1DENA

Proteinase inhibitor homologues as potassium channel blockers
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Venom(potassium channel inhibitor)
molecule keywords DENDROTOXIN I
publication title Proteinase inhibitor homologues as potassium channel blockers.
pubmed doi rcsb
source organism Dendroaspis polylepis polylepis
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 1denA00
4PTIA 3AUCA 4WWYC 3FP7J 2FI4I 3CI7A 1TCPA 1CO7I 1LD6A 4ISOB 1Y62A 3FP8I 4TPII 1KNTA 3L3TE 1ZJDB 3BTDI 5JB7A 2UUYB 2DDJA 3GYMI 5JB5A 2FI3I 2IJOI 3AUIA 2M01A 1YC0I 1FY8I 3BTMI 3T62D 1DTXA 1T8NB 1BF0A 3BTHI 9PTIA 1P2KI 1BZXI 3UOUB 1BPTA 1P2OB 2JOTA 2HEXA 5PTIA 1UUAA 1D0DB 3BTQI 1BUNB 2TGPI 4DG4C 1F5RI 2UUXA 1JV8A 3BTKI 1BTIA 5JB4A 1AAPA 2R9PE 1FANA 2LFLA 1ADZA 1BTHP 1YLDB 3OTJI 4ISLB 1D0DA 4Y0YI 2KNTA 3D65I 1BRBI 4NTYB 3M7QB 1QLQA 3TPII 1SHPA 2CA7A 4Y11I 2LFKA 3AUHA 2KAII 3BTTI 2ODYE 4BNRI 3U1JE 1P2NB 3AUDA 1TOCR 3LDMA 1KTHA 1T8MB 3P95E 3UIRC 1AALA 8PTIA 5JB6A 4U30W 1OA65 3AUBA 3TGII 1TFXC 1MTND 1FAKI 3TGJI 1BRCI 4ISNB 2W8XA 1K6UA 3TGKI 1UUBA 1TAWB 3FP6I 1DEMA 1F7ZI 1P2II 3BTFI 4Y0ZI 2ZJXA 1OA55 1P2JI 1YLCB 4BD9B 3WNYA 1BIKA 3LDIA 3BYBA 2FTLI 1TAPA 1IRHA 3L33E 1CBWD 1JV9A 3LDJA 1JC6A 2DDIA 1LD5A 3BTWI 1G6XA 4Y10I 3BTEI 2RA3C 4U32X 2FTMB 2TPII 1B0CA 3AUEA 4WXVC 3P92E 1DENA 1TPAI 1ZR0B 1T8OB 2M99A 5C67C 2KCRA 7PTIA 1P2QB 4NTXB 1KIGI 1PITA 1BZ5A 1EJMB 1T8LB 1BHCA 1P2MB 1NAGA 4BQDA 4DTGK 3BTGI 1DTKA 1KUNA 2FI5I 2J6DA 1BPIA 2PTCI 6PTIA 1EAWB 1YKTB 3AUGA 1CA0D 2ZVXA 3OFWA 4NTWB 1T7CB
chains in the Genus database with same CATH superfamily
4PTIA 3AUCA 4WWYC 3FP7J 2FI4I 3CI7A 1TCPA 1CO7I 1LD6A 4ISOB 1Y62A 3FP8I 4TPII 1KNTA 3L3TE 1ZJDB 3BTDI 5JB7A 2UUYB 2DDJA 3GYMI 5JB5A 2FI3I 2IJOI 3AUIA 2M01A 1YC0I 1FY8I 3BTMI 3T62D 1DTXA 1T8NB 1BF0A 3BTHI 9PTIA 1P2KI 1BZXI 3UOUB 1BPTA 1P2OB 2JOTA 2HEXA 5PTIA 1UUAA 1D0DB 3BTQI 1BUNB 2TGPI 4DG4C 1F5RI 2UUXA 1JV8A 3BTKI 1BTIA 5JB4A 1AAPA 2R9PE 1FANA 2LFLA 1ADZA 1BTHP 1YLDB 3OTJI 4ISLB 1D0DA 4Y0YI 2KNTA 3D65I 1BRBI 4NTYB 3M7QB 1QLQA 3TPII 1SHPA 2CA7A 4Y11I 2LFKA 3AUHA 2KAII 3BTTI 2ODYE 4BNRI 3U1JE 1P2NB 3AUDA 1TOCR 3LDMA 1KTHA 1T8MB 3P95E 3UIRC 1AALA 8PTIA 5JB6A 4U30W 1OA65 3AUBA 3TGII 1TFXC 1MTND 1FAKI 3TGJI 1BRCI 4ISNB 2W8XA 1K6UA 3TGKI 1UUBA 1TAWB 3FP6I 1DEMA 1F7ZI 1P2II 3BTFI 4Y0ZI 2ZJXA 1OA55 1P2JI 1YLCB 4BD9B 3WNYA 1BIKA 3LDIA 3BYBA 2FTLI 1TAPA 1IRHA 3L33E 1CBWD 1JV9A 3LDJA 1JC6A 2DDIA 1LD5A 3BTWI 1G6XA 4Y10I 3BTEI 2RA3C 4U32X 2FTMB 2TPII 1B0CA 3AUEA 4WXVC 3P92E 1DENA 1TPAI 1ZR0B 1T8OB 2M99A 5C67C 2KCRA 7PTIA 1P2QB 4NTXB 1KIGI 1PITA 1BZ5A 1EJMB 1T8LB 1BHCA 1P2MB 1NAGA 4BQDA 4DTGK 3BTGI 1DTKA 1KUNA 2FI5I 2J6DA 1BPIA 2PTCI 6PTIA 1EAWB 1YKTB 3AUGA 1CA0D 2ZVXA 3OFWA 4NTWB 1T7CB
chains in the Genus database with same CATH topology
4PTIA 3AUCA 4WWYC 3FP7J 2FI4I 3CI7A 1TCPA 1CO7I 1LD6A 4ISOB 1Y62A 3FP8I 4TPII 1KNTA 3L3TE 1ZJDB 3BTDI 5JB7A 2UUYB 2DDJA 3GYMI 5JB5A 2FI3I 2IJOI 3AUIA 2M01A 1YC0I 1FY8I 3BTMI 3T62D 1DTXA 1T8NB 1BF0A 3BTHI 9PTIA 1P2KI 1BZXI 3UOUB 1BPTA 1P2OB 2JOTA 2HEXA 5PTIA 1UUAA 1D0DB 3BTQI 1BUNB 2TGPI 4DG4C 1F5RI 2UUXA 1JV8A 3BTKI 1BTIA 5JB4A 1AAPA 2R9PE 1FANA 2LFLA 1ADZA 1BTHP 1YLDB 3OTJI 4ISLB 1D0DA 4Y0YI 2KNTA 3D65I 1BRBI 4NTYB 3M7QB 1QLQA 3TPII 1SHPA 2CA7A 4Y11I 2LFKA 3AUHA 2KAII 3BTTI 2ODYE 4BNRI 3U1JE 1P2NB 3AUDA 1TOCR 3LDMA 1KTHA 1T8MB 3P95E 3UIRC 1AALA 8PTIA 5JB6A 4U30W 1OA65 3AUBA 3TGII 1TFXC 1MTND 1FAKI 3TGJI 1BRCI 4ISNB 2W8XA 1K6UA 3TGKI 1UUBA 1TAWB 3FP6I 1DEMA 1F7ZI 1P2II 3BTFI 4Y0ZI 2ZJXA 1OA55 1P2JI 1YLCB 4BD9B 3WNYA 1BIKA 3LDIA 3BYBA 2FTLI 1TAPA 1IRHA 3L33E 1CBWD 1JV9A 3LDJA 1JC6A 2DDIA 1LD5A 3BTWI 1G6XA 4Y10I 3BTEI 2RA3C 4U32X 2FTMB 2TPII 1B0CA 3AUEA 4WXVC 3P92E 1DENA 1TPAI 1ZR0B 1T8OB 2M99A 5C67C 2KCRA 7PTIA 1P2QB 4NTXB 1KIGI 1PITA 1BZ5A 1EJMB 1T8LB 1BHCA 1P2MB 1NAGA 4BQDA 4DTGK 3BTGI 1DTKA 1KUNA 2FI5I 2J6DA 1BPIA 2PTCI 6PTIA 1EAWB 1YKTB 3AUGA 1CA0D 2ZVXA 3OFWA 4NTWB 1T7CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PTI A;  3AUC A;  4WWY C;  3FP7 J;  2FI4 I;  3CI7 A;  1TCP A;  1CO7 I;  1LD6 A;  4ISO B;  1Y62 A;  3FP8 I;  4TPI I;  1KNT A;  3L3T E;  1ZJD B;  3BTD I;  5JB7 A;  2UUY B;  2DDJ A;  3GYM I;  5JB5 A;  2FI3 I;  2IJO I;  3AUI A;  2M01 A;  1YC0 I;  1FY8 I;  3BTM I;  3T62 D;  1DTX A;  1T8N B;  1BF0 A;  3BTH I;  9PTI A;  1P2K I;  1BZX I;  3UOU B;  1BPT A;  1P2O B;  2JOT A;  2HEX A;  5PTI A;  1UUA A;  1D0D B;  3BTQ I;  1BUN B;  2TGP I;  4DG4 C;  1F5R I;  2UUX A;  1JV8 A;  3BTK I;  1BTI A;  5JB4 A;  1AAP A;  2R9P E;  1FAN A;  2LFL A;  1ADZ A;  1BTH P;  1YLD B;  3OTJ I;  4ISL B;  1D0D A;  4Y0Y I;  2KNT A;  3D65 I;  1BRB I;  4NTY B;  3M7Q B;  1QLQ A;  3TPI I;  1SHP A;  2CA7 A;  4Y11 I;  2LFK A;  3AUH A;  2KAI I;  3BTT I;  2ODY E;  4BNR I;  3U1J E;  1P2N B;  3AUD A;  1TOC R;  3LDM A;  1KTH A;  1T8M B;  3P95 E;  3UIR C;  1AAL A;  8PTI A;  5JB6 A;  4U30 W;  1OA6 5;  3AUB A;  3TGI I;  1TFX C;  1MTN D;  1FAK I;  3TGJ I;  1BRC I;  4ISN B;  2W8X A;  1K6U A;  3TGK I;  1UUB A;  1TAW B;  3FP6 I;  1DEM A;  1F7Z I;  1P2I I;  3BTF I;  4Y0Z I;  2ZJX A;  1OA5 5;  1P2J I;  1YLC B;  4BD9 B;  3WNY A;  1BIK A;  3LDI A;  3BYB A;  2FTL I;  1TAP A;  1IRH A;  3L33 E;  1CBW D;  1JV9 A;  3LDJ A;  1JC6 A;  2DDI A;  1LD5 A;  3BTW I;  1G6X A;  4Y10 I;  3BTE I;  2RA3 C;  4U32 X;  2FTM B;  2TPI I;  1B0C A;  3AUE A;  4WXV C;  3P92 E;  1DEN A;  1TPA I;  1ZR0 B;  1T8O B;  2M99 A;  5C67 C;  2KCR A;  7PTI A;  1P2Q B;  4NTX B;  1KIG I;  1PIT A;  1BZ5 A;  1EJM B;  1T8L B;  1BHC A;  1P2M B;  1NAG A;  4BQD A;  4DTG K;  3BTG I;  1DTK A;  1KUN A;  2FI5 I;  2J6D A;  1BPI A;  2PTC I;  6PTI A;  1EAW B;  1YKT B;  3AUG A;  1CA0 D;  2ZVX A;  3OFW A;  4NTW B;  1T7C B; 
#chains in the Genus database with same CATH topology
 4PTI A;  3AUC A;  4WWY C;  3FP7 J;  2FI4 I;  3CI7 A;  1TCP A;  1CO7 I;  1LD6 A;  4ISO B;  1Y62 A;  3FP8 I;  4TPI I;  1KNT A;  3L3T E;  1ZJD B;  3BTD I;  5JB7 A;  2UUY B;  2DDJ A;  3GYM I;  5JB5 A;  2FI3 I;  2IJO I;  3AUI A;  2M01 A;  1YC0 I;  1FY8 I;  3BTM I;  3T62 D;  1DTX A;  1T8N B;  1BF0 A;  3BTH I;  9PTI A;  1P2K I;  1BZX I;  3UOU B;  1BPT A;  1P2O B;  2JOT A;  2HEX A;  5PTI A;  1UUA A;  1D0D B;  3BTQ I;  1BUN B;  2TGP I;  4DG4 C;  1F5R I;  2UUX A;  1JV8 A;  3BTK I;  1BTI A;  5JB4 A;  1AAP A;  2R9P E;  1FAN A;  2LFL A;  1ADZ A;  1BTH P;  1YLD B;  3OTJ I;  4ISL B;  1D0D A;  4Y0Y I;  2KNT A;  3D65 I;  1BRB I;  4NTY B;  3M7Q B;  1QLQ A;  3TPI I;  1SHP A;  2CA7 A;  4Y11 I;  2LFK A;  3AUH A;  2KAI I;  3BTT I;  2ODY E;  4BNR I;  3U1J E;  1P2N B;  3AUD A;  1TOC R;  3LDM A;  1KTH A;  1T8M B;  3P95 E;  3UIR C;  1AAL A;  8PTI A;  5JB6 A;  4U30 W;  1OA6 5;  3AUB A;  3TGI I;  1TFX C;  1MTN D;  1FAK I;  3TGJ I;  1BRC I;  4ISN B;  2W8X A;  1K6U A;  3TGK I;  1UUB A;  1TAW B;  3FP6 I;  1DEM A;  1F7Z I;  1P2I I;  3BTF I;  4Y0Z I;  2ZJX A;  1OA5 5;  1P2J I;  1YLC B;  4BD9 B;  3WNY A;  1BIK A;  3LDI A;  3BYB A;  2FTL I;  1TAP A;  1IRH A;  3L33 E;  1CBW D;  1JV9 A;  3LDJ A;  1JC6 A;  2DDI A;  1LD5 A;  3BTW I;  1G6X A;  4Y10 I;  3BTE I;  2RA3 C;  4U32 X;  2FTM B;  2TPI I;  1B0C A;  3AUE A;  4WXV C;  3P92 E;  1DEN A;  1TPA I;  1ZR0 B;  1T8O B;  2M99 A;  5C67 C;  2KCR A;  7PTI A;  1P2Q B;  4NTX B;  1KIG I;  1PIT A;  1BZ5 A;  1EJM B;  1T8L B;  1BHC A;  1P2M B;  1NAG A;  4BQD A;  4DTG K;  3BTG I;  1DTK A;  1KUN A;  2FI5 I;  2J6D A;  1BPI A;  2PTC I;  6PTI A;  1EAW B;  1YKT B;  3AUG A;  1CA0 D;  2ZVX A;  3OFW A;  4NTW B;  1T7C B; 
#chains in the Genus database with same CATH homology
 4PTI A;  3AUC A;  4WWY C;  3FP7 J;  2FI4 I;  3CI7 A;  1TCP A;  1CO7 I;  1LD6 A;  4ISO B;  1Y62 A;  3FP8 I;  4TPI I;  1KNT A;  3L3T E;  1ZJD B;  3BTD I;  5JB7 A;  2UUY B;  2DDJ A;  3GYM I;  5JB5 A;  2FI3 I;  2IJO I;  3AUI A;  2M01 A;  1YC0 I;  1FY8 I;  3BTM I;  3T62 D;  1DTX A;  1T8N B;  1BF0 A;  3BTH I;  9PTI A;  1P2K I;  1BZX I;  3UOU B;  1BPT A;  1P2O B;  2JOT A;  2HEX A;  5PTI A;  1UUA A;  1D0D B;  3BTQ I;  1BUN B;  2TGP I;  4DG4 C;  1F5R I;  2UUX A;  1JV8 A;  3BTK I;  1BTI A;  5JB4 A;  1AAP A;  2R9P E;  1FAN A;  2LFL A;  1ADZ A;  1BTH P;  1YLD B;  3OTJ I;  4ISL B;  1D0D A;  4Y0Y I;  2KNT A;  3D65 I;  1BRB I;  4NTY B;  3M7Q B;  1QLQ A;  3TPI I;  1SHP A;  2CA7 A;  4Y11 I;  2LFK A;  3AUH A;  2KAI I;  3BTT I;  2ODY E;  4BNR I;  3U1J E;  1P2N B;  3AUD A;  1TOC R;  3LDM A;  1KTH A;  1T8M B;  3P95 E;  3UIR C;  1AAL A;  8PTI A;  5JB6 A;  4U30 W;  1OA6 5;  3AUB A;  3TGI I;  1TFX C;  1MTN D;  1FAK I;  3TGJ I;  1BRC I;  4ISN B;  2W8X A;  1K6U A;  3TGK I;  1UUB A;  1TAW B;  3FP6 I;  1DEM A;  1F7Z I;  1P2I I;  3BTF I;  4Y0Z I;  2ZJX A;  1OA5 5;  1P2J I;  1YLC B;  4BD9 B;  3WNY A;  1BIK A;  3LDI A;  3BYB A;  2FTL I;  1TAP A;  1IRH A;  3L33 E;  1CBW D;  1JV9 A;  3LDJ A;  1JC6 A;  2DDI A;  1LD5 A;  3BTW I;  1G6X A;  4Y10 I;  3BTE I;  2RA3 C;  4U32 X;  2FTM B;  2TPI I;  1B0C A;  3AUE A;  4WXV C;  3P92 E;  1DEN A;  1TPA I;  1ZR0 B;  1T8O B;  2M99 A;  5C67 C;  2KCR A;  7PTI A;  1P2Q B;  4NTX B;  1KIG I;  1PIT A;  1BZ5 A;  1EJM B;  1T8L B;  1BHC A;  1P2M B;  1NAG A;  4BQD A;  4DTG K;  3BTG I;  1DTK A;  1KUN A;  2FI5 I;  2J6D A;  1BPI A;  2PTC I;  6PTI A;  1EAW B;  1YKT B;  3AUG A;  1CA0 D;  2ZVX A;  3OFW A;  4NTW B;  1T7C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...