1IRHA

The solution structure of the third kunitz domain of tissue factor pathway inhibitor
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
61
structure length
61
Chain Sequence
EFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords tissue factor pathway inhibitor
publication title Structural mechanism for heparin-binding of the third Kunitz domain of human tissue factor pathway inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 2
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2001-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 1irhA00
1AALA 2FI4I 1UUBA 3AUGA 3BTHI 1BTIA 2R9PE 2UUYB 1TCPA 1DEMA 1P2QB 3FP7J 4U30W 1T8NB 1BF0A 3AUBA 1JC6A 4NTYB 1D0DB 2ODYE 3UOUB 7PTIA 4Y10I 3TPII 4TPII 3FP6I 1BPTA 8PTIA 2IJOI 1LD6A 1D0DA 1AAPA 1QLQA 2KCRA 1FANA 3BTWI 4Y0ZI 1BHCA 3UIRC 1YLCB 2CA7A 6PTIA 1P2OB 3M7QB 5JB6A 1DTKA 3AUCA 3TGJI 1TAWB 3TGII 1NAGA 3WNYA 4ISOB 4BNRI 1BRCI 3U1JE 3AUHA 3L33E 4WXVC 1KIGI 9PTIA 1BZXI 1LD5A 1TAPA 5C67C 4DG4C 1ZJDB 2M01A 3TGKI 4BD9B 2FTMB 1BUNB 3BTGI 2ZJXA 3FP8I 1DENA 3P95E 1YKTB 1FAKI 2HEXA 1JV9A 4NTWB 1JV8A 1BZ5A 1ZR0B 2ZVXA 2DDIA 1TPAI 3GYMI 4WWYC 1P2NB 1UUAA 1SHPA 1F7ZI 2TPII 1KNTA 3LDJA 2W8XA 2FI3I 3D65I 1IRHA 4U32X 4NTXB 3AUEA 5PTIA 1KTHA 3BTQI 3BTMI 1CA0D 3L3TE 2FTLI 2M99A 4PTIA 1PITA 5JB4A 1B0CA 1K6UA 2FI5I 1G6XA 3P92E 1CBWD 3BTDI 2PTCI 4Y0YI 1CO7I 5JB5A 2KAII 3BYBA 2LFLA 3AUDA 1OA55 1P2II 4DTGK 5JB7A 3BTTI 2RA3C 1T7CB 1EJMB 1YC0I 3BTEI 1T8OB 1BIKA 1Y62A 3BTFI 3LDMA 2JOTA 1P2JI 1TOCR 1TFXC 4BQDA 2KNTA 3BTKI 1P2MB 1BRBI 1DTXA 2LFKA 3LDIA 1MTND 1EAWB 1T8LB 3T62D 1ADZA 3OFWA 1BPIA 3OTJI 1T8MB 4ISLB 2J6DA 1KUNA 3CI7A 3AUIA 1FY8I 2TGPI 4Y11I 4ISNB 2DDJA 1F5RI 1BTHP 1P2KI 1YLDB 1OA65 2UUXA
chains in the Genus database with same CATH superfamily
1AALA 2FI4I 1UUBA 3AUGA 3BTHI 1BTIA 2R9PE 2UUYB 1TCPA 1DEMA 1P2QB 3FP7J 4U30W 1T8NB 1BF0A 3AUBA 1JC6A 4NTYB 1D0DB 2ODYE 3UOUB 7PTIA 4Y10I 3TPII 4TPII 3FP6I 1BPTA 8PTIA 2IJOI 1LD6A 1D0DA 1AAPA 1QLQA 2KCRA 1FANA 3BTWI 4Y0ZI 1BHCA 3UIRC 1YLCB 2CA7A 6PTIA 1P2OB 3M7QB 5JB6A 1DTKA 3AUCA 3TGJI 1TAWB 3TGII 1NAGA 3WNYA 4ISOB 4BNRI 1BRCI 3U1JE 3AUHA 3L33E 4WXVC 1KIGI 9PTIA 1BZXI 1LD5A 1TAPA 5C67C 4DG4C 1ZJDB 2M01A 3TGKI 4BD9B 2FTMB 1BUNB 3BTGI 2ZJXA 3FP8I 1DENA 3P95E 1YKTB 1FAKI 2HEXA 1JV9A 4NTWB 1JV8A 1BZ5A 1ZR0B 2ZVXA 2DDIA 1TPAI 3GYMI 4WWYC 1P2NB 1UUAA 1SHPA 1F7ZI 2TPII 1KNTA 3LDJA 2W8XA 2FI3I 3D65I 1IRHA 4U32X 4NTXB 3AUEA 5PTIA 1KTHA 3BTQI 3BTMI 1CA0D 3L3TE 2FTLI 2M99A 4PTIA 1PITA 5JB4A 1B0CA 1K6UA 2FI5I 1G6XA 3P92E 1CBWD 3BTDI 2PTCI 4Y0YI 1CO7I 5JB5A 2KAII 3BYBA 2LFLA 3AUDA 1OA55 1P2II 4DTGK 5JB7A 3BTTI 2RA3C 1T7CB 1EJMB 1YC0I 3BTEI 1T8OB 1BIKA 1Y62A 3BTFI 3LDMA 2JOTA 1P2JI 1TOCR 1TFXC 4BQDA 2KNTA 3BTKI 1P2MB 1BRBI 1DTXA 2LFKA 3LDIA 1MTND 1EAWB 1T8LB 3T62D 1ADZA 3OFWA 1BPIA 3OTJI 1T8MB 4ISLB 2J6DA 1KUNA 3CI7A 3AUIA 1FY8I 2TGPI 4Y11I 4ISNB 2DDJA 1F5RI 1BTHP 1P2KI 1YLDB 1OA65 2UUXA
chains in the Genus database with same CATH topology
1AALA 2FI4I 1UUBA 3AUGA 3BTHI 1BTIA 2R9PE 2UUYB 1TCPA 1DEMA 1P2QB 3FP7J 4U30W 1T8NB 1BF0A 3AUBA 1JC6A 4NTYB 1D0DB 2ODYE 3UOUB 7PTIA 4Y10I 3TPII 4TPII 3FP6I 1BPTA 8PTIA 2IJOI 1LD6A 1D0DA 1AAPA 1QLQA 2KCRA 1FANA 3BTWI 4Y0ZI 1BHCA 3UIRC 1YLCB 2CA7A 6PTIA 1P2OB 3M7QB 5JB6A 1DTKA 3AUCA 3TGJI 1TAWB 3TGII 1NAGA 3WNYA 4ISOB 4BNRI 1BRCI 3U1JE 3AUHA 3L33E 4WXVC 1KIGI 9PTIA 1BZXI 1LD5A 1TAPA 5C67C 4DG4C 1ZJDB 2M01A 3TGKI 4BD9B 2FTMB 1BUNB 3BTGI 2ZJXA 3FP8I 1DENA 3P95E 1YKTB 1FAKI 2HEXA 1JV9A 4NTWB 1JV8A 1BZ5A 1ZR0B 2ZVXA 2DDIA 1TPAI 3GYMI 4WWYC 1P2NB 1UUAA 1SHPA 1F7ZI 2TPII 1KNTA 3LDJA 2W8XA 2FI3I 3D65I 1IRHA 4U32X 4NTXB 3AUEA 5PTIA 1KTHA 3BTQI 3BTMI 1CA0D 3L3TE 2FTLI 2M99A 4PTIA 1PITA 5JB4A 1B0CA 1K6UA 2FI5I 1G6XA 3P92E 1CBWD 3BTDI 2PTCI 4Y0YI 1CO7I 5JB5A 2KAII 3BYBA 2LFLA 3AUDA 1OA55 1P2II 4DTGK 5JB7A 3BTTI 2RA3C 1T7CB 1EJMB 1YC0I 3BTEI 1T8OB 1BIKA 1Y62A 3BTFI 3LDMA 2JOTA 1P2JI 1TOCR 1TFXC 4BQDA 2KNTA 3BTKI 1P2MB 1BRBI 1DTXA 2LFKA 3LDIA 1MTND 1EAWB 1T8LB 3T62D 1ADZA 3OFWA 1BPIA 3OTJI 1T8MB 4ISLB 2J6DA 1KUNA 3CI7A 3AUIA 1FY8I 2TGPI 4Y11I 4ISNB 2DDJA 1F5RI 1BTHP 1P2KI 1YLDB 1OA65 2UUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAL A;  2FI4 I;  1UUB A;  3AUG A;  3BTH I;  1BTI A;  2R9P E;  2UUY B;  1TCP A;  1DEM A;  1P2Q B;  3FP7 J;  4U30 W;  1T8N B;  1BF0 A;  3AUB A;  1JC6 A;  4NTY B;  1D0D B;  2ODY E;  3UOU B;  7PTI A;  4Y10 I;  3TPI I;  4TPI I;  3FP6 I;  1BPT A;  8PTI A;  2IJO I;  1LD6 A;  1D0D A;  1AAP A;  1QLQ A;  2KCR A;  1FAN A;  3BTW I;  4Y0Z I;  1BHC A;  3UIR C;  1YLC B;  2CA7 A;  6PTI A;  1P2O B;  3M7Q B;  5JB6 A;  1DTK A;  3AUC A;  3TGJ I;  1TAW B;  3TGI I;  1NAG A;  3WNY A;  4ISO B;  4BNR I;  1BRC I;  3U1J E;  3AUH A;  3L33 E;  4WXV C;  1KIG I;  9PTI A;  1BZX I;  1LD5 A;  1TAP A;  5C67 C;  4DG4 C;  1ZJD B;  2M01 A;  3TGK I;  4BD9 B;  2FTM B;  1BUN B;  3BTG I;  2ZJX A;  3FP8 I;  1DEN A;  3P95 E;  1YKT B;  1FAK I;  2HEX A;  1JV9 A;  4NTW B;  1JV8 A;  1BZ5 A;  1ZR0 B;  2ZVX A;  2DDI A;  1TPA I;  3GYM I;  4WWY C;  1P2N B;  1UUA A;  1SHP A;  1F7Z I;  2TPI I;  1KNT A;  3LDJ A;  2W8X A;  2FI3 I;  3D65 I;  1IRH A;  4U32 X;  4NTX B;  3AUE A;  5PTI A;  1KTH A;  3BTQ I;  3BTM I;  1CA0 D;  3L3T E;  2FTL I;  2M99 A;  4PTI A;  1PIT A;  5JB4 A;  1B0C A;  1K6U A;  2FI5 I;  1G6X A;  3P92 E;  1CBW D;  3BTD I;  2PTC I;  4Y0Y I;  1CO7 I;  5JB5 A;  2KAI I;  3BYB A;  2LFL A;  3AUD A;  1OA5 5;  1P2I I;  4DTG K;  5JB7 A;  3BTT I;  2RA3 C;  1T7C B;  1EJM B;  1YC0 I;  3BTE I;  1T8O B;  1BIK A;  1Y62 A;  3BTF I;  3LDM A;  2JOT A;  1P2J I;  1TOC R;  1TFX C;  4BQD A;  2KNT A;  3BTK I;  1P2M B;  1BRB I;  1DTX A;  2LFK A;  3LDI A;  1MTN D;  1EAW B;  1T8L B;  3T62 D;  1ADZ A;  3OFW A;  1BPI A;  3OTJ I;  1T8M B;  4ISL B;  2J6D A;  1KUN A;  3CI7 A;  3AUI A;  1FY8 I;  2TGP I;  4Y11 I;  4ISN B;  2DDJ A;  1F5R I;  1BTH P;  1P2K I;  1YLD B;  1OA6 5;  2UUX A; 
#chains in the Genus database with same CATH topology
 1AAL A;  2FI4 I;  1UUB A;  3AUG A;  3BTH I;  1BTI A;  2R9P E;  2UUY B;  1TCP A;  1DEM A;  1P2Q B;  3FP7 J;  4U30 W;  1T8N B;  1BF0 A;  3AUB A;  1JC6 A;  4NTY B;  1D0D B;  2ODY E;  3UOU B;  7PTI A;  4Y10 I;  3TPI I;  4TPI I;  3FP6 I;  1BPT A;  8PTI A;  2IJO I;  1LD6 A;  1D0D A;  1AAP A;  1QLQ A;  2KCR A;  1FAN A;  3BTW I;  4Y0Z I;  1BHC A;  3UIR C;  1YLC B;  2CA7 A;  6PTI A;  1P2O B;  3M7Q B;  5JB6 A;  1DTK A;  3AUC A;  3TGJ I;  1TAW B;  3TGI I;  1NAG A;  3WNY A;  4ISO B;  4BNR I;  1BRC I;  3U1J E;  3AUH A;  3L33 E;  4WXV C;  1KIG I;  9PTI A;  1BZX I;  1LD5 A;  1TAP A;  5C67 C;  4DG4 C;  1ZJD B;  2M01 A;  3TGK I;  4BD9 B;  2FTM B;  1BUN B;  3BTG I;  2ZJX A;  3FP8 I;  1DEN A;  3P95 E;  1YKT B;  1FAK I;  2HEX A;  1JV9 A;  4NTW B;  1JV8 A;  1BZ5 A;  1ZR0 B;  2ZVX A;  2DDI A;  1TPA I;  3GYM I;  4WWY C;  1P2N B;  1UUA A;  1SHP A;  1F7Z I;  2TPI I;  1KNT A;  3LDJ A;  2W8X A;  2FI3 I;  3D65 I;  1IRH A;  4U32 X;  4NTX B;  3AUE A;  5PTI A;  1KTH A;  3BTQ I;  3BTM I;  1CA0 D;  3L3T E;  2FTL I;  2M99 A;  4PTI A;  1PIT A;  5JB4 A;  1B0C A;  1K6U A;  2FI5 I;  1G6X A;  3P92 E;  1CBW D;  3BTD I;  2PTC I;  4Y0Y I;  1CO7 I;  5JB5 A;  2KAI I;  3BYB A;  2LFL A;  3AUD A;  1OA5 5;  1P2I I;  4DTG K;  5JB7 A;  3BTT I;  2RA3 C;  1T7C B;  1EJM B;  1YC0 I;  3BTE I;  1T8O B;  1BIK A;  1Y62 A;  3BTF I;  3LDM A;  2JOT A;  1P2J I;  1TOC R;  1TFX C;  4BQD A;  2KNT A;  3BTK I;  1P2M B;  1BRB I;  1DTX A;  2LFK A;  3LDI A;  1MTN D;  1EAW B;  1T8L B;  3T62 D;  1ADZ A;  3OFW A;  1BPI A;  3OTJ I;  1T8M B;  4ISL B;  2J6D A;  1KUN A;  3CI7 A;  3AUI A;  1FY8 I;  2TGP I;  4Y11 I;  4ISN B;  2DDJ A;  1F5R I;  1BTH P;  1P2K I;  1YLD B;  1OA6 5;  2UUX A; 
#chains in the Genus database with same CATH homology
 1AAL A;  2FI4 I;  1UUB A;  3AUG A;  3BTH I;  1BTI A;  2R9P E;  2UUY B;  1TCP A;  1DEM A;  1P2Q B;  3FP7 J;  4U30 W;  1T8N B;  1BF0 A;  3AUB A;  1JC6 A;  4NTY B;  1D0D B;  2ODY E;  3UOU B;  7PTI A;  4Y10 I;  3TPI I;  4TPI I;  3FP6 I;  1BPT A;  8PTI A;  2IJO I;  1LD6 A;  1D0D A;  1AAP A;  1QLQ A;  2KCR A;  1FAN A;  3BTW I;  4Y0Z I;  1BHC A;  3UIR C;  1YLC B;  2CA7 A;  6PTI A;  1P2O B;  3M7Q B;  5JB6 A;  1DTK A;  3AUC A;  3TGJ I;  1TAW B;  3TGI I;  1NAG A;  3WNY A;  4ISO B;  4BNR I;  1BRC I;  3U1J E;  3AUH A;  3L33 E;  4WXV C;  1KIG I;  9PTI A;  1BZX I;  1LD5 A;  1TAP A;  5C67 C;  4DG4 C;  1ZJD B;  2M01 A;  3TGK I;  4BD9 B;  2FTM B;  1BUN B;  3BTG I;  2ZJX A;  3FP8 I;  1DEN A;  3P95 E;  1YKT B;  1FAK I;  2HEX A;  1JV9 A;  4NTW B;  1JV8 A;  1BZ5 A;  1ZR0 B;  2ZVX A;  2DDI A;  1TPA I;  3GYM I;  4WWY C;  1P2N B;  1UUA A;  1SHP A;  1F7Z I;  2TPI I;  1KNT A;  3LDJ A;  2W8X A;  2FI3 I;  3D65 I;  1IRH A;  4U32 X;  4NTX B;  3AUE A;  5PTI A;  1KTH A;  3BTQ I;  3BTM I;  1CA0 D;  3L3T E;  2FTL I;  2M99 A;  4PTI A;  1PIT A;  5JB4 A;  1B0C A;  1K6U A;  2FI5 I;  1G6X A;  3P92 E;  1CBW D;  3BTD I;  2PTC I;  4Y0Y I;  1CO7 I;  5JB5 A;  2KAI I;  3BYB A;  2LFL A;  3AUD A;  1OA5 5;  1P2I I;  4DTG K;  5JB7 A;  3BTT I;  2RA3 C;  1T7C B;  1EJM B;  1YC0 I;  3BTE I;  1T8O B;  1BIK A;  1Y62 A;  3BTF I;  3LDM A;  2JOT A;  1P2J I;  1TOC R;  1TFX C;  4BQD A;  2KNT A;  3BTK I;  1P2M B;  1BRB I;  1DTX A;  2LFK A;  3LDI A;  1MTN D;  1EAW B;  1T8L B;  3T62 D;  1ADZ A;  3OFW A;  1BPI A;  3OTJ I;  1T8M B;  4ISL B;  2J6D A;  1KUN A;  3CI7 A;  3AUI A;  1FY8 I;  2TGP I;  4Y11 I;  4ISN B;  2DDJ A;  1F5R I;  1BTH P;  1P2K I;  1YLD B;  1OA6 5;  2UUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...