1KUNA

Solution structure of the human alpha3-chain type vi collagen c-terminal kunitz domain, nmr, 20 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
58
structure length
58
Chain Sequence
ETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Extracellular matrix
molecule keywords ALPHA3-CHAIN TYPE VI COLLAGEN
publication title Solution structure and backbone dynamics of the human alpha3-chain type VI collagen C-terminal Kunitz domain,.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00014 Kunitz_BPTI Kunitz/Bovine pancreatic trypsin inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.410.10 Few Secondary Structures Irregular Factor Xa Inhibitor Pancreatic trypsin inhibitor Kunitz domain 1kunA00
4BQDA 2ZJXA 3UOUB 1G6XA 3UIRC 2DDIA 4DG4C 2ZVXA 4ISNB 4BNRI 1KTHA 2TGPI 2FTLI 2KNTA 4Y11I 3BTFI 3FP8I 1AALA 1NAGA 8PTIA 3L3TE 1YLCB 4U32X 3BTGI 1K6UA 1EJMB 5JB4A 5JB6A 4NTWB 3AUCA 3U1JE 1JC6A 2UUYB 2M99A 1BPIA 1BUNB 3LDIA 3L33E 3OTJI 1PITA 1BF0A 1FANA 1T8LB 1LD5A 2M01A 1BRCI 3AUHA 1QLQA 1DENA 5C67C 3BTMI 4NTXB 5PTIA 2R9PE 1T8OB 1BIKA 3FP6I 1UUBA 1F5RI 1BTIA 1T8NB 1BTHP 1FAKI 1TOCR 1YLDB 4DTGK 1TFXC 1DTKA 2PTCI 1CO7I 4ISOB 2LFKA 3OFWA 3P95E 6PTIA 3LDJA 4WXVC 1B0CA 2TPII 1T7CB 1T8MB 3BTWI 1CBWD 3AUGA 1P2II 2IJOI 5JB7A 3BYBA 1P2KI 7PTIA 1FY8I 2DDJA 1BZ5A 3CI7A 1DTXA 4U30W 3D65I 3M7QB 1IRHA 4Y0YI 4PTIA 1BPTA 2HEXA 1P2MB 3TPII 2UUXA 1ZJDB 1ZR0B 3BTQI 3WNYA 1LD6A 1KIGI 3BTEI 1TPAI 2RA3C 1OA55 2KCRA 3LDMA 4Y0ZI 3TGKI 1YKTB 2FI5I 1BZXI 1F7ZI 1BHCA 1TAPA 1DEMA 1AAPA 2J6DA 3TGJI 1KNTA 4NTYB 2W8XA 2FI4I 3AUIA 1P2NB 3BTHI 2CA7A 2KAII 1EAWB 1P2QB 1SHPA 1JV9A 2FI3I 4ISLB 3AUDA 1TCPA 1JV8A 3GYMI 2ODYE 3P92E 3BTTI 3FP7J 3BTDI 1OA65 1D0DA 1KUNA 3AUBA 1D0DB 4TPII 3T62D 1BRBI 1P2OB 1TAWB 1ADZA 1MTND 2FTMB 1CA0D 1P2JI 1Y62A 2LFLA 1YC0I 3AUEA 3BTKI 4Y10I 4BD9B 5JB5A 3TGII 4WWYC 1UUAA 2JOTA 9PTIA
chains in the Genus database with same CATH superfamily
4BQDA 2ZJXA 3UOUB 1G6XA 3UIRC 2DDIA 4DG4C 2ZVXA 4ISNB 4BNRI 1KTHA 2TGPI 2FTLI 2KNTA 4Y11I 3BTFI 3FP8I 1AALA 1NAGA 8PTIA 3L3TE 1YLCB 4U32X 3BTGI 1K6UA 1EJMB 5JB4A 5JB6A 4NTWB 3AUCA 3U1JE 1JC6A 2UUYB 2M99A 1BPIA 1BUNB 3LDIA 3L33E 3OTJI 1PITA 1BF0A 1FANA 1T8LB 1LD5A 2M01A 1BRCI 3AUHA 1QLQA 1DENA 5C67C 3BTMI 4NTXB 5PTIA 2R9PE 1T8OB 1BIKA 3FP6I 1UUBA 1F5RI 1BTIA 1T8NB 1BTHP 1FAKI 1TOCR 1YLDB 4DTGK 1TFXC 1DTKA 2PTCI 1CO7I 4ISOB 2LFKA 3OFWA 3P95E 6PTIA 3LDJA 4WXVC 1B0CA 2TPII 1T7CB 1T8MB 3BTWI 1CBWD 3AUGA 1P2II 2IJOI 5JB7A 3BYBA 1P2KI 7PTIA 1FY8I 2DDJA 1BZ5A 3CI7A 1DTXA 4U30W 3D65I 3M7QB 1IRHA 4Y0YI 4PTIA 1BPTA 2HEXA 1P2MB 3TPII 2UUXA 1ZJDB 1ZR0B 3BTQI 3WNYA 1LD6A 1KIGI 3BTEI 1TPAI 2RA3C 1OA55 2KCRA 3LDMA 4Y0ZI 3TGKI 1YKTB 2FI5I 1BZXI 1F7ZI 1BHCA 1TAPA 1DEMA 1AAPA 2J6DA 3TGJI 1KNTA 4NTYB 2W8XA 2FI4I 3AUIA 1P2NB 3BTHI 2CA7A 2KAII 1EAWB 1P2QB 1SHPA 1JV9A 2FI3I 4ISLB 3AUDA 1TCPA 1JV8A 3GYMI 2ODYE 3P92E 3BTTI 3FP7J 3BTDI 1OA65 1D0DA 1KUNA 3AUBA 1D0DB 4TPII 3T62D 1BRBI 1P2OB 1TAWB 1ADZA 1MTND 2FTMB 1CA0D 1P2JI 1Y62A 2LFLA 1YC0I 3AUEA 3BTKI 4Y10I 4BD9B 5JB5A 3TGII 4WWYC 1UUAA 2JOTA 9PTIA
chains in the Genus database with same CATH topology
4BQDA 2ZJXA 3UOUB 1G6XA 3UIRC 2DDIA 4DG4C 2ZVXA 4ISNB 4BNRI 1KTHA 2TGPI 2FTLI 2KNTA 4Y11I 3BTFI 3FP8I 1AALA 1NAGA 8PTIA 3L3TE 1YLCB 4U32X 3BTGI 1K6UA 1EJMB 5JB4A 5JB6A 4NTWB 3AUCA 3U1JE 1JC6A 2UUYB 2M99A 1BPIA 1BUNB 3LDIA 3L33E 3OTJI 1PITA 1BF0A 1FANA 1T8LB 1LD5A 2M01A 1BRCI 3AUHA 1QLQA 1DENA 5C67C 3BTMI 4NTXB 5PTIA 2R9PE 1T8OB 1BIKA 3FP6I 1UUBA 1F5RI 1BTIA 1T8NB 1BTHP 1FAKI 1TOCR 1YLDB 4DTGK 1TFXC 1DTKA 2PTCI 1CO7I 4ISOB 2LFKA 3OFWA 3P95E 6PTIA 3LDJA 4WXVC 1B0CA 2TPII 1T7CB 1T8MB 3BTWI 1CBWD 3AUGA 1P2II 2IJOI 5JB7A 3BYBA 1P2KI 7PTIA 1FY8I 2DDJA 1BZ5A 3CI7A 1DTXA 4U30W 3D65I 3M7QB 1IRHA 4Y0YI 4PTIA 1BPTA 2HEXA 1P2MB 3TPII 2UUXA 1ZJDB 1ZR0B 3BTQI 3WNYA 1LD6A 1KIGI 3BTEI 1TPAI 2RA3C 1OA55 2KCRA 3LDMA 4Y0ZI 3TGKI 1YKTB 2FI5I 1BZXI 1F7ZI 1BHCA 1TAPA 1DEMA 1AAPA 2J6DA 3TGJI 1KNTA 4NTYB 2W8XA 2FI4I 3AUIA 1P2NB 3BTHI 2CA7A 2KAII 1EAWB 1P2QB 1SHPA 1JV9A 2FI3I 4ISLB 3AUDA 1TCPA 1JV8A 3GYMI 2ODYE 3P92E 3BTTI 3FP7J 3BTDI 1OA65 1D0DA 1KUNA 3AUBA 1D0DB 4TPII 3T62D 1BRBI 1P2OB 1TAWB 1ADZA 1MTND 2FTMB 1CA0D 1P2JI 1Y62A 2LFLA 1YC0I 3AUEA 3BTKI 4Y10I 4BD9B 5JB5A 3TGII 4WWYC 1UUAA 2JOTA 9PTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BQD A;  2ZJX A;  3UOU B;  1G6X A;  3UIR C;  2DDI A;  4DG4 C;  2ZVX A;  4ISN B;  4BNR I;  1KTH A;  2TGP I;  2FTL I;  2KNT A;  4Y11 I;  3BTF I;  3FP8 I;  1AAL A;  1NAG A;  8PTI A;  3L3T E;  1YLC B;  4U32 X;  3BTG I;  1K6U A;  1EJM B;  5JB4 A;  5JB6 A;  4NTW B;  3AUC A;  3U1J E;  1JC6 A;  2UUY B;  2M99 A;  1BPI A;  1BUN B;  3LDI A;  3L33 E;  3OTJ I;  1PIT A;  1BF0 A;  1FAN A;  1T8L B;  1LD5 A;  2M01 A;  1BRC I;  3AUH A;  1QLQ A;  1DEN A;  5C67 C;  3BTM I;  4NTX B;  5PTI A;  2R9P E;  1T8O B;  1BIK A;  3FP6 I;  1UUB A;  1F5R I;  1BTI A;  1T8N B;  1BTH P;  1FAK I;  1TOC R;  1YLD B;  4DTG K;  1TFX C;  1DTK A;  2PTC I;  1CO7 I;  4ISO B;  2LFK A;  3OFW A;  3P95 E;  6PTI A;  3LDJ A;  4WXV C;  1B0C A;  2TPI I;  1T7C B;  1T8M B;  3BTW I;  1CBW D;  3AUG A;  1P2I I;  2IJO I;  5JB7 A;  3BYB A;  1P2K I;  7PTI A;  1FY8 I;  2DDJ A;  1BZ5 A;  3CI7 A;  1DTX A;  4U30 W;  3D65 I;  3M7Q B;  1IRH A;  4Y0Y I;  4PTI A;  1BPT A;  2HEX A;  1P2M B;  3TPI I;  2UUX A;  1ZJD B;  1ZR0 B;  3BTQ I;  3WNY A;  1LD6 A;  1KIG I;  3BTE I;  1TPA I;  2RA3 C;  1OA5 5;  2KCR A;  3LDM A;  4Y0Z I;  3TGK I;  1YKT B;  2FI5 I;  1BZX I;  1F7Z I;  1BHC A;  1TAP A;  1DEM A;  1AAP A;  2J6D A;  3TGJ I;  1KNT A;  4NTY B;  2W8X A;  2FI4 I;  3AUI A;  1P2N B;  3BTH I;  2CA7 A;  2KAI I;  1EAW B;  1P2Q B;  1SHP A;  1JV9 A;  2FI3 I;  4ISL B;  3AUD A;  1TCP A;  1JV8 A;  3GYM I;  2ODY E;  3P92 E;  3BTT I;  3FP7 J;  3BTD I;  1OA6 5;  1D0D A;  1KUN A;  3AUB A;  1D0D B;  4TPI I;  3T62 D;  1BRB I;  1P2O B;  1TAW B;  1ADZ A;  1MTN D;  2FTM B;  1CA0 D;  1P2J I;  1Y62 A;  2LFL A;  1YC0 I;  3AUE A;  3BTK I;  4Y10 I;  4BD9 B;  5JB5 A;  3TGI I;  4WWY C;  1UUA A;  2JOT A;  9PTI A; 
#chains in the Genus database with same CATH topology
 4BQD A;  2ZJX A;  3UOU B;  1G6X A;  3UIR C;  2DDI A;  4DG4 C;  2ZVX A;  4ISN B;  4BNR I;  1KTH A;  2TGP I;  2FTL I;  2KNT A;  4Y11 I;  3BTF I;  3FP8 I;  1AAL A;  1NAG A;  8PTI A;  3L3T E;  1YLC B;  4U32 X;  3BTG I;  1K6U A;  1EJM B;  5JB4 A;  5JB6 A;  4NTW B;  3AUC A;  3U1J E;  1JC6 A;  2UUY B;  2M99 A;  1BPI A;  1BUN B;  3LDI A;  3L33 E;  3OTJ I;  1PIT A;  1BF0 A;  1FAN A;  1T8L B;  1LD5 A;  2M01 A;  1BRC I;  3AUH A;  1QLQ A;  1DEN A;  5C67 C;  3BTM I;  4NTX B;  5PTI A;  2R9P E;  1T8O B;  1BIK A;  3FP6 I;  1UUB A;  1F5R I;  1BTI A;  1T8N B;  1BTH P;  1FAK I;  1TOC R;  1YLD B;  4DTG K;  1TFX C;  1DTK A;  2PTC I;  1CO7 I;  4ISO B;  2LFK A;  3OFW A;  3P95 E;  6PTI A;  3LDJ A;  4WXV C;  1B0C A;  2TPI I;  1T7C B;  1T8M B;  3BTW I;  1CBW D;  3AUG A;  1P2I I;  2IJO I;  5JB7 A;  3BYB A;  1P2K I;  7PTI A;  1FY8 I;  2DDJ A;  1BZ5 A;  3CI7 A;  1DTX A;  4U30 W;  3D65 I;  3M7Q B;  1IRH A;  4Y0Y I;  4PTI A;  1BPT A;  2HEX A;  1P2M B;  3TPI I;  2UUX A;  1ZJD B;  1ZR0 B;  3BTQ I;  3WNY A;  1LD6 A;  1KIG I;  3BTE I;  1TPA I;  2RA3 C;  1OA5 5;  2KCR A;  3LDM A;  4Y0Z I;  3TGK I;  1YKT B;  2FI5 I;  1BZX I;  1F7Z I;  1BHC A;  1TAP A;  1DEM A;  1AAP A;  2J6D A;  3TGJ I;  1KNT A;  4NTY B;  2W8X A;  2FI4 I;  3AUI A;  1P2N B;  3BTH I;  2CA7 A;  2KAI I;  1EAW B;  1P2Q B;  1SHP A;  1JV9 A;  2FI3 I;  4ISL B;  3AUD A;  1TCP A;  1JV8 A;  3GYM I;  2ODY E;  3P92 E;  3BTT I;  3FP7 J;  3BTD I;  1OA6 5;  1D0D A;  1KUN A;  3AUB A;  1D0D B;  4TPI I;  3T62 D;  1BRB I;  1P2O B;  1TAW B;  1ADZ A;  1MTN D;  2FTM B;  1CA0 D;  1P2J I;  1Y62 A;  2LFL A;  1YC0 I;  3AUE A;  3BTK I;  4Y10 I;  4BD9 B;  5JB5 A;  3TGI I;  4WWY C;  1UUA A;  2JOT A;  9PTI A; 
#chains in the Genus database with same CATH homology
 4BQD A;  2ZJX A;  3UOU B;  1G6X A;  3UIR C;  2DDI A;  4DG4 C;  2ZVX A;  4ISN B;  4BNR I;  1KTH A;  2TGP I;  2FTL I;  2KNT A;  4Y11 I;  3BTF I;  3FP8 I;  1AAL A;  1NAG A;  8PTI A;  3L3T E;  1YLC B;  4U32 X;  3BTG I;  1K6U A;  1EJM B;  5JB4 A;  5JB6 A;  4NTW B;  3AUC A;  3U1J E;  1JC6 A;  2UUY B;  2M99 A;  1BPI A;  1BUN B;  3LDI A;  3L33 E;  3OTJ I;  1PIT A;  1BF0 A;  1FAN A;  1T8L B;  1LD5 A;  2M01 A;  1BRC I;  3AUH A;  1QLQ A;  1DEN A;  5C67 C;  3BTM I;  4NTX B;  5PTI A;  2R9P E;  1T8O B;  1BIK A;  3FP6 I;  1UUB A;  1F5R I;  1BTI A;  1T8N B;  1BTH P;  1FAK I;  1TOC R;  1YLD B;  4DTG K;  1TFX C;  1DTK A;  2PTC I;  1CO7 I;  4ISO B;  2LFK A;  3OFW A;  3P95 E;  6PTI A;  3LDJ A;  4WXV C;  1B0C A;  2TPI I;  1T7C B;  1T8M B;  3BTW I;  1CBW D;  3AUG A;  1P2I I;  2IJO I;  5JB7 A;  3BYB A;  1P2K I;  7PTI A;  1FY8 I;  2DDJ A;  1BZ5 A;  3CI7 A;  1DTX A;  4U30 W;  3D65 I;  3M7Q B;  1IRH A;  4Y0Y I;  4PTI A;  1BPT A;  2HEX A;  1P2M B;  3TPI I;  2UUX A;  1ZJD B;  1ZR0 B;  3BTQ I;  3WNY A;  1LD6 A;  1KIG I;  3BTE I;  1TPA I;  2RA3 C;  1OA5 5;  2KCR A;  3LDM A;  4Y0Z I;  3TGK I;  1YKT B;  2FI5 I;  1BZX I;  1F7Z I;  1BHC A;  1TAP A;  1DEM A;  1AAP A;  2J6D A;  3TGJ I;  1KNT A;  4NTY B;  2W8X A;  2FI4 I;  3AUI A;  1P2N B;  3BTH I;  2CA7 A;  2KAI I;  1EAW B;  1P2Q B;  1SHP A;  1JV9 A;  2FI3 I;  4ISL B;  3AUD A;  1TCP A;  1JV8 A;  3GYM I;  2ODY E;  3P92 E;  3BTT I;  3FP7 J;  3BTD I;  1OA6 5;  1D0D A;  1KUN A;  3AUB A;  1D0D B;  4TPI I;  3T62 D;  1BRB I;  1P2O B;  1TAW B;  1ADZ A;  1MTN D;  2FTM B;  1CA0 D;  1P2J I;  1Y62 A;  2LFL A;  1YC0 I;  3AUE A;  3BTK I;  4Y10 I;  4BD9 B;  5JB5 A;  3TGI I;  4WWY C;  1UUA A;  2JOT A;  9PTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...