2JXY | Genus

Total Genus 17

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus	17
sequence length	194
structure length	194
Chain Sequence	MEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__7775832947941215__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__7775832947941215__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://genus.fuw.edu.pl/view/2JXY/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__7775832947941215__","codePath":"https:/static/js/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"7775832947941215","bgcolor":"white" }

setting document base to "https://genus.fuw.edu.pl/view/2JXY/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__7775832947941215__ ready

script 1 started

platformSpeed = 8

Viewer cachePut cache://localLOAD_/file/5cfd4a26885c5ce14bced7b0/pdb.gz

Viewer cachePut https://genus.fuw.edu.pl/file/5cfd4a26885c5ce14bced7b0/pdb.gz

FileManager.getAtomSetCollectionFromFile(/file/5cfd4a26885c5ce14bced7b0/pdb.gz)

loadScript /static/js/j2s/core/corezip.z.js

The Resolver thinks Pdb

loadScript /static/js/j2s/core/corebio.z.js

Time for openFile(/file/5cfd4a26885c5ce14bced7b0/pdb.gz): 322 ms

reading 194 atoms

ModelSet: haveSymmetry:false haveUnitcells:false haveFractionalCoord:false

1 model in this collection. Use getProperty "modelInfo" or getProperty "auxiliaryInfo" to inspect them.

Default Van der Waals type for model set to Jmol

194 atoms created

ModelSet: autobonding; use autobond=false to not generate bonds automatically

Time for creating model: 20 ms

Adding embedded #jmolscript: select ({0:193});backbone only;select *;

platformSpeed = 8

cartoonsFancy = true

sheetSmoothing = 1.0

traceAlpha = true

loadScript /static/js/j2s/core/corescriptcmd.z.js

specularPower = 9

ambientPercent = 20

antialiasDisplay = true

Script completed

Jmol script terminated

loadScript /static/js/j2s/J/g3d/HermiteRenderer.js

loadScript /static/js/j2s/J/renderbio/BioMeshRenderer.js

loadScript /static/js/j2s/J/render/MeshRenderer.js

loadScript /static/js/j2s/J/shape/Mesh.js

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Genus data interpretation

molecule tags	Hydrolase
source organism	Homo sapiens
publication title	Evidence of reciprocal reorientation of the catalytic and hemopexin-like domains of full-length MMP-12 pubmed doi rcsb
molecule keywords	Macrophage metalloelastase
total genus	17
structure length	194
sequence length	194
ec nomenclature	ec 3.4.24.65: Macrophage elastase.
pdb deposition date	2007-12-01

pfam database annotations

chain	Pfam Accession Code	Pfam Family Identifier	Pfam Description
A	PF00045	Hemopexin	Hemopexin

Image from the rcsb pdb (www.rcsb.org)

cath code	Class	Architecture	Topology	Homology	Domain
2.110.10.10	Mainly Beta	4 Propeller	Hemopexin	Hemopexin-like domain	2jxyA00

4AUOA 1HXNA 3C7XA 1GENA 1QHUA 4HSDA 1PEXA 1CK7A 4G0DA 2MQSA 1FBLA 1RTGA 1SU3A 4OEIA 2JXYA 4LL2A 2CLTA 1QJSA 3S18A 3OYOA 3BA0A 1GXDA 4FU4A 4RT6B 4FVLA 3V6NA 3LP9A 4YEHA 1ITVA
chains in the Genus database with same CATH superfamily

#chains in the Genus database with same CATH superfamily
 4AUO A;  1HXN A;  3C7X A;  1GEN A;  1QHU A;  4HSD A;  1PEX A;  1CK7 A;  4G0D A;  2MQS A;  1FBL A;  1RTG A;  1SU3 A;  4OEI A;  2JXY A;  4LL2 A;  2CLT A;  1QJS A;  3S18 A;  3OYO A;  3BA0 A;  1GXD A;  4FU4 A;  4RT6 B;  4FVL A;  3V6N A;  3LP9 A;  4YEH A;  1ITV A; 
#chains in the Genus database with same CATH topology
 4AUO A;  1HXN A;  3C7X A;  1GEN A;  1QHU A;  4HSD A;  1PEX A;  1CK7 A;  4G0D A;  2MQS A;  1FBL A;  1RTG A;  1SU3 A;  4OEI A;  2JXY A;  4LL2 A;  2CLT A;  1QJS A;  3S18 A;  3OYO A;  3BA0 A;  1GXD A;  4FU4 A;  4RT6 B;  4FVL A;  3V6N A;  3LP9 A;  4YEH A;  1ITV A; 
#chains in the Genus database with same CATH homology
 4AUO A;  1HXN A;  3C7X A;  1GEN A;  1QHU A;  4HSD A;  1PEX A;  1CK7 A;  4G0D A;  2MQS A;  1FBL A;  1RTG A;  1SU3 A;  4OEI A;  2JXY A;  4LL2 A;  2CLT A;  1QJS A;  3S18 A;  3OYO A;  3BA0 A;  1GXD A;  4FU4 A;  4RT6 B;  4FVL A;  3V6N A;  3LP9 A;  4YEH A;  1ITV A;

...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)

...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

2JXYA

Total Genus

sequence length

structure length

Chain Sequence

Structure visualization

pfam database annotations