  3OYF A;  1X2N A;  4XRF A;  2BBY A;  4MFE A;  1ORK A;  3JRI A;  2BHZ A;  3WGI A;  4CCJ A;  2CV0 A;  1J7K A;  5J8C A;  4PJL A;  1B72 A;  3D5S C;  4IHX A;  5HVQ C;  1IUY A;  3MWM A;  2FOW A;  1W5S A;  1JKQ C;  1QPM A;  2K3P A;  2XF6 A;  4M3G A;  3VFZ A;  4K2E A;  4YIF A;  3OL3 A;  2ECB A;  1JXS A;  1APL C;  1VF9 A;  1B9N A;  2FNA A;  3HGY A;  3BLY A;  3C2H A;  3JRD A;  1DPR A;  4GO1 A;  1B9M A;  3PFY A;  2ZJR F;  3TP0 A;  3H3Z A;  2LC2 A;  2GA1 A;  4M3D A;  3NWT A;  4BHC A;  2IT0 A;  1MBH A;  1QHH D;  1IV6 A;  2BHY A;  2IA1 A;  2NVX J;  3J7A Y;  1U5T A;  2R7W A;  1XD7 A;  3MMY B;  4XMY A;  3KYD B;  3C2G A;  3S93 A;  3AAF A;  2IBD A;  1WKM A;  2A5Y B;  2P5L C;  2QA4 I;  2LSO A;  3E3V A;  1X19 A;  4OOI A;  5F27 A;  2BY2 A;  2NNY A;  2LF8 A;  2GIV A;  5CKT A;  2CW7 A;  4AIK A;  2W82 A;  2LBF A;  5EYR A;  3OYJ A;  1SEU A;  4BQA A;  1R5I D;  4XIC A;  2R7O A;  2VJJ A;  2B63 J;  5DCM B;  2FSW A;  1EH8 A;  2DA2 A;  4YFN F;  1SVL A;  3KP3 A;  3ROU A;  2P7V B;  1S8N A;  4BE2 A;  2MSY A;  5F0C A;  4DYQ A;  4XOT A;  1DGR M;  1T98 A;  1MIJ A;  5E8G A;  3RPU A;  1ZQ3 P;  4BDZ A;  4ZYD A;  5F6F A;  2V1N A;  3UKG A;  5LHH A;  3OR1 C;  4G7H F;  2ZB9 A;  1IO2 A;  5M5W J;  1S72 I;  4UB6 C;  3ZXS A;  3B73 A;  1WHU A;  3ZMS A;  2LFB A;  4U0W A;  1Z7U A;  1J9I A;  2CSO A;  3ZRG A;  3S16 J;  4ZDO A;  5K5Q A;  2NXN B;  3KFW X;  2NVY J;  1MMD A;  1EKE A;  5EZH A;  3EPZ A;  1I50 J;  2CU7 A;  3IWZ A;  1ZRC A;  1UMQ A;  4W1U A;  1ON1 A;  2H1L A;  3FMQ A;  3L09 A;  5EGO A;  2Q8K A;  3GF2 A;  2AQF A;  1SVM A;  1Y8R B;  4OMZ A;  5ILV A;  2PJR B;  2VXZ A;  2DA6 A;  3OYG A;  3BTL A;  2OQG A;  3U1K A;  5KK1 A;  5B1B H;  2E7W A;  4DYC A;  4QWQ A;  1UAA A;  2E36 A;  3K4K A;  4DYR A;  4H0E A;  2YS9 A;  2QSH X;  4CCN A;  2ZJP F;  4HBL A;  1FBU A;  2E34 A;  2OTJ I;  5D9I A;  4RLQ A;  1KU3 A;  3IV5 A;  4OWR B;  1KYW A;  4BEH B;  5KAF C;  3KCC A;  1S29 A;  5FKL A;  5K1Y A;  1Y39 A;  4M6Y A;  1SD6 A;  1XX5 A;  5HDG A;  2P81 A;  1EH6 A;  2QSG X;  4FE4 A;  2PJR A;  2NS7 A;  1AWC A;  4V2G A;  3CMM A;  3BT9 A;  3DFG A;  2XPW A;  5IP9 J;  2CFO A;  4I0A A;  4L0Y B;  1Y1V J;  5DD4 A;  4BUP A;  4LOC A;  2VE9 A;  3OYH A;  1TBD A;  3GTP J;  1F36 A;  2CUF A;  1B72 B;  4AYB A;  1F5T A;  4G6T B;  2ID3 A;  2IS1 A;  1P7I A;  2CUE A;  3JR9 A;  3H5N A;  1PVE A;  4XKW A;  2QQ8 A;  2ZFU A;  2XB0 X;  4EJW A;  1YX3 A;  5ICE A;  4IJA A;  2WAF A;  1OLT A;  2DOF A;  5B66 C;  2DMU A;  4HPQ A;  1GXQ A;  2FQ3 A;  3A01 A;  4EM0 B;  2MH9 A;  3PUF A;  1W0T A;  1DPU A;  1R71 A;  1TWC J;  1Y0N A;  2E1O A;  4HYE A;  5LRS A;  1WI3 A;  2RAE A;  5IOZ A;  4ZTJ A;  4F7Z A;  1KYZ A;  1UST A;  1CGP A;  1OCO H;  2CS3 A;  1Z9C A;  5FD6 A;  4WXD A;  3IL2 A;  2XC7 A;  4IRI A;  2FBK A;  1YQA A;  1XGS A;  4LB5 A;  2F6C A;  2JPB A;  2BZT A;  2CQN A;  3GEZ A;  1R23 A;  4NC7 A;  4UVA A;  3SXY A;  2BXY A;  3HPH A;  4DW6 A;  4NUB A;  3F21 A;  4F93 B;  3AL0 B;  4HST A;  1WJF A;  2J5P A;  3DCF A;  1YJ9 I;  5LBQ A;  3KLO A;  4KYW A;  1T0F C;  4M9Z A;  2Z33 A;  2LH9 A;  2R0Q C;  3OYD A;  1ZG1 A;  4IZZ A;  3CME I;  5DCM A;  1MH4 A;  3OWT A;  2XGC A;  5GPA A;  2DA1 A;  4CIC A;  1VQ9 I;  1FEX A;  2E1N A;  2K4B A;  3LAJ A;  4XM3 A;  2VC0 A;  3CF2 A;  3S1R J;  1YOV B;  2JSP A;  3F3X A;  2IW5 A;  2DK8 A;  3NEU A;  4N0B A;  4NQW A;  2BGC A;  3HRT A;  3AG2 H;  5JVG F;  2ADU A;  3L2U A;  1EH7 A;  1BBY A;  2Q2E B;  2X6Y A;  3Q9S A;  4ZJZ A;  3K70 C;  2A05 A;  2VBY A;  4ZH4 F;  2FBH A;  2LRD A;  1D0X A;  2EV6 A;  2E71 A;  1RRJ A;  4A12 A;  3I64 A;  2EIN H;  1NG7 A;  1IC8 A;  3TDU C;  1YS6 A;  2EK5 A;  5FLM J;  3LMM A;  2CMP A;  3I3L A;  4KT6 A;  4C2T A;  2V4J C;  5IY5 H;  2WB1 A;  2ZSI B;  4XLH A;  2JPC A;  3SFI A;  3HOW J;  5E3M A;  1YJW I;  3BPX A;  3SDG A;  5HNH A;  3OS0 A;  2F4O B;  3A1Y A;  4YFX F;  1FNN A;  5F04 A;  1S3J A;  2P8T A;  4WCG A;  3JTH A;  5IPA A;  3IRQ A;  1R9T J;  1K78 A;  3I4M J;  3S14 J;  3MKW B;  1OJL A;  4KMF A;  3N4M A;  4MFD A;  1L0O C;  1MDM B;  2JZY A;  3CCV I;  4YIR X;  2W7N A;  1OPC A;  4BKX A;  4CZC A;  1ETV A;  2X6X A;  2TDX A;  5HDN A;  3CCY A;  4HDU A;  4NB5 A;  2W1O A;  1ZG3 A;  2XSJ C;  3LSH A;  2IXS A;  2KIS A;  4HV6 A;  2R7Q A;  2KKO A;  4HA8 A;  2CQK A;  4DBR A;  2V1X A;  1BI3 A;  3BG3 A;  2CW0 F;  1XTA A;  4DIQ A;  2E5N A;  3BTJ A;  3DTI A;  1RKT A;  2EQR A;  2YX4 A;  3FXR A;  4RM3 A;  4ANJ A;  1WWX A;  4BHB A;  5HLI A;  4RB3 C;  2L4M A;  3S1N J;  4C9Y A;  3Q0U A;  2WA0 A;  3E0J B;  3I54 A;  5ED4 A;  4LK0 F;  1MD0 A;  5ICF A;  4FTH A;  3PL8 A;  3DKY A;  3BCA A;  1TBX A;  3K0L A;  1JHH A;  1VQ6 I;  4U7B A;  2M7B A;  3N05 A;  2ZCW A;  4HDV A;  3KET A;  4DJA A;  2LG4 A;  5FO5 A;  3M4O J;  2V1D A;  2IRF G;  2VIX A;  4DBQ A;  2E60 A;  5JR3 A;  1ZEL A;  1QGP A;  3CCR I;  2DLL A;  2VQG A;  2ZME C;  1TQI A;  2CH0 A;  4N4O B;  1ZLK A;  3V4G A;  3WHC A;  5LEK A;  2IVM A;  1XSD A;  1S7E A;  1I1G A;  2DT7 B;  1MSE C;  5KAI C;  2K4J A;  3K4N A;  1F1Z A;  1Z0X A;  3GLX A;  5LHI A;  3DP7 A;  1YIJ I;  1QVU A;  4KIT B;  1TWH J;  2XAQ A;  3B6A A;  2L9S A;  3IAS 2;  4M73 A;  4AC0 A;  4UNO A;  1YE9 A;  3A4C A;  1H89 C;  2DXI A;  3AG3 H;  2KPM A;  3R0J A;  4HQE A;  1NHA A;  3RTR A;  4A3C J;  5D5V B;  4JP0 A;  4BU2 A;  1FMW A;  2IA2 A;  2DA4 A;  2K3F A;  3L2W A;  2MC4 A;  2RNG A;  2WWY A;  1W1W E;  4LG0 A;  2G0E A;  3JRH A;  2PEX A;  3HOU J;  2QGU A;  2R7Z J;  3ABL H;  4ZQ9 A;  1MBJ A;  2F5E A;  2Y75 A;  2XAH A;  4QLC U;  1G59 A;  4MTD A;  1FMV A;  2IS4 A;  2PG4 A;  3VYT B;  1HA8 A;  3JRF A;  3ISP A;  3CJR B;  3A2K A;  3HGG A;  1SD4 A;  2Z2S B;  3I56 I;  4O5V A;  3V7S A;  2VAS A;  2G7U A;  2Z1D A;  1P9Q C;  3KEQ A;  2LR8 A;  2VQH A;  1ETQ A;  3BR3 A;  3CMY A;  3QP5 A;  1T6S A;  5LGT A;  5HOO A;  4EAT A;  1VI0 A;  2VB6 A;  1T95 A;  4WX9 A;  2DT6 A;  5BQT A;  3LWF A;  3G2B A;  3MD2 A;  1QBJ A;  4RBO A;  1HW5 A;  1S9H A;  1O3S A;  4CH7 A;  3F8M A;  1TT5 B;  1BIA A;  2H8R A;  1MJA A;  4KIS A;  5GAE J;  3GCM A;  1OR7 C;  2XF7 A;  4C2M J;  3J81 Z;  1TWF J;  2Y30 A;  1NTC A;  3RJP A;  3GXO A;  2HNH A;  4B09 A;  3LL7 A;  1MMN A;  3IKV A;  2XAJ A;  4M3E A;  1S5L C;  1G3Y A;  3CC4 I;  5L3E A;  4M6X A;  2ICW G;  1O3R A;  1S6L A;  3L9F A;  2ECC A;  1W7P D;  1GXP A;  1D0Y A;  1Q1H A;  2QEX I;  2EZL A;  3L2Q A;  4ZDP A;  2XGD A;  1DU0 A;  3H3V K;  1W7P B;  4Q48 A;  1ZRD A;  4ZC3 A;  1FC3 A;  2NAZ A;  2XDV A;  4OAZ A;  3RYP A;  2MYS A;  3FMS A;  2YSR A;  2R5Z B;  1WH5 A;  2XAG A;  1HDD C;  5FD5 A;  3SZT A;  3HBL A;  3M7G A;  3S1M J;  1ULY A;  3IAM 2;  4CYC B;  3QN2 A;  3V8J A;  3PFI A;  2DK5 A;  3WOD F;  4EEF G;  2RQQ A;  2XAS A;  3DF8 A;  3HKZ N;  3VYS B;  3QYF A;  2OZ6 A;  3ABK H;  3HOY J;  3M1C A;  1QNT A;  1UEL B;  1GDT A;  1PYV A;  4KMU X;  3I9V 2;  5L3C A;  5F0H A;  4OAY A;  4LD5 A;  4JX6 A;  4XLF A;  1ITY A;  5FLX Z;  1IN8 A;  3WU2 C;  1X1C A;  5EEA A;  2DMQ A;  3KYC B;  3ZCO A;  4NNJ A;  3WU1 B;  2BV6 A;  3PSF A;  4PJM A;  3L2V A;  1HC8 A;  4KNY A;  2O3F A;  2RQP A;  3BR2 A;  4M9X A;  1JKR C;  2HFH A;  2OAZ A;  2TBD A;  5CYN A;  3V7R A;  1BIB A;  5IOY A;  3TED A;  1SAN A;  3HOS A;  1T2K A;  1D8J A;  1MZB A;  4UV9 A;  3JRE A;  4BQO A;  4ENM A;  4L9T A;  5HS8 A;  1HCR A;  4S04 A;  4KJZ A;  5D5X B;  5HDK A;  1U9O A;  1V55 H;  2COM A;  2KL4 A;  4A5M A;  3LSR A;  1IAW A;  1L5I A;  3DBL B;  4G8X A;  4LIT A;  2OZU A;  2ESN A;  2IGK A;  2ZKZ A;  3GZN B;  3CDH A;  1J2X A;  4LG0 B;  3P5J A;  2ELK A;  2XGE A;  3RPU D;  2PMU A;  4IHT A;  2K9M A;  2QEN A;  4LIF A;  3K69 A;  5H6Q A;  1LQ1 A;  1K79 A;  2CO5 A;  2L5Q A;  2VBW A;  4CCO A;  2XB5 A;  1ZR4 A;  3TDZ C;  1FOW A;  3LA3 A;  4IHW A;  1VQP I;  1K61 A;  2V7F A;  4F55 A;  3CJQ B;  3CP8 A;  1LUJ B;  1CF7 B;  4LMD A;  3WG7 H;  3FXK A;  2D45 A;  1FYL A;  1T38 A;  1Z77 A;  2E7X A;  4BH9 A;  3MFK A;  2P7C B;  3RKW A;  2V79 A;  1I6H J;  1UG2 A;  1ZAO A;  2O8X A;  2PI0 A;  2LY9 A;  2WAD A;  5IT9 Z;  5HOD A;  2VJ5 A;  3SJM A;  1IRZ A;  3M8F A;  4RA2 A;  3KP7 A;  3S2D J;  3UNG C;  2Z5U A;  3EUH A;  2XGX A;  1KU9 A;  3FKJ A;  1EJ9 A;  1AKH A;  3ELK A;  5E8I A;  3CDL A;  3V42 A;  1JUM A;  3DKW A;  5BMZ A;  1JKO C;  4ZYH A;  3GWZ A;  1XMA A;  5CVJ A;  2OF7 A;  5E1X A;  3TW7 A;  5E1W A;  5GPC A;  3QU6 A;  3FHZ A;  3R6S A;  2A6H F;  1K4S A;  1J0R A;  3RKY A;  3A01 B;  4R79 A;  1X3Z B;  3KZI C;  3HYI A;  3VYR B;  5FRN A;  2FMY A;  3ZMV A;  3HRU A;  4GFB A;  4UXN A;  5HLG A;  3J7Z I;  1M1E B;  3FMR A;  4RS8 A;  4ETS A;  2DTZ A;  1R7J A;  4RAG A;  4HX8 A;  4JK1 X;  2V6E A;  2KMU A;  3OV8 A;  2IGM A;  2LF7 A;  2DN0 A;  1W5T A;  2EPF A;  4WK8 F;  3LQR A;  5M5Y J;  4ENJ A;  4CGZ A;  3QOD A;  2L0K A;  1FZP B;  1DU6 A;  3BQZ A;  2L9V A;  2QKM B;  5L3F A;  1X3W B;  3TO7 A;  3Q0V A;  1UFM A;  2L01 A;  3R4K A;  2KDZ A;  1W36 C;  1JI8 A;  4L5J A;  2EIK H;  3RPQ A;  1V5F A;  4U7D A;  2Z3Y A;  1H9G A;  4GGG A;  3PIP F;  1I1S A;  5M5X J;  2LYC A;  1ZAR A;  3QP6 A;  2ME0 A;  1JKP C;  3C18 A;  1VQL I;  1T33 A;  3CD6 I;  2IS2 A;  2AO9 A;  1Y0U A;  2F5C A;  4LK1 F;  3OYN A;  3BWG A;  1JUP A;  2K85 A;  2JA5 J;  3RKX A;  3TW6 A;  2LKS A;  5ICC A;  2IAI A;  3X2Q H;  4BAY A;  1R1T A;  2UUZ A;  2BVM A;  3ZQF A;  4BXU A;  2IJL A;  2LOO A;  9ANT A;  2B9S A;  3J80 Z;  2WAQ A;  5IYC J;  1P7J A;  3WTZ A;  4M71 A;  1R00 A;  2M45 A;  3I71 A;  3MAJ A;  2LD5 A;  4HF0 A;  4PSW A;  4IOA F;  4A3I J;  1U9N A;  2W48 A;  2V26 A;  3GFL A;  2NL8 A;  2EWN A;  3E97 A;  5EEH A;  3G4S I;  2E2J J;  4A5N A;  5JHU A;  4BJT A;  2JTV A;  3GFJ A;  1ENH A;  3QPH A;  3WGH A;  3CCJ I;  2EZI A;  2GXA A;  3CZ6 A;  2E5Z A;  3JRB A;  4KFC A;  3MZH A;  2K5C A;  3K4L A;  4I01 A;  2QBY A;  5J1Y A;  3CJN A;  4IQJ A;  2NVQ J;  1I5Z A;  3BJA A;  1JHF A;  2LP0 A;  1ZH5 A;  3GME A;  1D5V A;  2XIG A;  3WE2 A;  1IW7 F;  2HZD A;  3OOU A;  1BR2 A;  2AQE A;  5DUI A;  2BE5 F;  2FUG 2;  2QQ9 A;  2R7R A;  2M0M A;  2R5Z A;  2WY7 Q;  2OC6 A;  2HDD A;  1I27 A;  3P9I A;  1YIO A;  5GAH J;  2JA6 J;  2DFE A;  3P9C A;  5LEJ A;  1XC5 A;  2EB7 A;  4HX7 A;  2X1E A;  3AG1 H;  2VI6 A;  2AS5 F;  5C4J J;  2HW0 A;  4E7I A;  4XOP A;  4EJU A;  1YHQ I;  4KT5 C;  2GQQ A;  5EDN A;  1M55 A;  1FSH A;  4IL6 C;  4A3B J;  3H5R A;  4HV5 A;  3ZR8 X;  4RB2 C;  2MLK A;  3OIO A;  2Y48 A;  4LMY A;  3F6V A;  2E19 A;  2HQA A;  3A0H C;  2CW8 A;  2HOS A;  3IUO A;  1E17 A;  4AWX B;  3CCS I;  1V5E A;  1G3W A;  3CUO A;  2P5V A;  4AVZ A;  1EA3 A;  4CA0 A;  1MMA A;  3G71 I;  2F4I A;  4XR6 A;  4U88 A;  3ABT A;  5FKN A;  4A0Y A;  4LGW A;  5TRD A;  4Y13 A;  3NWS A;  2O61 A;  3REO A;  3WGG A;  3FM5 A;  3Q0W A;  1T56 A;  4WXC A;  1V54 H;  2XAU A;  3HHG A;  1X4O A;  3FDY A;  3OS2 A;  3H92 A;  4EV0 A;  4RMN A;  4Q5S F;  5D8K B;  2RRE A;  4DZJ A;  4S0H B;  3HSE A;  3KIO A;  2MAB A;  4P9U A;  3HKZ A;  3CCE I;  1Y1W J;  2K9L A;  4ENN A;  1RUN A;  3I59 B;  4CCM A;  1YW7 A;  2D1H A;  3OYK A;  5GTI C;  4II3 A;  1MBE A;  2R93 J;  2VOP A;  5IYD J;  2VC1 A;  2OUM A;  1FLI A;  5FKO A;  1KSY A;  1X1B A;  2XKO A;  1SFK A;  1AA7 A;  3JAM K;  2XVC A;  2MFZ A;  2DTR A;  4RGU A;  2FQ4 A;  2ITL A;  1RUO A;  1OCR H;  2KP6 A;  3LAP A;  4BY1 J;  4NBQ A;  3OIQ A;  1BR1 A;  3KZZ A;  5J40 A;  1XSX A;  2EFO A;  2Y9Y A;  2M2E A;  5LRR A;  3WTS C;  1TNT A;  3JRA A;  2XRN A;  2JUG A;  2V9P A;  4C2U A;  2VPL A;  3K4J A;  2O6G E;  4KUM A;  3H5A A;  2ZXW H;  1J5Y A;  1U8B A;  2BXZ A;  1X3U A;  2K9N A;  2X1C A;  1IXS B;  4ESB A;  2I10 A;  1E3O C;  1V4R A;  3V7C A;  1FOK A;  2R7S A;  2HOT A;  2CUJ A;  1RI7 A;  4B47 A;  1GV2 A;  4KN4 X;  1VQM I;  1D0Z A;  2L7Z A;  3I59 A;  3SZP A;  2VPR A;  2O03 A;  1MH3 A;  1YX5 A;  2NYX A;  2E1M C;  1J59 A;  3CC2 I;  3K10 A;  4D7M A;  5K7Z A;  2G9W A;  1WGX A;  3R61 A;  4ZZD A;  3ZMT A;  4B1R A;  2HVQ A;  1D8K A;  4B3X A;  2ITJ A;  1D1B A;  1KU2 A;  5JFR A;  3MKZ A;  1JGG A;  3TL4 X;  1SFX A;  1ZG5 A;  1KON A;  1UHW A;  3QPL A;  5FFX A;  2VN2 A;  3S3N A;  2QM3 A;  4HF1 A;  2DMP A;  4EVI A;  3CLO A;  2DMN A;  1MNM C;  1WZ2 A;  2GAU A;  4U0V A;  2Y69 H;  2AHQ A;  1GHC A;  5BOX A;  3I4N J;  1ETX A;  4XSX F;  1TZL A;  1U2W A;  4NC6 A;  3NAR A;  3HXL A;  3SQN A;  4QTR A;  3LNQ A;  1F4K A;  4BEH A;  3PIO F;  2H1K A;  4XRM A;  4ENK A;  1ZTR A;  2EH3 A;  2AXT C;  2M7A A;  2DCE A;  2WAQ N;  2HDW A;  3ZQ7 A;  2FUF A;  2BVL A;  4RAF A;  4V2F A;  4BXX J;  3LSG A;  3HUG A;  5B1A H;  2FML A;  2X4H A;  4R1H A;  2M5W A;  1QZE A;  2ZFW A;  1WJ5 A;  2NOG A;  3QFQ A;  4GCV A;  1D5Y A;  3OMY A;  4KIB A;  3DLA A;  2E1M B;  1O4X A;  2BYV E;  4Y7N J;  2E2I J;  2A69 F;  3GTM J;  3HSF A;  3E5U A;  2Z16 A;  1ZRE A;  2QZ8 A;  3DEE A;  4BQN A;  3W2A A;  1FOY A;  2OCC H;  2R3S A;  2DDB A;  1J75 A;  1QPI A;  2X51 A;  5LLQ A;  2DYS H;  2VE8 A;  1WJB A;  3C1D A;  2F5V A;  3G1L A;  4I99 C;  2HU9 A;  5CVU A;  2JA7 J;  5H6R A;  1GVD A;  1RZ4 A;  1IV8 A;  1R4N B;  4MEY F;  3ASN H;  1H88 C;  2DFI A;  1GLN A;  1G4D A;  2HVS A;  1Z91 A;  3IRR A;  3QYE A;  2K9S A;  1U6G A;  4RGX A;  2YU3 A;  5CJ9 A;  4BJ5 C;  1B8I B;  2FF4 A;  1YLF A;  1G6N A;  2UV1 A;  5FLX K;  3T8R A;  1WVR A;  5GTH C;  5C3E J;  5BYG A;  4JX4 A;  3VWB A;  4B4C A;  4W97 A;  1LNW A;  3K4C A;  1TL8 A;  4M3F A;  2XRL A;  4BBR J;  4ZYA A;  3HRM A;  5M3M J;  4A6D A;  5DV5 A;  1X2M A;  2FRH A;  3K7A J;  3H36 A;  4FB3 A;  1R1U A;  2IGN A;  4I98 B;  1LKX A;  5ERI A;  2ZXJ A;  3K2Z A;  4L18 B;  2OD5 A;  5JLW A;  1GT0 C;  5DM6 F;  3CUQ C;  3TGN A;  2HKO A;  3K4M A;  2KT0 A;  1TWG J;  2V6C A;  2VJ4 A;  3SDB A;  3LST A;  1ZGJ A;  5D5U B;  3S17 J;  1X1P A;  2CQX A;  4Y15 A;  4X0G A;  1SFE A;  4A3K J;  2YU9 J;  2HQ5 A;  5F1J A;  1TT0 A;  1JJ6 C;  4MIM A;  3TMO A;  2WY8 Q;  1SD7 A;  2H09 A;  2H8W A;  2OBP A;  3GYH X;  2Y0S N;  4ZYG A;  4AIH A;  2DOA A;  2WV0 A;  4GXO A;  2EBI A;  2VT2 A;  1QU3 A;  1XG1 A;  2PBI A;  1FY7 A;  1PUF B;  4Y52 J;  1RR7 A;  4D9J A;  3QOE A;  3I55 I; 
#chains in the Genus database with same CATH homology
 2OV7 A;  4ZTF A;  3VYS B;  3QYF A;  2CUZ A;  3H9Q A;  3OYM A;  3OS1 A;  3OL4 A;  3PJR A;  3EUH C;  3M1C A;  4B48 A;  3LSK A;  1UEL B;  2W00 A;  1PYV A;  3I9V 2;  1VZ0 A;  5LD2 C;  2P0W A;  4OAY A;  2KLO A;  1BR4 A;  5TGT A;  3VSL A;  4P1W A;  3OYI A;  4XLF A;  4Y3O A;  3SEZ A;  3S3O A;  5FRM A;  1X1C A;  3W2W A;  2ELJ A;  3ZCO A;  4NNJ A;  4BS9 A;  3SZG A;  1X1D A;  3PSF A;  4PJM A;  3L2V A;  2KQR A;  1WJD A;  4ITV A;  4XQF A;  3PNV A;  1Y6I A;  4RM2 A;  2TBD A;  3OY9 A;  3D5L A;  3OYF A;  5CYN A;  2KDO A;  3OR2 C;  3HOS A;  4CCJ A;  3DTK A;  2CV0 A;  4BQO A;  2R7U A;  4LIV A;  4PJL A;  3D5S C;  3HL2 A;  5HVQ C;  4KJZ A;  2BOL A;  2K3P A;  2KL4 A;  2XF6 A;  1L5I A;  3OL3 A;  2A5W A;  4LIT A;  1Z3X A;  2IGK A;  3BLY A;  1LVK A;  3C2H A;  3RPU D;  1D1A A;  3PFY A;  2K9M A;  3EUA A;  4IKF A;  4FAS D;  2LC2 A;  5CQG A;  4LIF A;  3NWT A;  1X1A A;  4NQW B;  4XLC A;  4LG3 A;  2L5Q A;  4E7S A;  1QHH D;  1PJR A;  4CCO A;  1J09 A;  2VJI A;  3J7A Y;  4HG2 A;  2R7W A;  1SAU A;  2VLA A;  2V7F A;  4PJJ A;  1BOB A;  3MMY B;  4XMY A;  3CJQ B;  3CP8 A;  4F55 A;  3C2G A;  3S93 A;  4BXF A;  1DQU A;  2M4G A;  4LMD A;  4E7L A;  3S8P A;  3M8J A;  3LSM A;  1DGW Y;  1X19 A;  3OYL A;  2HPI A;  4H4K C;  5CKT A;  3ZQQ A;  4Y4R A;  2CW7 A;  2VKD A;  3BG7 A;  3CES A;  4PFO A;  2W82 A;  2LBF A;  3OYJ A;  2WAD A;  2R7O A;  3L2R A;  2VJJ A;  2VJ5 A;  3IP4 B;  3OIP A;  4BE2 A;  4J00 A;  3UNG C;  4XOT A;  1DGR M;  3FKJ A;  2Q1Z B;  4JOM A;  4BE1 A;  4PK4 A;  3DWL E;  4BDZ A;  2V1N A;  5KCM A;  5CPR B;  3RSN A;  3V42 A;  3OR1 C;  2L2O A;  3ZXS A;  5FRO A;  4N4N B;  3GBG A;  3FHN A;  1LDK B;  4F3Q A;  3ZRG A;  2IF9 A;  4ZDO A;  1MW7 A;  1IRX A;  3BC8 A;  1MMD A;  2KHM A;  1DP3 A;  3EPZ A;  4R79 A;  3VYR B;  5FRN A;  4DOZ A;  2V6E A;  3QYB A;  2AQF A;  2KMU A;  2IGM A;  2PJR B;  2VXZ A;  3OYG A;  2IGO A;  3QOD A;  2GOM A;  2VQC A;  3DU5 A;  2HVR A;  1WJA A;  2QKM B;  1UAA A;  1JI8 A;  1W36 C;  3K4K A;  1Z21 A;  1V5F A;  4D1Q A;  2LRE A;  4CCN A;  1F08 A;  5KHD A;  4XL9 A;  2LYC A;  2ZXH A;  2O5R A;  1R9W A;  5D9I A;  4RLQ A;  4OWR B;  4BEH B;  2IS2 A;  2PMZ A;  2KZV A;  2WBM A;  3OYN A;  4BL0 B;  1Z1D B;  4NC8 A;  4JQF A;  4BAC A;  2PJR A;  2UUZ A;  2X1D A;  2BVM A;  3CMM A;  1W36 D;  1G8X A;  3AL0 C;  1WJC A;  2CFO A;  2LOO A;  4XOR A;  2WAQ A;  4BUP A;  1TBD A;  3OYH A;  3SEQ A;  3LSI A;  4PSW A;  4AYB A;  2VKH A;  4CCK A;  2V26 A;  4G6T B;  2NL8 A;  2IS1 A;  3H5N A;  3DPU A;  3K6G A;  4XKW A;  4XKV A;  4BJT A;  3VSK A;  2ZFU A;  5DCX A;  3H0D A;  3CZ6 A;  2E5Z A;  1YX3 A;  2WAF A;  1OLT A;  2NOJ B;  2K5C A;  3K4L A;  3W3C A;  4IQJ A;  4HPQ A;  1K6Y A;  4XN3 A;  2VL8 A;  2HZD A;  3UR3 C;  3OOU A;  1BR2 A;  4J01 A;  3F9K A;  2AQE A;  3K70 D;  4C30 A;  2FUG 2;  4ZTJ A;  3U21 A;  2R7R A;  2VQL A;  2M0M A;  3HUG B;  3D5R C;  2WY7 Q;  2ZXI A;  2OC6 A;  4QPO A;  2CS3 A;  2WAE A;  2XC7 A;  2X1E A;  4YRV A;  2F6C A;  2KRC A;  3W2V A;  4NC7 A;  2ZSH B;  3HPH A;  2HW0 A;  4NUB A;  4F93 B;  3AL0 B;  4E7I A;  4HST A;  4XOP A;  1WJF A;  4XLA A;  4AU7 A;  1M55 A;  3H5R A;  3ZR8 X;  1T0F C;  4KW3 A;  2LH9 A;  1QHG A;  2L9N A;  4Y33 A;  3OYD A;  4IZZ A;  1LFP A;  2HQA A;  3OWT A;  2CW8 A;  3IUO A;  1V5E A;  4AVZ A;  1EA3 A;  3CF2 A;  4XM3 A;  4CA0 A;  4F92 B;  1MMA A;  1MMG A;  2JSP A;  2F4I A;  2M3A A;  4XR6 A;  4XNF A;  3RQ4 A;  4GDF A;  5KNL A;  2LY1 A;  3DKX A;  3NWS A;  2MD0 A;  3AKZ A;  3L2U A;  2Q2E B;  2X6Y A;  2XAU A;  4HNU A;  1U0J A;  4ZJZ A;  3K70 C;  1X4O A;  2XF5 A;  3H35 A;  3FDY A;  3OS2 A;  4BQQ A;  3SYT A;  4RMN A;  2JA2 A;  2LRD A;  2RRE A;  2BW3 A;  3CP2 A;  2CV1 A;  1D0X A;  2MAB A;  3HKZ A;  2K9L A;  4CCM A;  3OYK A;  1NG7 A;  4II3 A;  4HNT A;  3OYB A;  4GRI A;  3LMM A;  2OUM A;  4FET A;  1KSY A;  1X1B A;  2CMP A;  3DPL C;  1SFK A;  3I3L A;  1AA7 A;  4KT6 A;  4C2T A;  2V4J C;  2WB1 A;  2MFZ A;  2Y0S A;  2ITL A;  1X4P A;  2KP6 A;  2ZSI B;  5HNF A;  5HLT A;  4XLH A;  3ONQ A;  3HG9 A;  1BR1 A;  3OIQ A;  4F91 B;  2W4S A;  5HNH A;  2CV2 A;  3OS0 A;  3A1Y A;  2JUG A;  4C2U A;  2VPL A;  3K4J A;  3DTE A;  2A6T A;  3H5A A;  2LY2 A;  2X6W A;  4LIU A;  3FBI B;  3MKW B;  1NG6 A;  2X1C A;  3H9J A;  4BDY A;  3RCO A;  2W7N A;  4CZC A;  4BGD A;  2X6X A;  4B44 A;  1Z7L A;  2R7S A;  2CUJ A;  4F52 A;  4B47 A;  2I8D A;  2W1O A;  3BG6 A;  4B43 A;  2XSJ C;  3LSH A;  1D0Z A;  2IXS A;  4XKC A;  2R7Q A;  2GOX B;  4DBR A;  2BW3 B;  4DIQ A;  2E5N A;  3PUB A;  1YX5 A;  3DTI A;  2E1M C;  4RM3 A;  4YEL A;  2R7X A;  4NBP A;  4XN0 A;  4ANJ A;  1WFX A;  3K10 A;  1RZ9 A;  2HVQ A;  4C9Y A;  4E7Z A;  2WA0 A;  3E0J B;  1V5G A;  3TBI A;  4B3X A;  2ITJ A;  4BJ6 C;  1D1B A;  3ZGK A;  3PNT A;  4QPQ A;  3EUK L;  3PL8 A;  3MKY B;  3MKZ A;  3OYE A;  3DKY A;  3BCA A;  3TL4 X;  2R7V A;  1KON A;  3KX2 A;  4BE0 A;  4U7B A;  3S3N A;  2M7B A;  3N05 A;  3QK2 A;  1D1C A;  1MND A;  4DJA A;  2LBF B;  2LG4 A;  3HOT A;  3BCB A;  2VIX A;  4DBQ A;  2E60 A;  1ZEL A;  1TZL A;  2VQG A;  2V9K A;  2R4G A;  4ZO0 A;  2UWM A;  2CH0 A;  5CQE A;  4N4O B;  3HXL A;  4PJN A;  3DU6 A;  4U87 A;  4BEH A;  2DT7 B;  4ZDL A;  2M7A A;  4E7J A;  4E4H A;  3K4N A;  2DCE A;  1R6R A;  2HDW A;  1N78 A;  4CCL A;  2FUF A;  2BVL A;  4KIT B;  2L9S A;  4XON A;  3IAS 2;  3HC7 A;  3LSG A;  4PFP A;  1YE9 A;  4XKB A;  3A4C A;  2DXI A;  1UUT A;  2KPM A;  3PSI A;  1WJ5 A;  3RTR A;  3QFQ A;  2IS6 A;  1N75 A;  4II2 A;  3OMY A;  3DLA A;  5JHF A;  4BU2 A;  2DJI A;  1FMW A;  2E1M B;  3OYA A;  3L2W A;  2NTC A;  2MC4 A;  2RNG A;  2Z16 A;  2KRH A;  3DEE A;  4BQN A;  4PSX A;  3W2A A;  2M4K A;  2L7K A;  4HRI A;  3KEY A;  2X51 A;  2HPM A;  4ZQ9 A;  2X85 A;  3S3M A;  1WJB A;  2QKL B;  2F5V A;  4XLE A;  3DQV C;  2HU9 A;  3AFH A;  1G59 A;  4HSR A;  1FMV A;  2IS4 A;  1WJE A;  3VYT B;  2HVS A;  1HA8 A;  1GLN A;  3H9G A;  4FGN A;  3CJR B;  5LFA A;  3A2K A;  3QYE A;  2JVH A;  2Z2S B;  4BJ5 C;  2VAS A;  2R7T A;  2Z1D A;  3VYU B;  3OYC A;  2IPR A;  1P9Q C;  2VQH A;  2UV1 A;  3K4B A;  4IX7 A;  5HOO A;  4EAT A;  1N77 A;  2VB6 A;  1T95 A;  3FBN B;  2DT6 A;  1Z3Y A;  3HPG A;  1E0E A;  5BYG A;  3G2B A;  3MD2 A;  1S9H A;  3VWB A;  4CH7 A;  2VXD A;  3K4C A;  4ZYA A;  1L2M A;  4KIS A;  2JVG A;  4FB3 A;  1OR7 C;  2IGN A;  2XF7 A;  1LKX A;  3DPT A;  2HNH A;  4P5O A;  3LL7 A;  3S32 A;  1MMN A;  4YEJ A;  4PUS A;  3K4M A;  1Y56 A;  2VJ4 A;  3SDB A;  1D0Y A;  4X0G A;  4E7K A;  4RLF A;  1KSX A;  3L2Q A;  4ZDP A;  1TT0 A;  1ERD A;  3E1S A;  4ZC3 A;  2XDV A;  4OAZ A;  2WY8 Q;  3TMO A;  4DGW B;  3LFU A;  4E6K G;  2MYS A;  4E7H A;  4MLO A;  4HEA 2;  3VDX A;  4CUG A;  2DOA A;  1MNE A;  4CSW A;  1QU3 A;  3KYL A;  3IAM 2;  4IQ4 A;  4D9J A;  3PNY A;  3QOE A;  3QN2 A;  1UG0 A;  2RQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...