1ADZA

The solution structure of the second kunitz domain of tissue factor pathway inhibitor, nmr, 30 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
71
structure length
71
Chain Sequence
DYKDDDDKLKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TISSUE FACTOR PATHWAY INHIBITOR
publication title The second Kunitz domain of human tissue factor pathway inhibitor: cloning, structure determination and interaction with factor Xa.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1997-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 1adzA00
2KCRA 1KIGI 5JB6A 1UUAA 1OA65 3L33E 4WXVC 4NTWB 1YKTB 2TPII 5C67C 4U30W 1ZJDB 1TAPA 4NTYB 1BRCI 1JV9A 3D65I 1FY8I 3BYBA 1F5RI 3BTQI 2ZVXA 1ZR0B 1BTHP 2J6DA 3TPII 1JC6A 3TGKI 3U1JE 1TAWB 1AALA 2FI3I 5PTIA 3AUHA 1DEMA 3BTGI 1DTKA 2KNTA 4ISNB 4Y0YI 5JB4A 3AUGA 1OA55 4Y10I 2UUYB 1BRBI 3FP7J 2JOTA 1AAPA 1P2KI 1B0CA 4PTIA 1ADZA 1BPTA 3L3TE 1BUNB 1Y62A 2UUXA 1FAKI 1EJMB 2R9PE 4WWYC 1LD5A 1F7ZI 1SHPA 3BTDI 4Y0ZI 1LD6A 1MTND 7PTIA 2DDIA 1IRHA 4BD9B 3TGJI 3BTWI 1EAWB 1UUBA 1CBWD 1BF0A 1T8OB 4DG4C 4NTXB 3OTJI 2M01A 3TGII 1TOCR 1KTHA 2LFLA 1CA0D 3AUEA 4ISOB 5JB7A 1JV8A 2KAII 2FI4I 2PTCI 4ISLB 9PTIA 4BQDA 1P2NB 3P95E 1TFXC 1BIKA 3BTEI 1NAGA 4BNRI 3AUIA 3GYMI 1P2JI 2HEXA 6PTIA 3BTFI 1BPIA 1BZ5A 8PTIA 1T8MB 1P2II 1P2MB 1BTIA 1K6UA 2CA7A 3FP6I 3P92E 3CI7A 4DTGK 1DTXA 3LDMA 1P2OB 1YLDB 2FTLI 3BTMI 2IJOI 1G6XA 2M99A 3UOUB 3LDIA 1T8NB 2DDJA 2LFKA 3WNYA 1PITA 1BZXI 1KUNA 1T8LB 1TCPA 3AUCA 1QLQA 3BTKI 3AUBA 4Y11I 2W8XA 4U32X 5JB5A 1KNTA 1TPAI 1BHCA 2FI5I 1DENA 3UIRC 3M7QB 1FANA 2ODYE 1CO7I 1D0DA 3AUDA 3LDJA 3T62D 1P2QB 1D0DB 1T7CB 2TGPI 3BTHI 2RA3C 2ZJXA 1YC0I 3BTTI 2FTMB 3OFWA 4TPII 3FP8I 1YLCB
chains in the Genus database with same CATH superfamily
2KCRA 1KIGI 5JB6A 1UUAA 1OA65 3L33E 4WXVC 4NTWB 1YKTB 2TPII 5C67C 4U30W 1ZJDB 1TAPA 4NTYB 1BRCI 1JV9A 3D65I 1FY8I 3BYBA 1F5RI 3BTQI 2ZVXA 1ZR0B 1BTHP 2J6DA 3TPII 1JC6A 3TGKI 3U1JE 1TAWB 1AALA 2FI3I 5PTIA 3AUHA 1DEMA 3BTGI 1DTKA 2KNTA 4ISNB 4Y0YI 5JB4A 3AUGA 1OA55 4Y10I 2UUYB 1BRBI 3FP7J 2JOTA 1AAPA 1P2KI 1B0CA 4PTIA 1ADZA 1BPTA 3L3TE 1BUNB 1Y62A 2UUXA 1FAKI 1EJMB 2R9PE 4WWYC 1LD5A 1F7ZI 1SHPA 3BTDI 4Y0ZI 1LD6A 1MTND 7PTIA 2DDIA 1IRHA 4BD9B 3TGJI 3BTWI 1EAWB 1UUBA 1CBWD 1BF0A 1T8OB 4DG4C 4NTXB 3OTJI 2M01A 3TGII 1TOCR 1KTHA 2LFLA 1CA0D 3AUEA 4ISOB 5JB7A 1JV8A 2KAII 2FI4I 2PTCI 4ISLB 9PTIA 4BQDA 1P2NB 3P95E 1TFXC 1BIKA 3BTEI 1NAGA 4BNRI 3AUIA 3GYMI 1P2JI 2HEXA 6PTIA 3BTFI 1BPIA 1BZ5A 8PTIA 1T8MB 1P2II 1P2MB 1BTIA 1K6UA 2CA7A 3FP6I 3P92E 3CI7A 4DTGK 1DTXA 3LDMA 1P2OB 1YLDB 2FTLI 3BTMI 2IJOI 1G6XA 2M99A 3UOUB 3LDIA 1T8NB 2DDJA 2LFKA 3WNYA 1PITA 1BZXI 1KUNA 1T8LB 1TCPA 3AUCA 1QLQA 3BTKI 3AUBA 4Y11I 2W8XA 4U32X 5JB5A 1KNTA 1TPAI 1BHCA 2FI5I 1DENA 3UIRC 3M7QB 1FANA 2ODYE 1CO7I 1D0DA 3AUDA 3LDJA 3T62D 1P2QB 1D0DB 1T7CB 2TGPI 3BTHI 2RA3C 2ZJXA 1YC0I 3BTTI 2FTMB 3OFWA 4TPII 3FP8I 1YLCB
chains in the Genus database with same CATH topology
2KCRA 1KIGI 5JB6A 1UUAA 1OA65 3L33E 4WXVC 4NTWB 1YKTB 2TPII 5C67C 4U30W 1ZJDB 1TAPA 4NTYB 1BRCI 1JV9A 3D65I 1FY8I 3BYBA 1F5RI 3BTQI 2ZVXA 1ZR0B 1BTHP 2J6DA 3TPII 1JC6A 3TGKI 3U1JE 1TAWB 1AALA 2FI3I 5PTIA 3AUHA 1DEMA 3BTGI 1DTKA 2KNTA 4ISNB 4Y0YI 5JB4A 3AUGA 1OA55 4Y10I 2UUYB 1BRBI 3FP7J 2JOTA 1AAPA 1P2KI 1B0CA 4PTIA 1ADZA 1BPTA 3L3TE 1BUNB 1Y62A 2UUXA 1FAKI 1EJMB 2R9PE 4WWYC 1LD5A 1F7ZI 1SHPA 3BTDI 4Y0ZI 1LD6A 1MTND 7PTIA 2DDIA 1IRHA 4BD9B 3TGJI 3BTWI 1EAWB 1UUBA 1CBWD 1BF0A 1T8OB 4DG4C 4NTXB 3OTJI 2M01A 3TGII 1TOCR 1KTHA 2LFLA 1CA0D 3AUEA 4ISOB 5JB7A 1JV8A 2KAII 2FI4I 2PTCI 4ISLB 9PTIA 4BQDA 1P2NB 3P95E 1TFXC 1BIKA 3BTEI 1NAGA 4BNRI 3AUIA 3GYMI 1P2JI 2HEXA 6PTIA 3BTFI 1BPIA 1BZ5A 8PTIA 1T8MB 1P2II 1P2MB 1BTIA 1K6UA 2CA7A 3FP6I 3P92E 3CI7A 4DTGK 1DTXA 3LDMA 1P2OB 1YLDB 2FTLI 3BTMI 2IJOI 1G6XA 2M99A 3UOUB 3LDIA 1T8NB 2DDJA 2LFKA 3WNYA 1PITA 1BZXI 1KUNA 1T8LB 1TCPA 3AUCA 1QLQA 3BTKI 3AUBA 4Y11I 2W8XA 4U32X 5JB5A 1KNTA 1TPAI 1BHCA 2FI5I 1DENA 3UIRC 3M7QB 1FANA 2ODYE 1CO7I 1D0DA 3AUDA 3LDJA 3T62D 1P2QB 1D0DB 1T7CB 2TGPI 3BTHI 2RA3C 2ZJXA 1YC0I 3BTTI 2FTMB 3OFWA 4TPII 3FP8I 1YLCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCR A;  1KIG I;  5JB6 A;  1UUA A;  1OA6 5;  3L33 E;  4WXV C;  4NTW B;  1YKT B;  2TPI I;  5C67 C;  4U30 W;  1ZJD B;  1TAP A;  4NTY B;  1BRC I;  1JV9 A;  3D65 I;  1FY8 I;  3BYB A;  1F5R I;  3BTQ I;  2ZVX A;  1ZR0 B;  1BTH P;  2J6D A;  3TPI I;  1JC6 A;  3TGK I;  3U1J E;  1TAW B;  1AAL A;  2FI3 I;  5PTI A;  3AUH A;  1DEM A;  3BTG I;  1DTK A;  2KNT A;  4ISN B;  4Y0Y I;  5JB4 A;  3AUG A;  1OA5 5;  4Y10 I;  2UUY B;  1BRB I;  3FP7 J;  2JOT A;  1AAP A;  1P2K I;  1B0C A;  4PTI A;  1ADZ A;  1BPT A;  3L3T E;  1BUN B;  1Y62 A;  2UUX A;  1FAK I;  1EJM B;  2R9P E;  4WWY C;  1LD5 A;  1F7Z I;  1SHP A;  3BTD I;  4Y0Z I;  1LD6 A;  1MTN D;  7PTI A;  2DDI A;  1IRH A;  4BD9 B;  3TGJ I;  3BTW I;  1EAW B;  1UUB A;  1CBW D;  1BF0 A;  1T8O B;  4DG4 C;  4NTX B;  3OTJ I;  2M01 A;  3TGI I;  1TOC R;  1KTH A;  2LFL A;  1CA0 D;  3AUE A;  4ISO B;  5JB7 A;  1JV8 A;  2KAI I;  2FI4 I;  2PTC I;  4ISL B;  9PTI A;  4BQD A;  1P2N B;  3P95 E;  1TFX C;  1BIK A;  3BTE I;  1NAG A;  4BNR I;  3AUI A;  3GYM I;  1P2J I;  2HEX A;  6PTI A;  3BTF I;  1BPI A;  1BZ5 A;  8PTI A;  1T8M B;  1P2I I;  1P2M B;  1BTI A;  1K6U A;  2CA7 A;  3FP6 I;  3P92 E;  3CI7 A;  4DTG K;  1DTX A;  3LDM A;  1P2O B;  1YLD B;  2FTL I;  3BTM I;  2IJO I;  1G6X A;  2M99 A;  3UOU B;  3LDI A;  1T8N B;  2DDJ A;  2LFK A;  3WNY A;  1PIT A;  1BZX I;  1KUN A;  1T8L B;  1TCP A;  3AUC A;  1QLQ A;  3BTK I;  3AUB A;  4Y11 I;  2W8X A;  4U32 X;  5JB5 A;  1KNT A;  1TPA I;  1BHC A;  2FI5 I;  1DEN A;  3UIR C;  3M7Q B;  1FAN A;  2ODY E;  1CO7 I;  1D0D A;  3AUD A;  3LDJ A;  3T62 D;  1P2Q B;  1D0D B;  1T7C B;  2TGP I;  3BTH I;  2RA3 C;  2ZJX A;  1YC0 I;  3BTT I;  2FTM B;  3OFW A;  4TPI I;  3FP8 I;  1YLC B; 
#chains in the Genus database with same CATH topology
 2KCR A;  1KIG I;  5JB6 A;  1UUA A;  1OA6 5;  3L33 E;  4WXV C;  4NTW B;  1YKT B;  2TPI I;  5C67 C;  4U30 W;  1ZJD B;  1TAP A;  4NTY B;  1BRC I;  1JV9 A;  3D65 I;  1FY8 I;  3BYB A;  1F5R I;  3BTQ I;  2ZVX A;  1ZR0 B;  1BTH P;  2J6D A;  3TPI I;  1JC6 A;  3TGK I;  3U1J E;  1TAW B;  1AAL A;  2FI3 I;  5PTI A;  3AUH A;  1DEM A;  3BTG I;  1DTK A;  2KNT A;  4ISN B;  4Y0Y I;  5JB4 A;  3AUG A;  1OA5 5;  4Y10 I;  2UUY B;  1BRB I;  3FP7 J;  2JOT A;  1AAP A;  1P2K I;  1B0C A;  4PTI A;  1ADZ A;  1BPT A;  3L3T E;  1BUN B;  1Y62 A;  2UUX A;  1FAK I;  1EJM B;  2R9P E;  4WWY C;  1LD5 A;  1F7Z I;  1SHP A;  3BTD I;  4Y0Z I;  1LD6 A;  1MTN D;  7PTI A;  2DDI A;  1IRH A;  4BD9 B;  3TGJ I;  3BTW I;  1EAW B;  1UUB A;  1CBW D;  1BF0 A;  1T8O B;  4DG4 C;  4NTX B;  3OTJ I;  2M01 A;  3TGI I;  1TOC R;  1KTH A;  2LFL A;  1CA0 D;  3AUE A;  4ISO B;  5JB7 A;  1JV8 A;  2KAI I;  2FI4 I;  2PTC I;  4ISL B;  9PTI A;  4BQD A;  1P2N B;  3P95 E;  1TFX C;  1BIK A;  3BTE I;  1NAG A;  4BNR I;  3AUI A;  3GYM I;  1P2J I;  2HEX A;  6PTI A;  3BTF I;  1BPI A;  1BZ5 A;  8PTI A;  1T8M B;  1P2I I;  1P2M B;  1BTI A;  1K6U A;  2CA7 A;  3FP6 I;  3P92 E;  3CI7 A;  4DTG K;  1DTX A;  3LDM A;  1P2O B;  1YLD B;  2FTL I;  3BTM I;  2IJO I;  1G6X A;  2M99 A;  3UOU B;  3LDI A;  1T8N B;  2DDJ A;  2LFK A;  3WNY A;  1PIT A;  1BZX I;  1KUN A;  1T8L B;  1TCP A;  3AUC A;  1QLQ A;  3BTK I;  3AUB A;  4Y11 I;  2W8X A;  4U32 X;  5JB5 A;  1KNT A;  1TPA I;  1BHC A;  2FI5 I;  1DEN A;  3UIR C;  3M7Q B;  1FAN A;  2ODY E;  1CO7 I;  1D0D A;  3AUD A;  3LDJ A;  3T62 D;  1P2Q B;  1D0D B;  1T7C B;  2TGP I;  3BTH I;  2RA3 C;  2ZJX A;  1YC0 I;  3BTT I;  2FTM B;  3OFW A;  4TPI I;  3FP8 I;  1YLC B; 
#chains in the Genus database with same CATH homology
 2KCR A;  1KIG I;  5JB6 A;  1UUA A;  1OA6 5;  3L33 E;  4WXV C;  4NTW B;  1YKT B;  2TPI I;  5C67 C;  4U30 W;  1ZJD B;  1TAP A;  4NTY B;  1BRC I;  1JV9 A;  3D65 I;  1FY8 I;  3BYB A;  1F5R I;  3BTQ I;  2ZVX A;  1ZR0 B;  1BTH P;  2J6D A;  3TPI I;  1JC6 A;  3TGK I;  3U1J E;  1TAW B;  1AAL A;  2FI3 I;  5PTI A;  3AUH A;  1DEM A;  3BTG I;  1DTK A;  2KNT A;  4ISN B;  4Y0Y I;  5JB4 A;  3AUG A;  1OA5 5;  4Y10 I;  2UUY B;  1BRB I;  3FP7 J;  2JOT A;  1AAP A;  1P2K I;  1B0C A;  4PTI A;  1ADZ A;  1BPT A;  3L3T E;  1BUN B;  1Y62 A;  2UUX A;  1FAK I;  1EJM B;  2R9P E;  4WWY C;  1LD5 A;  1F7Z I;  1SHP A;  3BTD I;  4Y0Z I;  1LD6 A;  1MTN D;  7PTI A;  2DDI A;  1IRH A;  4BD9 B;  3TGJ I;  3BTW I;  1EAW B;  1UUB A;  1CBW D;  1BF0 A;  1T8O B;  4DG4 C;  4NTX B;  3OTJ I;  2M01 A;  3TGI I;  1TOC R;  1KTH A;  2LFL A;  1CA0 D;  3AUE A;  4ISO B;  5JB7 A;  1JV8 A;  2KAI I;  2FI4 I;  2PTC I;  4ISL B;  9PTI A;  4BQD A;  1P2N B;  3P95 E;  1TFX C;  1BIK A;  3BTE I;  1NAG A;  4BNR I;  3AUI A;  3GYM I;  1P2J I;  2HEX A;  6PTI A;  3BTF I;  1BPI A;  1BZ5 A;  8PTI A;  1T8M B;  1P2I I;  1P2M B;  1BTI A;  1K6U A;  2CA7 A;  3FP6 I;  3P92 E;  3CI7 A;  4DTG K;  1DTX A;  3LDM A;  1P2O B;  1YLD B;  2FTL I;  3BTM I;  2IJO I;  1G6X A;  2M99 A;  3UOU B;  3LDI A;  1T8N B;  2DDJ A;  2LFK A;  3WNY A;  1PIT A;  1BZX I;  1KUN A;  1T8L B;  1TCP A;  3AUC A;  1QLQ A;  3BTK I;  3AUB A;  4Y11 I;  2W8X A;  4U32 X;  5JB5 A;  1KNT A;  1TPA I;  1BHC A;  2FI5 I;  1DEN A;  3UIR C;  3M7Q B;  1FAN A;  2ODY E;  1CO7 I;  1D0D A;  3AUD A;  3LDJ A;  3T62 D;  1P2Q B;  1D0D B;  1T7C B;  2TGP I;  3BTH I;  2RA3 C;  2ZJX A;  1YC0 I;  3BTT I;  2FTM B;  3OFW A;  4TPI I;  3FP8 I;  1YLC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...