The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
145
|
structure length |
138
|
Chain Sequence |
KQGAMLAVFKDTYGLSFTDLVRTCTDWVTAIFGVNPTIAEGFKTLIQPFILYAHIQCLDCKWGVLILALLRYKCGKSRLTVAKGLSTLLHVPETCMLIQPPKLRSSVAALYWYRTGISNISEVMGDTPEWIQRLTIIQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The DNA-binding domain of human papillomavirus type 18 E1. Crystal structure, dimerization, and DNA binding.
pubmed doi rcsb |
molecule tags |
Replication
|
source organism |
Human papillomavirus type 18
|
molecule keywords |
Replication protein E1
|
total genus |
38
|
structure length |
138
|
sequence length |
145
|
ec nomenclature |
ec
3.6.4.12: DNA helicase. |
pdb deposition date | 2003-10-31 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Replication Protein E1; Chain: A, | Replication Protein E1; Chain: A, |
#chains in the Genus database with same CATH superfamily 1R9W A; 1KSY A; 1KSX A; 1F08 A; #chains in the Genus database with same CATH topology 2NL8 A; 2TBD A; 4GDF A; 3DKX A; 5BYG A; 3QN2 A; 1UUT A; 1L2M A; 4NBP A; 2IPR A; 3QK2 A; 1TBD A; 2IF9 A; 4KW3 A; 1KSY A; 5CYN A; 2ITJ A; 4LMD A; 4LIF A; 1KSX A; 1Z1D B; 1R9W A; 1F08 A; 1RZ9 A; 2FUF A; 4FGN A; 2HW0 A; 3QFQ A; 2ITL A; 1M55 A; 4FB3 A; 4U87 A; 4ZQ9 A; 5DCX A; 5D9I A; 2NTC A; 4ZO0 A; 3DKY A; 1L5I A; #chains in the Genus database with same CATH homology 2NL8 A; 2TBD A; 4GDF A; 3DKX A; 5BYG A; 3QN2 A; 1UUT A; 1L2M A; 4NBP A; 2IPR A; 3QK2 A; 1TBD A; 2IF9 A; 4KW3 A; 1KSY A; 5CYN A; 2ITJ A; 4LMD A; 4LIF A; 1KSX A; 1Z1D B; 1R9W A; 1F08 A; 1RZ9 A; 2FUF A; 4FGN A; 2HW0 A; 3QFQ A; 2ITL A; 1M55 A; 4FB3 A; 4U87 A; 4ZQ9 A; 5DCX A; 5D9I A; 2NTC A; 4ZO0 A; 3DKY A; 1L5I A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...