1JV8A

Nmr structure of bpti mutant g37a
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
58
structure length
58
Chain Sequence
RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGACRAKRNNFKSAEDCMRTCGGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords TRYPSIN INHIBITOR
publication title A highly destabilizing mutation, G37A, of the bovine pancreatic trypsin inhibitor retains the average native conformation but greatly increases local flexibility
pubmed doi rcsb
source organism Bos taurus
total genus 4
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2001-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 1jv8A00
2CA7A 3T62D 1DTKA 1JC6A 1DENA 1UUAA 7PTIA 2FTLI 3LDJA 1YKTB 3OTJI 1P2MB 1PITA 3UIRC 3AUGA 1T8NB 3OFWA 2J6DA 4ISLB 1F7ZI 3AUBA 2M99A 1BHCA 1BUNB 4DTGK 2W8XA 4NTWB 1KIGI 1YC0I 3P92E 5JB4A 2KNTA 4Y10I 1TOCR 2FI5I 2TPII 1BRCI 1TAWB 3BTDI 1BPTA 3CI7A 3BTFI 3BTMI 3D65I 2HEXA 3FP8I 1P2KI 2M01A 1DTXA 1BPIA 4NTYB 6PTIA 1JV8A 1P2QB 3FP6I 1LD5A 3BTQI 2FI3I 3AUHA 3BTHI 1SHPA 3AUIA 1G6XA 2RA3C 2LFLA 4WWYC 4TPII 2JOTA 3L33E 4NTXB 3GYMI 4U32X 3UOUB 1AALA 3AUDA 2ODYE 2KCRA 5JB7A 1BZXI 2ZJXA 8PTIA 1D0DA 1YLDB 1T8MB 3M7QB 1MTND 1ADZA 3TGKI 1KUNA 2FTMB 3BTGI 1B0CA 1TAPA 2KAII 2DDIA 1EJMB 1DEMA 5PTIA 5JB6A 4BQDA 3BTTI 4PTIA 1CA0D 3L3TE 1P2JI 1P2OB 4U30W 1T8LB 1ZR0B 1OA55 1ZJDB 2UUXA 1YLCB 2PTCI 2ZVXA 4ISOB 1T8OB 1UUBA 5C67C 1P2II 4DG4C 1JV9A 4BNRI 1T7CB 3P95E 1IRHA 3U1JE 1CO7I 3BTKI 1TPAI 3BYBA 1BRBI 4Y11I 2LFKA 4ISNB 1BF0A 1KTHA 2TGPI 1QLQA 4WXVC 1KNTA 1TFXC 3TPII 3LDMA 1BZ5A 1LD6A 1FAKI 2UUYB 3WNYA 1AAPA 2IJOI 5JB5A 1BTIA 1F5RI 3AUCA 1CBWD 1Y62A 4Y0YI 3LDIA 3TGII 1P2NB 3FP7J 3AUEA 4BD9B 3BTWI 3TGJI 2DDJA 1FY8I 1EAWB 2FI4I 4Y0ZI 3BTEI 1OA65 1K6UA 1BTHP 1TCPA 2R9PE 1NAGA 1FANA 1BIKA 9PTIA 1D0DB
chains in the Genus database with same CATH superfamily
2CA7A 3T62D 1DTKA 1JC6A 1DENA 1UUAA 7PTIA 2FTLI 3LDJA 1YKTB 3OTJI 1P2MB 1PITA 3UIRC 3AUGA 1T8NB 3OFWA 2J6DA 4ISLB 1F7ZI 3AUBA 2M99A 1BHCA 1BUNB 4DTGK 2W8XA 4NTWB 1KIGI 1YC0I 3P92E 5JB4A 2KNTA 4Y10I 1TOCR 2FI5I 2TPII 1BRCI 1TAWB 3BTDI 1BPTA 3CI7A 3BTFI 3BTMI 3D65I 2HEXA 3FP8I 1P2KI 2M01A 1DTXA 1BPIA 4NTYB 6PTIA 1JV8A 1P2QB 3FP6I 1LD5A 3BTQI 2FI3I 3AUHA 3BTHI 1SHPA 3AUIA 1G6XA 2RA3C 2LFLA 4WWYC 4TPII 2JOTA 3L33E 4NTXB 3GYMI 4U32X 3UOUB 1AALA 3AUDA 2ODYE 2KCRA 5JB7A 1BZXI 2ZJXA 8PTIA 1D0DA 1YLDB 1T8MB 3M7QB 1MTND 1ADZA 3TGKI 1KUNA 2FTMB 3BTGI 1B0CA 1TAPA 2KAII 2DDIA 1EJMB 1DEMA 5PTIA 5JB6A 4BQDA 3BTTI 4PTIA 1CA0D 3L3TE 1P2JI 1P2OB 4U30W 1T8LB 1ZR0B 1OA55 1ZJDB 2UUXA 1YLCB 2PTCI 2ZVXA 4ISOB 1T8OB 1UUBA 5C67C 1P2II 4DG4C 1JV9A 4BNRI 1T7CB 3P95E 1IRHA 3U1JE 1CO7I 3BTKI 1TPAI 3BYBA 1BRBI 4Y11I 2LFKA 4ISNB 1BF0A 1KTHA 2TGPI 1QLQA 4WXVC 1KNTA 1TFXC 3TPII 3LDMA 1BZ5A 1LD6A 1FAKI 2UUYB 3WNYA 1AAPA 2IJOI 5JB5A 1BTIA 1F5RI 3AUCA 1CBWD 1Y62A 4Y0YI 3LDIA 3TGII 1P2NB 3FP7J 3AUEA 4BD9B 3BTWI 3TGJI 2DDJA 1FY8I 1EAWB 2FI4I 4Y0ZI 3BTEI 1OA65 1K6UA 1BTHP 1TCPA 2R9PE 1NAGA 1FANA 1BIKA 9PTIA 1D0DB
chains in the Genus database with same CATH topology
2CA7A 3T62D 1DTKA 1JC6A 1DENA 1UUAA 7PTIA 2FTLI 3LDJA 1YKTB 3OTJI 1P2MB 1PITA 3UIRC 3AUGA 1T8NB 3OFWA 2J6DA 4ISLB 1F7ZI 3AUBA 2M99A 1BHCA 1BUNB 4DTGK 2W8XA 4NTWB 1KIGI 1YC0I 3P92E 5JB4A 2KNTA 4Y10I 1TOCR 2FI5I 2TPII 1BRCI 1TAWB 3BTDI 1BPTA 3CI7A 3BTFI 3BTMI 3D65I 2HEXA 3FP8I 1P2KI 2M01A 1DTXA 1BPIA 4NTYB 6PTIA 1JV8A 1P2QB 3FP6I 1LD5A 3BTQI 2FI3I 3AUHA 3BTHI 1SHPA 3AUIA 1G6XA 2RA3C 2LFLA 4WWYC 4TPII 2JOTA 3L33E 4NTXB 3GYMI 4U32X 3UOUB 1AALA 3AUDA 2ODYE 2KCRA 5JB7A 1BZXI 2ZJXA 8PTIA 1D0DA 1YLDB 1T8MB 3M7QB 1MTND 1ADZA 3TGKI 1KUNA 2FTMB 3BTGI 1B0CA 1TAPA 2KAII 2DDIA 1EJMB 1DEMA 5PTIA 5JB6A 4BQDA 3BTTI 4PTIA 1CA0D 3L3TE 1P2JI 1P2OB 4U30W 1T8LB 1ZR0B 1OA55 1ZJDB 2UUXA 1YLCB 2PTCI 2ZVXA 4ISOB 1T8OB 1UUBA 5C67C 1P2II 4DG4C 1JV9A 4BNRI 1T7CB 3P95E 1IRHA 3U1JE 1CO7I 3BTKI 1TPAI 3BYBA 1BRBI 4Y11I 2LFKA 4ISNB 1BF0A 1KTHA 2TGPI 1QLQA 4WXVC 1KNTA 1TFXC 3TPII 3LDMA 1BZ5A 1LD6A 1FAKI 2UUYB 3WNYA 1AAPA 2IJOI 5JB5A 1BTIA 1F5RI 3AUCA 1CBWD 1Y62A 4Y0YI 3LDIA 3TGII 1P2NB 3FP7J 3AUEA 4BD9B 3BTWI 3TGJI 2DDJA 1FY8I 1EAWB 2FI4I 4Y0ZI 3BTEI 1OA65 1K6UA 1BTHP 1TCPA 2R9PE 1NAGA 1FANA 1BIKA 9PTIA 1D0DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CA7 A;  3T62 D;  1DTK A;  1JC6 A;  1DEN A;  1UUA A;  7PTI A;  2FTL I;  3LDJ A;  1YKT B;  3OTJ I;  1P2M B;  1PIT A;  3UIR C;  3AUG A;  1T8N B;  3OFW A;  2J6D A;  4ISL B;  1F7Z I;  3AUB A;  2M99 A;  1BHC A;  1BUN B;  4DTG K;  2W8X A;  4NTW B;  1KIG I;  1YC0 I;  3P92 E;  5JB4 A;  2KNT A;  4Y10 I;  1TOC R;  2FI5 I;  2TPI I;  1BRC I;  1TAW B;  3BTD I;  1BPT A;  3CI7 A;  3BTF I;  3BTM I;  3D65 I;  2HEX A;  3FP8 I;  1P2K I;  2M01 A;  1DTX A;  1BPI A;  4NTY B;  6PTI A;  1JV8 A;  1P2Q B;  3FP6 I;  1LD5 A;  3BTQ I;  2FI3 I;  3AUH A;  3BTH I;  1SHP A;  3AUI A;  1G6X A;  2RA3 C;  2LFL A;  4WWY C;  4TPI I;  2JOT A;  3L33 E;  4NTX B;  3GYM I;  4U32 X;  3UOU B;  1AAL A;  3AUD A;  2ODY E;  2KCR A;  5JB7 A;  1BZX I;  2ZJX A;  8PTI A;  1D0D A;  1YLD B;  1T8M B;  3M7Q B;  1MTN D;  1ADZ A;  3TGK I;  1KUN A;  2FTM B;  3BTG I;  1B0C A;  1TAP A;  2KAI I;  2DDI A;  1EJM B;  1DEM A;  5PTI A;  5JB6 A;  4BQD A;  3BTT I;  4PTI A;  1CA0 D;  3L3T E;  1P2J I;  1P2O B;  4U30 W;  1T8L B;  1ZR0 B;  1OA5 5;  1ZJD B;  2UUX A;  1YLC B;  2PTC I;  2ZVX A;  4ISO B;  1T8O B;  1UUB A;  5C67 C;  1P2I I;  4DG4 C;  1JV9 A;  4BNR I;  1T7C B;  3P95 E;  1IRH A;  3U1J E;  1CO7 I;  3BTK I;  1TPA I;  3BYB A;  1BRB I;  4Y11 I;  2LFK A;  4ISN B;  1BF0 A;  1KTH A;  2TGP I;  1QLQ A;  4WXV C;  1KNT A;  1TFX C;  3TPI I;  3LDM A;  1BZ5 A;  1LD6 A;  1FAK I;  2UUY B;  3WNY A;  1AAP A;  2IJO I;  5JB5 A;  1BTI A;  1F5R I;  3AUC A;  1CBW D;  1Y62 A;  4Y0Y I;  3LDI A;  3TGI I;  1P2N B;  3FP7 J;  3AUE A;  4BD9 B;  3BTW I;  3TGJ I;  2DDJ A;  1FY8 I;  1EAW B;  2FI4 I;  4Y0Z I;  3BTE I;  1OA6 5;  1K6U A;  1BTH P;  1TCP A;  2R9P E;  1NAG A;  1FAN A;  1BIK A;  9PTI A;  1D0D B; 
#chains in the Genus database with same CATH topology
 2CA7 A;  3T62 D;  1DTK A;  1JC6 A;  1DEN A;  1UUA A;  7PTI A;  2FTL I;  3LDJ A;  1YKT B;  3OTJ I;  1P2M B;  1PIT A;  3UIR C;  3AUG A;  1T8N B;  3OFW A;  2J6D A;  4ISL B;  1F7Z I;  3AUB A;  2M99 A;  1BHC A;  1BUN B;  4DTG K;  2W8X A;  4NTW B;  1KIG I;  1YC0 I;  3P92 E;  5JB4 A;  2KNT A;  4Y10 I;  1TOC R;  2FI5 I;  2TPI I;  1BRC I;  1TAW B;  3BTD I;  1BPT A;  3CI7 A;  3BTF I;  3BTM I;  3D65 I;  2HEX A;  3FP8 I;  1P2K I;  2M01 A;  1DTX A;  1BPI A;  4NTY B;  6PTI A;  1JV8 A;  1P2Q B;  3FP6 I;  1LD5 A;  3BTQ I;  2FI3 I;  3AUH A;  3BTH I;  1SHP A;  3AUI A;  1G6X A;  2RA3 C;  2LFL A;  4WWY C;  4TPI I;  2JOT A;  3L33 E;  4NTX B;  3GYM I;  4U32 X;  3UOU B;  1AAL A;  3AUD A;  2ODY E;  2KCR A;  5JB7 A;  1BZX I;  2ZJX A;  8PTI A;  1D0D A;  1YLD B;  1T8M B;  3M7Q B;  1MTN D;  1ADZ A;  3TGK I;  1KUN A;  2FTM B;  3BTG I;  1B0C A;  1TAP A;  2KAI I;  2DDI A;  1EJM B;  1DEM A;  5PTI A;  5JB6 A;  4BQD A;  3BTT I;  4PTI A;  1CA0 D;  3L3T E;  1P2J I;  1P2O B;  4U30 W;  1T8L B;  1ZR0 B;  1OA5 5;  1ZJD B;  2UUX A;  1YLC B;  2PTC I;  2ZVX A;  4ISO B;  1T8O B;  1UUB A;  5C67 C;  1P2I I;  4DG4 C;  1JV9 A;  4BNR I;  1T7C B;  3P95 E;  1IRH A;  3U1J E;  1CO7 I;  3BTK I;  1TPA I;  3BYB A;  1BRB I;  4Y11 I;  2LFK A;  4ISN B;  1BF0 A;  1KTH A;  2TGP I;  1QLQ A;  4WXV C;  1KNT A;  1TFX C;  3TPI I;  3LDM A;  1BZ5 A;  1LD6 A;  1FAK I;  2UUY B;  3WNY A;  1AAP A;  2IJO I;  5JB5 A;  1BTI A;  1F5R I;  3AUC A;  1CBW D;  1Y62 A;  4Y0Y I;  3LDI A;  3TGI I;  1P2N B;  3FP7 J;  3AUE A;  4BD9 B;  3BTW I;  3TGJ I;  2DDJ A;  1FY8 I;  1EAW B;  2FI4 I;  4Y0Z I;  3BTE I;  1OA6 5;  1K6U A;  1BTH P;  1TCP A;  2R9P E;  1NAG A;  1FAN A;  1BIK A;  9PTI A;  1D0D B; 
#chains in the Genus database with same CATH homology
 2CA7 A;  3T62 D;  1DTK A;  1JC6 A;  1DEN A;  1UUA A;  7PTI A;  2FTL I;  3LDJ A;  1YKT B;  3OTJ I;  1P2M B;  1PIT A;  3UIR C;  3AUG A;  1T8N B;  3OFW A;  2J6D A;  4ISL B;  1F7Z I;  3AUB A;  2M99 A;  1BHC A;  1BUN B;  4DTG K;  2W8X A;  4NTW B;  1KIG I;  1YC0 I;  3P92 E;  5JB4 A;  2KNT A;  4Y10 I;  1TOC R;  2FI5 I;  2TPI I;  1BRC I;  1TAW B;  3BTD I;  1BPT A;  3CI7 A;  3BTF I;  3BTM I;  3D65 I;  2HEX A;  3FP8 I;  1P2K I;  2M01 A;  1DTX A;  1BPI A;  4NTY B;  6PTI A;  1JV8 A;  1P2Q B;  3FP6 I;  1LD5 A;  3BTQ I;  2FI3 I;  3AUH A;  3BTH I;  1SHP A;  3AUI A;  1G6X A;  2RA3 C;  2LFL A;  4WWY C;  4TPI I;  2JOT A;  3L33 E;  4NTX B;  3GYM I;  4U32 X;  3UOU B;  1AAL A;  3AUD A;  2ODY E;  2KCR A;  5JB7 A;  1BZX I;  2ZJX A;  8PTI A;  1D0D A;  1YLD B;  1T8M B;  3M7Q B;  1MTN D;  1ADZ A;  3TGK I;  1KUN A;  2FTM B;  3BTG I;  1B0C A;  1TAP A;  2KAI I;  2DDI A;  1EJM B;  1DEM A;  5PTI A;  5JB6 A;  4BQD A;  3BTT I;  4PTI A;  1CA0 D;  3L3T E;  1P2J I;  1P2O B;  4U30 W;  1T8L B;  1ZR0 B;  1OA5 5;  1ZJD B;  2UUX A;  1YLC B;  2PTC I;  2ZVX A;  4ISO B;  1T8O B;  1UUB A;  5C67 C;  1P2I I;  4DG4 C;  1JV9 A;  4BNR I;  1T7C B;  3P95 E;  1IRH A;  3U1J E;  1CO7 I;  3BTK I;  1TPA I;  3BYB A;  1BRB I;  4Y11 I;  2LFK A;  4ISN B;  1BF0 A;  1KTH A;  2TGP I;  1QLQ A;  4WXV C;  1KNT A;  1TFX C;  3TPI I;  3LDM A;  1BZ5 A;  1LD6 A;  1FAK I;  2UUY B;  3WNY A;  1AAP A;  2IJO I;  5JB5 A;  1BTI A;  1F5R I;  3AUC A;  1CBW D;  1Y62 A;  4Y0Y I;  3LDI A;  3TGI I;  1P2N B;  3FP7 J;  3AUE A;  4BD9 B;  3BTW I;  3TGJ I;  2DDJ A;  1FY8 I;  1EAW B;  2FI4 I;  4Y0Z I;  3BTE I;  1OA6 5;  1K6U A;  1BTH P;  1TCP A;  2R9P E;  1NAG A;  1FAN A;  1BIK A;  9PTI A;  1D0D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...