1BF0A

Calcicludine (cac) from green mamba dendroaspis angusticeps, nmr, 15 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Calcium channel blocker
molecule keywords CALCICLUDINE
publication title Conformational and functional variability supported by the BPTI fold: solution structure of the Ca2+ channel blocker calcicludine.
pubmed doi rcsb
source organism Dendroaspis angusticeps
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1998-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 1bf0A00
4U32X 4Y0ZI 3BYBA 4BQDA 2M01A 1EAWB 1BUNB 1NAGA 2HEXA 1FAKI 2J6DA 2ZVXA 2RA3C 2UUXA 4Y11I 1JV9A 1FY8I 4WWYC 4Y10I 1AALA 1TAWB 3BTMI 1P2NB 1B0CA 4PTIA 3UOUB 2KAII 1BF0A 1T7CB 2FTLI 2W8XA 3L3TE 2R9PE 3AUEA 1P2QB 4Y0YI 2ODYE 1T8LB 2ZJXA 3TGKI 2IJOI 3AUHA 1KTHA 1YC0I 3AUDA 2KNTA 5PTIA 4BNRI 5JB6A 9PTIA 3LDJA 1FANA 3WNYA 1CO7I 1G6XA 4DTGK 1T8OB 1JV8A 3TGII 1UUBA 2TPII 3AUGA 3UIRC 4BD9B 1P2JI 3AUBA 4DG4C 3LDIA 1KIGI 1TAPA 1BZXI 2DDJA 1SHPA 3D65I 4NTYB 4ISLB 2LFKA 1YLCB 1P2KI 3P95E 1P2II 1JC6A 3GYMI 1BTHP 1OA55 1TOCR 3LDMA 3M7QB 3TPII 4NTWB 1UUAA 2UUYB 1CA0D 2CA7A 1BHCA 1BIKA 2FI4I 5JB7A 1MTND 3AUCA 3BTGI 5C67C 1P2MB 3FP7J 3P92E 3BTEI 3OFWA 3L33E 4WXVC 1Y62A 1YLDB 3FP6I 1P2OB 2KCRA 1LD5A 1T8NB 3BTFI 4NTXB 3CI7A 1LD6A 1TFXC 1TCPA 1DENA 1DTXA 3FP8I 1T8MB 8PTIA 1AAPA 1YKTB 1ZJDB 3BTQI 1BRCI 3BTKI 2FI3I 2TGPI 1BRBI 1KUNA 2DDIA 1F5RI 4U30W 1EJMB 3AUIA 1BPIA 3BTTI 5JB4A 2LFLA 1IRHA 1K6UA 1PITA 6PTIA 4ISOB 4ISNB 1D0DA 5JB5A 1BZ5A 1DEMA 1KNTA 1BPTA 1CBWD 2PTCI 3BTDI 2FTMB 3OTJI 1DTKA 7PTIA 3BTWI 1ZR0B 1QLQA 1F7ZI 2JOTA 1BTIA 1D0DB 2FI5I 1OA65 3U1JE 3TGJI 2M99A 3BTHI 4TPII 1ADZA 3T62D 1TPAI
chains in the Genus database with same CATH superfamily
4U32X 4Y0ZI 3BYBA 4BQDA 2M01A 1EAWB 1BUNB 1NAGA 2HEXA 1FAKI 2J6DA 2ZVXA 2RA3C 2UUXA 4Y11I 1JV9A 1FY8I 4WWYC 4Y10I 1AALA 1TAWB 3BTMI 1P2NB 1B0CA 4PTIA 3UOUB 2KAII 1BF0A 1T7CB 2FTLI 2W8XA 3L3TE 2R9PE 3AUEA 1P2QB 4Y0YI 2ODYE 1T8LB 2ZJXA 3TGKI 2IJOI 3AUHA 1KTHA 1YC0I 3AUDA 2KNTA 5PTIA 4BNRI 5JB6A 9PTIA 3LDJA 1FANA 3WNYA 1CO7I 1G6XA 4DTGK 1T8OB 1JV8A 3TGII 1UUBA 2TPII 3AUGA 3UIRC 4BD9B 1P2JI 3AUBA 4DG4C 3LDIA 1KIGI 1TAPA 1BZXI 2DDJA 1SHPA 3D65I 4NTYB 4ISLB 2LFKA 1YLCB 1P2KI 3P95E 1P2II 1JC6A 3GYMI 1BTHP 1OA55 1TOCR 3LDMA 3M7QB 3TPII 4NTWB 1UUAA 2UUYB 1CA0D 2CA7A 1BHCA 1BIKA 2FI4I 5JB7A 1MTND 3AUCA 3BTGI 5C67C 1P2MB 3FP7J 3P92E 3BTEI 3OFWA 3L33E 4WXVC 1Y62A 1YLDB 3FP6I 1P2OB 2KCRA 1LD5A 1T8NB 3BTFI 4NTXB 3CI7A 1LD6A 1TFXC 1TCPA 1DENA 1DTXA 3FP8I 1T8MB 8PTIA 1AAPA 1YKTB 1ZJDB 3BTQI 1BRCI 3BTKI 2FI3I 2TGPI 1BRBI 1KUNA 2DDIA 1F5RI 4U30W 1EJMB 3AUIA 1BPIA 3BTTI 5JB4A 2LFLA 1IRHA 1K6UA 1PITA 6PTIA 4ISOB 4ISNB 1D0DA 5JB5A 1BZ5A 1DEMA 1KNTA 1BPTA 1CBWD 2PTCI 3BTDI 2FTMB 3OTJI 1DTKA 7PTIA 3BTWI 1ZR0B 1QLQA 1F7ZI 2JOTA 1BTIA 1D0DB 2FI5I 1OA65 3U1JE 3TGJI 2M99A 3BTHI 4TPII 1ADZA 3T62D 1TPAI
chains in the Genus database with same CATH topology
4U32X 4Y0ZI 3BYBA 4BQDA 2M01A 1EAWB 1BUNB 1NAGA 2HEXA 1FAKI 2J6DA 2ZVXA 2RA3C 2UUXA 4Y11I 1JV9A 1FY8I 4WWYC 4Y10I 1AALA 1TAWB 3BTMI 1P2NB 1B0CA 4PTIA 3UOUB 2KAII 1BF0A 1T7CB 2FTLI 2W8XA 3L3TE 2R9PE 3AUEA 1P2QB 4Y0YI 2ODYE 1T8LB 2ZJXA 3TGKI 2IJOI 3AUHA 1KTHA 1YC0I 3AUDA 2KNTA 5PTIA 4BNRI 5JB6A 9PTIA 3LDJA 1FANA 3WNYA 1CO7I 1G6XA 4DTGK 1T8OB 1JV8A 3TGII 1UUBA 2TPII 3AUGA 3UIRC 4BD9B 1P2JI 3AUBA 4DG4C 3LDIA 1KIGI 1TAPA 1BZXI 2DDJA 1SHPA 3D65I 4NTYB 4ISLB 2LFKA 1YLCB 1P2KI 3P95E 1P2II 1JC6A 3GYMI 1BTHP 1OA55 1TOCR 3LDMA 3M7QB 3TPII 4NTWB 1UUAA 2UUYB 1CA0D 2CA7A 1BHCA 1BIKA 2FI4I 5JB7A 1MTND 3AUCA 3BTGI 5C67C 1P2MB 3FP7J 3P92E 3BTEI 3OFWA 3L33E 4WXVC 1Y62A 1YLDB 3FP6I 1P2OB 2KCRA 1LD5A 1T8NB 3BTFI 4NTXB 3CI7A 1LD6A 1TFXC 1TCPA 1DENA 1DTXA 3FP8I 1T8MB 8PTIA 1AAPA 1YKTB 1ZJDB 3BTQI 1BRCI 3BTKI 2FI3I 2TGPI 1BRBI 1KUNA 2DDIA 1F5RI 4U30W 1EJMB 3AUIA 1BPIA 3BTTI 5JB4A 2LFLA 1IRHA 1K6UA 1PITA 6PTIA 4ISOB 4ISNB 1D0DA 5JB5A 1BZ5A 1DEMA 1KNTA 1BPTA 1CBWD 2PTCI 3BTDI 2FTMB 3OTJI 1DTKA 7PTIA 3BTWI 1ZR0B 1QLQA 1F7ZI 2JOTA 1BTIA 1D0DB 2FI5I 1OA65 3U1JE 3TGJI 2M99A 3BTHI 4TPII 1ADZA 3T62D 1TPAI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U32 X;  4Y0Z I;  3BYB A;  4BQD A;  2M01 A;  1EAW B;  1BUN B;  1NAG A;  2HEX A;  1FAK I;  2J6D A;  2ZVX A;  2RA3 C;  2UUX A;  4Y11 I;  1JV9 A;  1FY8 I;  4WWY C;  4Y10 I;  1AAL A;  1TAW B;  3BTM I;  1P2N B;  1B0C A;  4PTI A;  3UOU B;  2KAI I;  1BF0 A;  1T7C B;  2FTL I;  2W8X A;  3L3T E;  2R9P E;  3AUE A;  1P2Q B;  4Y0Y I;  2ODY E;  1T8L B;  2ZJX A;  3TGK I;  2IJO I;  3AUH A;  1KTH A;  1YC0 I;  3AUD A;  2KNT A;  5PTI A;  4BNR I;  5JB6 A;  9PTI A;  3LDJ A;  1FAN A;  3WNY A;  1CO7 I;  1G6X A;  4DTG K;  1T8O B;  1JV8 A;  3TGI I;  1UUB A;  2TPI I;  3AUG A;  3UIR C;  4BD9 B;  1P2J I;  3AUB A;  4DG4 C;  3LDI A;  1KIG I;  1TAP A;  1BZX I;  2DDJ A;  1SHP A;  3D65 I;  4NTY B;  4ISL B;  2LFK A;  1YLC B;  1P2K I;  3P95 E;  1P2I I;  1JC6 A;  3GYM I;  1BTH P;  1OA5 5;  1TOC R;  3LDM A;  3M7Q B;  3TPI I;  4NTW B;  1UUA A;  2UUY B;  1CA0 D;  2CA7 A;  1BHC A;  1BIK A;  2FI4 I;  5JB7 A;  1MTN D;  3AUC A;  3BTG I;  5C67 C;  1P2M B;  3FP7 J;  3P92 E;  3BTE I;  3OFW A;  3L33 E;  4WXV C;  1Y62 A;  1YLD B;  3FP6 I;  1P2O B;  2KCR A;  1LD5 A;  1T8N B;  3BTF I;  4NTX B;  3CI7 A;  1LD6 A;  1TFX C;  1TCP A;  1DEN A;  1DTX A;  3FP8 I;  1T8M B;  8PTI A;  1AAP A;  1YKT B;  1ZJD B;  3BTQ I;  1BRC I;  3BTK I;  2FI3 I;  2TGP I;  1BRB I;  1KUN A;  2DDI A;  1F5R I;  4U30 W;  1EJM B;  3AUI A;  1BPI A;  3BTT I;  5JB4 A;  2LFL A;  1IRH A;  1K6U A;  1PIT A;  6PTI A;  4ISO B;  4ISN B;  1D0D A;  5JB5 A;  1BZ5 A;  1DEM A;  1KNT A;  1BPT A;  1CBW D;  2PTC I;  3BTD I;  2FTM B;  3OTJ I;  1DTK A;  7PTI A;  3BTW I;  1ZR0 B;  1QLQ A;  1F7Z I;  2JOT A;  1BTI A;  1D0D B;  2FI5 I;  1OA6 5;  3U1J E;  3TGJ I;  2M99 A;  3BTH I;  4TPI I;  1ADZ A;  3T62 D;  1TPA I; 
#chains in the Genus database with same CATH topology
 4U32 X;  4Y0Z I;  3BYB A;  4BQD A;  2M01 A;  1EAW B;  1BUN B;  1NAG A;  2HEX A;  1FAK I;  2J6D A;  2ZVX A;  2RA3 C;  2UUX A;  4Y11 I;  1JV9 A;  1FY8 I;  4WWY C;  4Y10 I;  1AAL A;  1TAW B;  3BTM I;  1P2N B;  1B0C A;  4PTI A;  3UOU B;  2KAI I;  1BF0 A;  1T7C B;  2FTL I;  2W8X A;  3L3T E;  2R9P E;  3AUE A;  1P2Q B;  4Y0Y I;  2ODY E;  1T8L B;  2ZJX A;  3TGK I;  2IJO I;  3AUH A;  1KTH A;  1YC0 I;  3AUD A;  2KNT A;  5PTI A;  4BNR I;  5JB6 A;  9PTI A;  3LDJ A;  1FAN A;  3WNY A;  1CO7 I;  1G6X A;  4DTG K;  1T8O B;  1JV8 A;  3TGI I;  1UUB A;  2TPI I;  3AUG A;  3UIR C;  4BD9 B;  1P2J I;  3AUB A;  4DG4 C;  3LDI A;  1KIG I;  1TAP A;  1BZX I;  2DDJ A;  1SHP A;  3D65 I;  4NTY B;  4ISL B;  2LFK A;  1YLC B;  1P2K I;  3P95 E;  1P2I I;  1JC6 A;  3GYM I;  1BTH P;  1OA5 5;  1TOC R;  3LDM A;  3M7Q B;  3TPI I;  4NTW B;  1UUA A;  2UUY B;  1CA0 D;  2CA7 A;  1BHC A;  1BIK A;  2FI4 I;  5JB7 A;  1MTN D;  3AUC A;  3BTG I;  5C67 C;  1P2M B;  3FP7 J;  3P92 E;  3BTE I;  3OFW A;  3L33 E;  4WXV C;  1Y62 A;  1YLD B;  3FP6 I;  1P2O B;  2KCR A;  1LD5 A;  1T8N B;  3BTF I;  4NTX B;  3CI7 A;  1LD6 A;  1TFX C;  1TCP A;  1DEN A;  1DTX A;  3FP8 I;  1T8M B;  8PTI A;  1AAP A;  1YKT B;  1ZJD B;  3BTQ I;  1BRC I;  3BTK I;  2FI3 I;  2TGP I;  1BRB I;  1KUN A;  2DDI A;  1F5R I;  4U30 W;  1EJM B;  3AUI A;  1BPI A;  3BTT I;  5JB4 A;  2LFL A;  1IRH A;  1K6U A;  1PIT A;  6PTI A;  4ISO B;  4ISN B;  1D0D A;  5JB5 A;  1BZ5 A;  1DEM A;  1KNT A;  1BPT A;  1CBW D;  2PTC I;  3BTD I;  2FTM B;  3OTJ I;  1DTK A;  7PTI A;  3BTW I;  1ZR0 B;  1QLQ A;  1F7Z I;  2JOT A;  1BTI A;  1D0D B;  2FI5 I;  1OA6 5;  3U1J E;  3TGJ I;  2M99 A;  3BTH I;  4TPI I;  1ADZ A;  3T62 D;  1TPA I; 
#chains in the Genus database with same CATH homology
 4U32 X;  4Y0Z I;  3BYB A;  4BQD A;  2M01 A;  1EAW B;  1BUN B;  1NAG A;  2HEX A;  1FAK I;  2J6D A;  2ZVX A;  2RA3 C;  2UUX A;  4Y11 I;  1JV9 A;  1FY8 I;  4WWY C;  4Y10 I;  1AAL A;  1TAW B;  3BTM I;  1P2N B;  1B0C A;  4PTI A;  3UOU B;  2KAI I;  1BF0 A;  1T7C B;  2FTL I;  2W8X A;  3L3T E;  2R9P E;  3AUE A;  1P2Q B;  4Y0Y I;  2ODY E;  1T8L B;  2ZJX A;  3TGK I;  2IJO I;  3AUH A;  1KTH A;  1YC0 I;  3AUD A;  2KNT A;  5PTI A;  4BNR I;  5JB6 A;  9PTI A;  3LDJ A;  1FAN A;  3WNY A;  1CO7 I;  1G6X A;  4DTG K;  1T8O B;  1JV8 A;  3TGI I;  1UUB A;  2TPI I;  3AUG A;  3UIR C;  4BD9 B;  1P2J I;  3AUB A;  4DG4 C;  3LDI A;  1KIG I;  1TAP A;  1BZX I;  2DDJ A;  1SHP A;  3D65 I;  4NTY B;  4ISL B;  2LFK A;  1YLC B;  1P2K I;  3P95 E;  1P2I I;  1JC6 A;  3GYM I;  1BTH P;  1OA5 5;  1TOC R;  3LDM A;  3M7Q B;  3TPI I;  4NTW B;  1UUA A;  2UUY B;  1CA0 D;  2CA7 A;  1BHC A;  1BIK A;  2FI4 I;  5JB7 A;  1MTN D;  3AUC A;  3BTG I;  5C67 C;  1P2M B;  3FP7 J;  3P92 E;  3BTE I;  3OFW A;  3L33 E;  4WXV C;  1Y62 A;  1YLD B;  3FP6 I;  1P2O B;  2KCR A;  1LD5 A;  1T8N B;  3BTF I;  4NTX B;  3CI7 A;  1LD6 A;  1TFX C;  1TCP A;  1DEN A;  1DTX A;  3FP8 I;  1T8M B;  8PTI A;  1AAP A;  1YKT B;  1ZJD B;  3BTQ I;  1BRC I;  3BTK I;  2FI3 I;  2TGP I;  1BRB I;  1KUN A;  2DDI A;  1F5R I;  4U30 W;  1EJM B;  3AUI A;  1BPI A;  3BTT I;  5JB4 A;  2LFL A;  1IRH A;  1K6U A;  1PIT A;  6PTI A;  4ISO B;  4ISN B;  1D0D A;  5JB5 A;  1BZ5 A;  1DEM A;  1KNT A;  1BPT A;  1CBW D;  2PTC I;  3BTD I;  2FTM B;  3OTJ I;  1DTK A;  7PTI A;  3BTW I;  1ZR0 B;  1QLQ A;  1F7Z I;  2JOT A;  1BTI A;  1D0D B;  2FI5 I;  1OA6 5;  3U1J E;  3TGJ I;  2M99 A;  3BTH I;  4TPI I;  1ADZ A;  3T62 D;  1TPA I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...