1JC6A

Solution structure of bungarus faciatus ix, a kunitz-type chymotrypsin inhibitor
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
KNRPTFCNLLPETGRCNALIPAFYYNSHLHKCQKFNYGGCGGNANNFKTIDECQRTCAAKYGRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords VENOM BASIC PROTEASE INHIBITORS IX AND VIIIB
publication title Solution structure of a Kunitz-type chymotrypsin inhibitor isolated from the elapid snake Bungarus fasciatus
pubmed doi rcsb
total genus 5
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 1jc6A00
4PTIA 1BTHP 1BZ5A 1TPAI 1BHCA 1KTHA 3BTHI 1UUAA 2M99A 1CO7I 4NTXB 2KNTA 2HEXA 1D0DB 3BYBA 3LDJA 3BTTI 4U32X 1T8LB 1TOCR 4Y0ZI 2UUYB 1LD6A 4BD9B 3FP6I 1NAGA 3P92E 2KAII 1QLQA 1DEMA 1JV9A 1BPTA 2TPII 1PITA 3M7QB 3GYMI 2M01A 1SHPA 1P2II 1TAWB 1P2QB 3AUEA 4WXVC 1F7ZI 3AUGA 5JB6A 1DENA 1BIKA 4DTGK 1DTXA 3L3TE 2IJOI 1BUNB 1ZR0B 1OA65 1K6UA 3AUCA 3U1JE 1T8MB 1MTND 1D0DA 1KIGI 2ODYE 3BTMI 4NTWB 2DDJA 2J6DA 3AUIA 3P95E 2CA7A 2ZVXA 2R9PE 4NTYB 1KNTA 2LFLA 2W8XA 3BTWI 3BTQI 2ZJXA 1YLDB 3BTDI 1CA0D 3LDIA 3UIRC 3UOUB 3L33E 4ISNB 1G6XA 3FP8I 1ADZA 3BTKI 3AUDA 5PTIA 3TGJI 3WNYA 5C67C 3TGII 5JB7A 1TFXC 1AALA 3AUHA 3CI7A 4Y11I 3AUBA 1TAPA 1F5RI 5JB5A 2LFKA 4BQDA 1JV8A 2FI5I 1P2MB 1BRCI 1BRBI 2UUXA 4WWYC 4ISOB 1EJMB 1Y62A 1BTIA 6PTIA 1B0CA 1P2OB 4U30W 1YC0I 1EAWB 4ISLB 2JOTA 9PTIA 1IRHA 1FAKI 2FI3I 3TGKI 3TPII 4BNRI 1TCPA 5JB4A 1FY8I 2DDIA 4TPII 1LD5A 3D65I 2FTLI 1YLCB 2FI4I 2PTCI 1P2JI 1T8OB 3FP7J 2RA3C 4Y10I 3BTFI 1YKTB 1OA55 1DTKA 1BZXI 1UUBA 2KCRA 4Y0YI 7PTIA 3OFWA 8PTIA 1ZJDB 3BTEI 1T8NB 1CBWD 2TGPI 1P2NB 1T7CB 3T62D 1AAPA 1KUNA 4DG4C 1FANA 3LDMA 1JC6A 1P2KI 2FTMB 3OTJI 3BTGI 1BF0A 1BPIA
chains in the Genus database with same CATH superfamily
4PTIA 1BTHP 1BZ5A 1TPAI 1BHCA 1KTHA 3BTHI 1UUAA 2M99A 1CO7I 4NTXB 2KNTA 2HEXA 1D0DB 3BYBA 3LDJA 3BTTI 4U32X 1T8LB 1TOCR 4Y0ZI 2UUYB 1LD6A 4BD9B 3FP6I 1NAGA 3P92E 2KAII 1QLQA 1DEMA 1JV9A 1BPTA 2TPII 1PITA 3M7QB 3GYMI 2M01A 1SHPA 1P2II 1TAWB 1P2QB 3AUEA 4WXVC 1F7ZI 3AUGA 5JB6A 1DENA 1BIKA 4DTGK 1DTXA 3L3TE 2IJOI 1BUNB 1ZR0B 1OA65 1K6UA 3AUCA 3U1JE 1T8MB 1MTND 1D0DA 1KIGI 2ODYE 3BTMI 4NTWB 2DDJA 2J6DA 3AUIA 3P95E 2CA7A 2ZVXA 2R9PE 4NTYB 1KNTA 2LFLA 2W8XA 3BTWI 3BTQI 2ZJXA 1YLDB 3BTDI 1CA0D 3LDIA 3UIRC 3UOUB 3L33E 4ISNB 1G6XA 3FP8I 1ADZA 3BTKI 3AUDA 5PTIA 3TGJI 3WNYA 5C67C 3TGII 5JB7A 1TFXC 1AALA 3AUHA 3CI7A 4Y11I 3AUBA 1TAPA 1F5RI 5JB5A 2LFKA 4BQDA 1JV8A 2FI5I 1P2MB 1BRCI 1BRBI 2UUXA 4WWYC 4ISOB 1EJMB 1Y62A 1BTIA 6PTIA 1B0CA 1P2OB 4U30W 1YC0I 1EAWB 4ISLB 2JOTA 9PTIA 1IRHA 1FAKI 2FI3I 3TGKI 3TPII 4BNRI 1TCPA 5JB4A 1FY8I 2DDIA 4TPII 1LD5A 3D65I 2FTLI 1YLCB 2FI4I 2PTCI 1P2JI 1T8OB 3FP7J 2RA3C 4Y10I 3BTFI 1YKTB 1OA55 1DTKA 1BZXI 1UUBA 2KCRA 4Y0YI 7PTIA 3OFWA 8PTIA 1ZJDB 3BTEI 1T8NB 1CBWD 2TGPI 1P2NB 1T7CB 3T62D 1AAPA 1KUNA 4DG4C 1FANA 3LDMA 1JC6A 1P2KI 2FTMB 3OTJI 3BTGI 1BF0A 1BPIA
chains in the Genus database with same CATH topology
4PTIA 1BTHP 1BZ5A 1TPAI 1BHCA 1KTHA 3BTHI 1UUAA 2M99A 1CO7I 4NTXB 2KNTA 2HEXA 1D0DB 3BYBA 3LDJA 3BTTI 4U32X 1T8LB 1TOCR 4Y0ZI 2UUYB 1LD6A 4BD9B 3FP6I 1NAGA 3P92E 2KAII 1QLQA 1DEMA 1JV9A 1BPTA 2TPII 1PITA 3M7QB 3GYMI 2M01A 1SHPA 1P2II 1TAWB 1P2QB 3AUEA 4WXVC 1F7ZI 3AUGA 5JB6A 1DENA 1BIKA 4DTGK 1DTXA 3L3TE 2IJOI 1BUNB 1ZR0B 1OA65 1K6UA 3AUCA 3U1JE 1T8MB 1MTND 1D0DA 1KIGI 2ODYE 3BTMI 4NTWB 2DDJA 2J6DA 3AUIA 3P95E 2CA7A 2ZVXA 2R9PE 4NTYB 1KNTA 2LFLA 2W8XA 3BTWI 3BTQI 2ZJXA 1YLDB 3BTDI 1CA0D 3LDIA 3UIRC 3UOUB 3L33E 4ISNB 1G6XA 3FP8I 1ADZA 3BTKI 3AUDA 5PTIA 3TGJI 3WNYA 5C67C 3TGII 5JB7A 1TFXC 1AALA 3AUHA 3CI7A 4Y11I 3AUBA 1TAPA 1F5RI 5JB5A 2LFKA 4BQDA 1JV8A 2FI5I 1P2MB 1BRCI 1BRBI 2UUXA 4WWYC 4ISOB 1EJMB 1Y62A 1BTIA 6PTIA 1B0CA 1P2OB 4U30W 1YC0I 1EAWB 4ISLB 2JOTA 9PTIA 1IRHA 1FAKI 2FI3I 3TGKI 3TPII 4BNRI 1TCPA 5JB4A 1FY8I 2DDIA 4TPII 1LD5A 3D65I 2FTLI 1YLCB 2FI4I 2PTCI 1P2JI 1T8OB 3FP7J 2RA3C 4Y10I 3BTFI 1YKTB 1OA55 1DTKA 1BZXI 1UUBA 2KCRA 4Y0YI 7PTIA 3OFWA 8PTIA 1ZJDB 3BTEI 1T8NB 1CBWD 2TGPI 1P2NB 1T7CB 3T62D 1AAPA 1KUNA 4DG4C 1FANA 3LDMA 1JC6A 1P2KI 2FTMB 3OTJI 3BTGI 1BF0A 1BPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PTI A;  1BTH P;  1BZ5 A;  1TPA I;  1BHC A;  1KTH A;  3BTH I;  1UUA A;  2M99 A;  1CO7 I;  4NTX B;  2KNT A;  2HEX A;  1D0D B;  3BYB A;  3LDJ A;  3BTT I;  4U32 X;  1T8L B;  1TOC R;  4Y0Z I;  2UUY B;  1LD6 A;  4BD9 B;  3FP6 I;  1NAG A;  3P92 E;  2KAI I;  1QLQ A;  1DEM A;  1JV9 A;  1BPT A;  2TPI I;  1PIT A;  3M7Q B;  3GYM I;  2M01 A;  1SHP A;  1P2I I;  1TAW B;  1P2Q B;  3AUE A;  4WXV C;  1F7Z I;  3AUG A;  5JB6 A;  1DEN A;  1BIK A;  4DTG K;  1DTX A;  3L3T E;  2IJO I;  1BUN B;  1ZR0 B;  1OA6 5;  1K6U A;  3AUC A;  3U1J E;  1T8M B;  1MTN D;  1D0D A;  1KIG I;  2ODY E;  3BTM I;  4NTW B;  2DDJ A;  2J6D A;  3AUI A;  3P95 E;  2CA7 A;  2ZVX A;  2R9P E;  4NTY B;  1KNT A;  2LFL A;  2W8X A;  3BTW I;  3BTQ I;  2ZJX A;  1YLD B;  3BTD I;  1CA0 D;  3LDI A;  3UIR C;  3UOU B;  3L33 E;  4ISN B;  1G6X A;  3FP8 I;  1ADZ A;  3BTK I;  3AUD A;  5PTI A;  3TGJ I;  3WNY A;  5C67 C;  3TGI I;  5JB7 A;  1TFX C;  1AAL A;  3AUH A;  3CI7 A;  4Y11 I;  3AUB A;  1TAP A;  1F5R I;  5JB5 A;  2LFK A;  4BQD A;  1JV8 A;  2FI5 I;  1P2M B;  1BRC I;  1BRB I;  2UUX A;  4WWY C;  4ISO B;  1EJM B;  1Y62 A;  1BTI A;  6PTI A;  1B0C A;  1P2O B;  4U30 W;  1YC0 I;  1EAW B;  4ISL B;  2JOT A;  9PTI A;  1IRH A;  1FAK I;  2FI3 I;  3TGK I;  3TPI I;  4BNR I;  1TCP A;  5JB4 A;  1FY8 I;  2DDI A;  4TPI I;  1LD5 A;  3D65 I;  2FTL I;  1YLC B;  2FI4 I;  2PTC I;  1P2J I;  1T8O B;  3FP7 J;  2RA3 C;  4Y10 I;  3BTF I;  1YKT B;  1OA5 5;  1DTK A;  1BZX I;  1UUB A;  2KCR A;  4Y0Y I;  7PTI A;  3OFW A;  8PTI A;  1ZJD B;  3BTE I;  1T8N B;  1CBW D;  2TGP I;  1P2N B;  1T7C B;  3T62 D;  1AAP A;  1KUN A;  4DG4 C;  1FAN A;  3LDM A;  1JC6 A;  1P2K I;  2FTM B;  3OTJ I;  3BTG I;  1BF0 A;  1BPI A; 
#chains in the Genus database with same CATH topology
 4PTI A;  1BTH P;  1BZ5 A;  1TPA I;  1BHC A;  1KTH A;  3BTH I;  1UUA A;  2M99 A;  1CO7 I;  4NTX B;  2KNT A;  2HEX A;  1D0D B;  3BYB A;  3LDJ A;  3BTT I;  4U32 X;  1T8L B;  1TOC R;  4Y0Z I;  2UUY B;  1LD6 A;  4BD9 B;  3FP6 I;  1NAG A;  3P92 E;  2KAI I;  1QLQ A;  1DEM A;  1JV9 A;  1BPT A;  2TPI I;  1PIT A;  3M7Q B;  3GYM I;  2M01 A;  1SHP A;  1P2I I;  1TAW B;  1P2Q B;  3AUE A;  4WXV C;  1F7Z I;  3AUG A;  5JB6 A;  1DEN A;  1BIK A;  4DTG K;  1DTX A;  3L3T E;  2IJO I;  1BUN B;  1ZR0 B;  1OA6 5;  1K6U A;  3AUC A;  3U1J E;  1T8M B;  1MTN D;  1D0D A;  1KIG I;  2ODY E;  3BTM I;  4NTW B;  2DDJ A;  2J6D A;  3AUI A;  3P95 E;  2CA7 A;  2ZVX A;  2R9P E;  4NTY B;  1KNT A;  2LFL A;  2W8X A;  3BTW I;  3BTQ I;  2ZJX A;  1YLD B;  3BTD I;  1CA0 D;  3LDI A;  3UIR C;  3UOU B;  3L33 E;  4ISN B;  1G6X A;  3FP8 I;  1ADZ A;  3BTK I;  3AUD A;  5PTI A;  3TGJ I;  3WNY A;  5C67 C;  3TGI I;  5JB7 A;  1TFX C;  1AAL A;  3AUH A;  3CI7 A;  4Y11 I;  3AUB A;  1TAP A;  1F5R I;  5JB5 A;  2LFK A;  4BQD A;  1JV8 A;  2FI5 I;  1P2M B;  1BRC I;  1BRB I;  2UUX A;  4WWY C;  4ISO B;  1EJM B;  1Y62 A;  1BTI A;  6PTI A;  1B0C A;  1P2O B;  4U30 W;  1YC0 I;  1EAW B;  4ISL B;  2JOT A;  9PTI A;  1IRH A;  1FAK I;  2FI3 I;  3TGK I;  3TPI I;  4BNR I;  1TCP A;  5JB4 A;  1FY8 I;  2DDI A;  4TPI I;  1LD5 A;  3D65 I;  2FTL I;  1YLC B;  2FI4 I;  2PTC I;  1P2J I;  1T8O B;  3FP7 J;  2RA3 C;  4Y10 I;  3BTF I;  1YKT B;  1OA5 5;  1DTK A;  1BZX I;  1UUB A;  2KCR A;  4Y0Y I;  7PTI A;  3OFW A;  8PTI A;  1ZJD B;  3BTE I;  1T8N B;  1CBW D;  2TGP I;  1P2N B;  1T7C B;  3T62 D;  1AAP A;  1KUN A;  4DG4 C;  1FAN A;  3LDM A;  1JC6 A;  1P2K I;  2FTM B;  3OTJ I;  3BTG I;  1BF0 A;  1BPI A; 
#chains in the Genus database with same CATH homology
 4PTI A;  1BTH P;  1BZ5 A;  1TPA I;  1BHC A;  1KTH A;  3BTH I;  1UUA A;  2M99 A;  1CO7 I;  4NTX B;  2KNT A;  2HEX A;  1D0D B;  3BYB A;  3LDJ A;  3BTT I;  4U32 X;  1T8L B;  1TOC R;  4Y0Z I;  2UUY B;  1LD6 A;  4BD9 B;  3FP6 I;  1NAG A;  3P92 E;  2KAI I;  1QLQ A;  1DEM A;  1JV9 A;  1BPT A;  2TPI I;  1PIT A;  3M7Q B;  3GYM I;  2M01 A;  1SHP A;  1P2I I;  1TAW B;  1P2Q B;  3AUE A;  4WXV C;  1F7Z I;  3AUG A;  5JB6 A;  1DEN A;  1BIK A;  4DTG K;  1DTX A;  3L3T E;  2IJO I;  1BUN B;  1ZR0 B;  1OA6 5;  1K6U A;  3AUC A;  3U1J E;  1T8M B;  1MTN D;  1D0D A;  1KIG I;  2ODY E;  3BTM I;  4NTW B;  2DDJ A;  2J6D A;  3AUI A;  3P95 E;  2CA7 A;  2ZVX A;  2R9P E;  4NTY B;  1KNT A;  2LFL A;  2W8X A;  3BTW I;  3BTQ I;  2ZJX A;  1YLD B;  3BTD I;  1CA0 D;  3LDI A;  3UIR C;  3UOU B;  3L33 E;  4ISN B;  1G6X A;  3FP8 I;  1ADZ A;  3BTK I;  3AUD A;  5PTI A;  3TGJ I;  3WNY A;  5C67 C;  3TGI I;  5JB7 A;  1TFX C;  1AAL A;  3AUH A;  3CI7 A;  4Y11 I;  3AUB A;  1TAP A;  1F5R I;  5JB5 A;  2LFK A;  4BQD A;  1JV8 A;  2FI5 I;  1P2M B;  1BRC I;  1BRB I;  2UUX A;  4WWY C;  4ISO B;  1EJM B;  1Y62 A;  1BTI A;  6PTI A;  1B0C A;  1P2O B;  4U30 W;  1YC0 I;  1EAW B;  4ISL B;  2JOT A;  9PTI A;  1IRH A;  1FAK I;  2FI3 I;  3TGK I;  3TPI I;  4BNR I;  1TCP A;  5JB4 A;  1FY8 I;  2DDI A;  4TPI I;  1LD5 A;  3D65 I;  2FTL I;  1YLC B;  2FI4 I;  2PTC I;  1P2J I;  1T8O B;  3FP7 J;  2RA3 C;  4Y10 I;  3BTF I;  1YKT B;  1OA5 5;  1DTK A;  1BZX I;  1UUB A;  2KCR A;  4Y0Y I;  7PTI A;  3OFW A;  8PTI A;  1ZJD B;  3BTE I;  1T8N B;  1CBW D;  2TGP I;  1P2N B;  1T7C B;  3T62 D;  1AAP A;  1KUN A;  4DG4 C;  1FAN A;  3LDM A;  1JC6 A;  1P2K I;  2FTM B;  3OTJ I;  3BTG I;  1BF0 A;  1BPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...