1DTKA

The nmr solution structure of dendrotoxin k from the venom of dendroaspis polylepis polylepis
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Presynaptic neurotoxin
molecule keywords DENDROTOXIN K
publication title Nuclear magnetic resonance solution structure of dendrotoxin K from the venom of Dendroaspis polylepis polylepis.
pubmed doi rcsb
source organism Dendroaspis polylepis polylepis
total genus 13
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1993-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 1dtkA00
1YKTB 1TAWB 2JOTA 4WWYC 3TGII 1BIKA 1CO7I 1TAPA 3AUCA 1BTHP 3T62D 3L3TE 5JB4A 9PTIA 1JV8A 1T8LB 3BTFI 1P2II 1FAKI 1P2OB 3BTTI 3OFWA 4BQDA 8PTIA 1JV9A 3BTDI 3P92E 1YC0I 6PTIA 5JB6A 4NTWB 3BTWI 1TCPA 1F5RI 1CA0D 2TPII 1BHCA 3AUHA 1DTXA 2HEXA 3AUDA 1BPIA 2FTMB 1FY8I 2LFLA 1G6XA 1K6UA 2IJOI 2LFKA 4PTIA 4DTGK 2UUYB 3BYBA 3TPII 1KNTA 1T8MB 3FP6I 3AUGA 1QLQA 1BRCI 1F7ZI 4ISOB 1IRHA 2FTLI 3UOUB 3M7QB 3BTEI 4BNRI 1BF0A 1ZR0B 2DDIA 1UUBA 2J6DA 4Y0ZI 1T8NB 3BTGI 4ISLB 2KNTA 3FP8I 1CBWD 3L33E 1KTHA 3FP7J 1LD5A 3BTHI 1YLDB 2R9PE 4Y10I 1DEMA 1AAPA 7PTIA 1DENA 4Y11I 1P2MB 3U1JE 4Y0YI 1AALA 2FI4I 3P95E 1T8OB 3AUBA 1P2JI 2FI3I 4DG4C 5JB5A 1YLCB 3AUEA 1OA65 1T7CB 2TGPI 3BTMI 1EJMB 1TOCR 3CI7A 1PITA 1FANA 3UIRC 3WNYA 1D0DB 1P2QB 3TGJI 3BTQI 3LDJA 2ODYE 3D65I 1ZJDB 1LD6A 2DDJA 2ZJXA 2KCRA 1P2KI 1B0CA 2FI5I 1Y62A 2UUXA 1BPTA 1EAWB 1D0DA 1BUNB 1UUAA 2CA7A 5C67C 4WXVC 2ZVXA 1BZXI 2RA3C 1KIGI 3LDIA 2M01A 1MTND 1KUNA 1BTIA 1TPAI 1TFXC 3GYMI 3LDMA 1BRBI 2PTCI 4U30W 1JC6A 1BZ5A 2M99A 3AUIA 3OTJI 1P2NB 4ISNB 4NTYB 1ADZA 1NAGA 4TPII 1DTKA 4NTXB 3BTKI 3TGKI 4U32X 1OA55 5JB7A 4BD9B 5PTIA 1SHPA 2KAII 2W8XA
chains in the Genus database with same CATH superfamily
1YKTB 1TAWB 2JOTA 4WWYC 3TGII 1BIKA 1CO7I 1TAPA 3AUCA 1BTHP 3T62D 3L3TE 5JB4A 9PTIA 1JV8A 1T8LB 3BTFI 1P2II 1FAKI 1P2OB 3BTTI 3OFWA 4BQDA 8PTIA 1JV9A 3BTDI 3P92E 1YC0I 6PTIA 5JB6A 4NTWB 3BTWI 1TCPA 1F5RI 1CA0D 2TPII 1BHCA 3AUHA 1DTXA 2HEXA 3AUDA 1BPIA 2FTMB 1FY8I 2LFLA 1G6XA 1K6UA 2IJOI 2LFKA 4PTIA 4DTGK 2UUYB 3BYBA 3TPII 1KNTA 1T8MB 3FP6I 3AUGA 1QLQA 1BRCI 1F7ZI 4ISOB 1IRHA 2FTLI 3UOUB 3M7QB 3BTEI 4BNRI 1BF0A 1ZR0B 2DDIA 1UUBA 2J6DA 4Y0ZI 1T8NB 3BTGI 4ISLB 2KNTA 3FP8I 1CBWD 3L33E 1KTHA 3FP7J 1LD5A 3BTHI 1YLDB 2R9PE 4Y10I 1DEMA 1AAPA 7PTIA 1DENA 4Y11I 1P2MB 3U1JE 4Y0YI 1AALA 2FI4I 3P95E 1T8OB 3AUBA 1P2JI 2FI3I 4DG4C 5JB5A 1YLCB 3AUEA 1OA65 1T7CB 2TGPI 3BTMI 1EJMB 1TOCR 3CI7A 1PITA 1FANA 3UIRC 3WNYA 1D0DB 1P2QB 3TGJI 3BTQI 3LDJA 2ODYE 3D65I 1ZJDB 1LD6A 2DDJA 2ZJXA 2KCRA 1P2KI 1B0CA 2FI5I 1Y62A 2UUXA 1BPTA 1EAWB 1D0DA 1BUNB 1UUAA 2CA7A 5C67C 4WXVC 2ZVXA 1BZXI 2RA3C 1KIGI 3LDIA 2M01A 1MTND 1KUNA 1BTIA 1TPAI 1TFXC 3GYMI 3LDMA 1BRBI 2PTCI 4U30W 1JC6A 1BZ5A 2M99A 3AUIA 3OTJI 1P2NB 4ISNB 4NTYB 1ADZA 1NAGA 4TPII 1DTKA 4NTXB 3BTKI 3TGKI 4U32X 1OA55 5JB7A 4BD9B 5PTIA 1SHPA 2KAII 2W8XA
chains in the Genus database with same CATH topology
1YKTB 1TAWB 2JOTA 4WWYC 3TGII 1BIKA 1CO7I 1TAPA 3AUCA 1BTHP 3T62D 3L3TE 5JB4A 9PTIA 1JV8A 1T8LB 3BTFI 1P2II 1FAKI 1P2OB 3BTTI 3OFWA 4BQDA 8PTIA 1JV9A 3BTDI 3P92E 1YC0I 6PTIA 5JB6A 4NTWB 3BTWI 1TCPA 1F5RI 1CA0D 2TPII 1BHCA 3AUHA 1DTXA 2HEXA 3AUDA 1BPIA 2FTMB 1FY8I 2LFLA 1G6XA 1K6UA 2IJOI 2LFKA 4PTIA 4DTGK 2UUYB 3BYBA 3TPII 1KNTA 1T8MB 3FP6I 3AUGA 1QLQA 1BRCI 1F7ZI 4ISOB 1IRHA 2FTLI 3UOUB 3M7QB 3BTEI 4BNRI 1BF0A 1ZR0B 2DDIA 1UUBA 2J6DA 4Y0ZI 1T8NB 3BTGI 4ISLB 2KNTA 3FP8I 1CBWD 3L33E 1KTHA 3FP7J 1LD5A 3BTHI 1YLDB 2R9PE 4Y10I 1DEMA 1AAPA 7PTIA 1DENA 4Y11I 1P2MB 3U1JE 4Y0YI 1AALA 2FI4I 3P95E 1T8OB 3AUBA 1P2JI 2FI3I 4DG4C 5JB5A 1YLCB 3AUEA 1OA65 1T7CB 2TGPI 3BTMI 1EJMB 1TOCR 3CI7A 1PITA 1FANA 3UIRC 3WNYA 1D0DB 1P2QB 3TGJI 3BTQI 3LDJA 2ODYE 3D65I 1ZJDB 1LD6A 2DDJA 2ZJXA 2KCRA 1P2KI 1B0CA 2FI5I 1Y62A 2UUXA 1BPTA 1EAWB 1D0DA 1BUNB 1UUAA 2CA7A 5C67C 4WXVC 2ZVXA 1BZXI 2RA3C 1KIGI 3LDIA 2M01A 1MTND 1KUNA 1BTIA 1TPAI 1TFXC 3GYMI 3LDMA 1BRBI 2PTCI 4U30W 1JC6A 1BZ5A 2M99A 3AUIA 3OTJI 1P2NB 4ISNB 4NTYB 1ADZA 1NAGA 4TPII 1DTKA 4NTXB 3BTKI 3TGKI 4U32X 1OA55 5JB7A 4BD9B 5PTIA 1SHPA 2KAII 2W8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKT B;  1TAW B;  2JOT A;  4WWY C;  3TGI I;  1BIK A;  1CO7 I;  1TAP A;  3AUC A;  1BTH P;  3T62 D;  3L3T E;  5JB4 A;  9PTI A;  1JV8 A;  1T8L B;  3BTF I;  1P2I I;  1FAK I;  1P2O B;  3BTT I;  3OFW A;  4BQD A;  8PTI A;  1JV9 A;  3BTD I;  3P92 E;  1YC0 I;  6PTI A;  5JB6 A;  4NTW B;  3BTW I;  1TCP A;  1F5R I;  1CA0 D;  2TPI I;  1BHC A;  3AUH A;  1DTX A;  2HEX A;  3AUD A;  1BPI A;  2FTM B;  1FY8 I;  2LFL A;  1G6X A;  1K6U A;  2IJO I;  2LFK A;  4PTI A;  4DTG K;  2UUY B;  3BYB A;  3TPI I;  1KNT A;  1T8M B;  3FP6 I;  3AUG A;  1QLQ A;  1BRC I;  1F7Z I;  4ISO B;  1IRH A;  2FTL I;  3UOU B;  3M7Q B;  3BTE I;  4BNR I;  1BF0 A;  1ZR0 B;  2DDI A;  1UUB A;  2J6D A;  4Y0Z I;  1T8N B;  3BTG I;  4ISL B;  2KNT A;  3FP8 I;  1CBW D;  3L33 E;  1KTH A;  3FP7 J;  1LD5 A;  3BTH I;  1YLD B;  2R9P E;  4Y10 I;  1DEM A;  1AAP A;  7PTI A;  1DEN A;  4Y11 I;  1P2M B;  3U1J E;  4Y0Y I;  1AAL A;  2FI4 I;  3P95 E;  1T8O B;  3AUB A;  1P2J I;  2FI3 I;  4DG4 C;  5JB5 A;  1YLC B;  3AUE A;  1OA6 5;  1T7C B;  2TGP I;  3BTM I;  1EJM B;  1TOC R;  3CI7 A;  1PIT A;  1FAN A;  3UIR C;  3WNY A;  1D0D B;  1P2Q B;  3TGJ I;  3BTQ I;  3LDJ A;  2ODY E;  3D65 I;  1ZJD B;  1LD6 A;  2DDJ A;  2ZJX A;  2KCR A;  1P2K I;  1B0C A;  2FI5 I;  1Y62 A;  2UUX A;  1BPT A;  1EAW B;  1D0D A;  1BUN B;  1UUA A;  2CA7 A;  5C67 C;  4WXV C;  2ZVX A;  1BZX I;  2RA3 C;  1KIG I;  3LDI A;  2M01 A;  1MTN D;  1KUN A;  1BTI A;  1TPA I;  1TFX C;  3GYM I;  3LDM A;  1BRB I;  2PTC I;  4U30 W;  1JC6 A;  1BZ5 A;  2M99 A;  3AUI A;  3OTJ I;  1P2N B;  4ISN B;  4NTY B;  1ADZ A;  1NAG A;  4TPI I;  1DTK A;  4NTX B;  3BTK I;  3TGK I;  4U32 X;  1OA5 5;  5JB7 A;  4BD9 B;  5PTI A;  1SHP A;  2KAI I;  2W8X A; 
#chains in the Genus database with same CATH topology
 1YKT B;  1TAW B;  2JOT A;  4WWY C;  3TGI I;  1BIK A;  1CO7 I;  1TAP A;  3AUC A;  1BTH P;  3T62 D;  3L3T E;  5JB4 A;  9PTI A;  1JV8 A;  1T8L B;  3BTF I;  1P2I I;  1FAK I;  1P2O B;  3BTT I;  3OFW A;  4BQD A;  8PTI A;  1JV9 A;  3BTD I;  3P92 E;  1YC0 I;  6PTI A;  5JB6 A;  4NTW B;  3BTW I;  1TCP A;  1F5R I;  1CA0 D;  2TPI I;  1BHC A;  3AUH A;  1DTX A;  2HEX A;  3AUD A;  1BPI A;  2FTM B;  1FY8 I;  2LFL A;  1G6X A;  1K6U A;  2IJO I;  2LFK A;  4PTI A;  4DTG K;  2UUY B;  3BYB A;  3TPI I;  1KNT A;  1T8M B;  3FP6 I;  3AUG A;  1QLQ A;  1BRC I;  1F7Z I;  4ISO B;  1IRH A;  2FTL I;  3UOU B;  3M7Q B;  3BTE I;  4BNR I;  1BF0 A;  1ZR0 B;  2DDI A;  1UUB A;  2J6D A;  4Y0Z I;  1T8N B;  3BTG I;  4ISL B;  2KNT A;  3FP8 I;  1CBW D;  3L33 E;  1KTH A;  3FP7 J;  1LD5 A;  3BTH I;  1YLD B;  2R9P E;  4Y10 I;  1DEM A;  1AAP A;  7PTI A;  1DEN A;  4Y11 I;  1P2M B;  3U1J E;  4Y0Y I;  1AAL A;  2FI4 I;  3P95 E;  1T8O B;  3AUB A;  1P2J I;  2FI3 I;  4DG4 C;  5JB5 A;  1YLC B;  3AUE A;  1OA6 5;  1T7C B;  2TGP I;  3BTM I;  1EJM B;  1TOC R;  3CI7 A;  1PIT A;  1FAN A;  3UIR C;  3WNY A;  1D0D B;  1P2Q B;  3TGJ I;  3BTQ I;  3LDJ A;  2ODY E;  3D65 I;  1ZJD B;  1LD6 A;  2DDJ A;  2ZJX A;  2KCR A;  1P2K I;  1B0C A;  2FI5 I;  1Y62 A;  2UUX A;  1BPT A;  1EAW B;  1D0D A;  1BUN B;  1UUA A;  2CA7 A;  5C67 C;  4WXV C;  2ZVX A;  1BZX I;  2RA3 C;  1KIG I;  3LDI A;  2M01 A;  1MTN D;  1KUN A;  1BTI A;  1TPA I;  1TFX C;  3GYM I;  3LDM A;  1BRB I;  2PTC I;  4U30 W;  1JC6 A;  1BZ5 A;  2M99 A;  3AUI A;  3OTJ I;  1P2N B;  4ISN B;  4NTY B;  1ADZ A;  1NAG A;  4TPI I;  1DTK A;  4NTX B;  3BTK I;  3TGK I;  4U32 X;  1OA5 5;  5JB7 A;  4BD9 B;  5PTI A;  1SHP A;  2KAI I;  2W8X A; 
#chains in the Genus database with same CATH homology
 1YKT B;  1TAW B;  2JOT A;  4WWY C;  3TGI I;  1BIK A;  1CO7 I;  1TAP A;  3AUC A;  1BTH P;  3T62 D;  3L3T E;  5JB4 A;  9PTI A;  1JV8 A;  1T8L B;  3BTF I;  1P2I I;  1FAK I;  1P2O B;  3BTT I;  3OFW A;  4BQD A;  8PTI A;  1JV9 A;  3BTD I;  3P92 E;  1YC0 I;  6PTI A;  5JB6 A;  4NTW B;  3BTW I;  1TCP A;  1F5R I;  1CA0 D;  2TPI I;  1BHC A;  3AUH A;  1DTX A;  2HEX A;  3AUD A;  1BPI A;  2FTM B;  1FY8 I;  2LFL A;  1G6X A;  1K6U A;  2IJO I;  2LFK A;  4PTI A;  4DTG K;  2UUY B;  3BYB A;  3TPI I;  1KNT A;  1T8M B;  3FP6 I;  3AUG A;  1QLQ A;  1BRC I;  1F7Z I;  4ISO B;  1IRH A;  2FTL I;  3UOU B;  3M7Q B;  3BTE I;  4BNR I;  1BF0 A;  1ZR0 B;  2DDI A;  1UUB A;  2J6D A;  4Y0Z I;  1T8N B;  3BTG I;  4ISL B;  2KNT A;  3FP8 I;  1CBW D;  3L33 E;  1KTH A;  3FP7 J;  1LD5 A;  3BTH I;  1YLD B;  2R9P E;  4Y10 I;  1DEM A;  1AAP A;  7PTI A;  1DEN A;  4Y11 I;  1P2M B;  3U1J E;  4Y0Y I;  1AAL A;  2FI4 I;  3P95 E;  1T8O B;  3AUB A;  1P2J I;  2FI3 I;  4DG4 C;  5JB5 A;  1YLC B;  3AUE A;  1OA6 5;  1T7C B;  2TGP I;  3BTM I;  1EJM B;  1TOC R;  3CI7 A;  1PIT A;  1FAN A;  3UIR C;  3WNY A;  1D0D B;  1P2Q B;  3TGJ I;  3BTQ I;  3LDJ A;  2ODY E;  3D65 I;  1ZJD B;  1LD6 A;  2DDJ A;  2ZJX A;  2KCR A;  1P2K I;  1B0C A;  2FI5 I;  1Y62 A;  2UUX A;  1BPT A;  1EAW B;  1D0D A;  1BUN B;  1UUA A;  2CA7 A;  5C67 C;  4WXV C;  2ZVX A;  1BZX I;  2RA3 C;  1KIG I;  3LDI A;  2M01 A;  1MTN D;  1KUN A;  1BTI A;  1TPA I;  1TFX C;  3GYM I;  3LDM A;  1BRB I;  2PTC I;  4U30 W;  1JC6 A;  1BZ5 A;  2M99 A;  3AUI A;  3OTJ I;  1P2N B;  4ISN B;  4NTY B;  1ADZ A;  1NAG A;  4TPI I;  1DTK A;  4NTX B;  3BTK I;  3TGK I;  4U32 X;  1OA5 5;  5JB7 A;  4BD9 B;  5PTI A;  1SHP A;  2KAI I;  2W8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...