4G0DA

Human collagenase 3 (mmp-13) full form with peptides from pro-domain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
368
structure length
368
Chain Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHAFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagenase 3
publication title Crystal structure of full-length human collagenase 3 (MMP-13) with peptides in the active site defines exosites in the catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 87
structure length 368
sequence length 368
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.-:
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 4g0dA02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4g0dA01
3TS4A 3DL1A 1ZS0A 1G4KA 1HV5A 1QUAA 1UTZA 2DDYA 2OW1A 1O0QA 4GWMA 1ZTQA 3I7IA 3BA0A 1O0TA 2QPJA 1MMPA 1G05A 1I73A 3KECA 2OXZA 2ERQA 3B8ZA 1JAPA 3AYKA 4R3VA 2V4BA 2X3AA 1R1JA 1KBCA 2JSDA 4WK7A 2XS3A 1MMRA 4H82A 1C3IA 3EHXA 4XM8A 4PKQA 3LIRA 5D7WA 5BPAA 2O3EA 1R1IA 2OY4A 5LABA 1QJSA 4H49A 4PKVA 4JPAA 3TSKA 1Y0VA 4DPEA 3LJTA 2MQSA 4PKUA 3L0VA 1XFXA 4Q1LA 1UMSA 2D1OA 2OW0A 2DW2A 2MZIA 1UTTA 2DW1A 5L7FA 3LMCA 4PKWA 1A85A 1MMQA 3KRYA 5I3MA 3SHIA 4GF1A 4J4MA 1C7KA 2Z2DA 3G42A 1K7QA 1IAAA 2JNPA 4A3WA 3OYOA 3GBOA 1G12A 5D1SA 2SRTA 3LUMA 2CLTA 2A8HA 1G49A 1QHUA 2O36A 3B92A 1HOVA 1D5JA 1BSWA 3V96B 1S4BP 1AYKA 3U1RA 3F15A 1BKCI 2OVXA 1PEXA 4PKSA 1USNA 2OZRA 5D3CA 4CTHA 1UMTA 2HU6A 2WOAA 4L19A 3LILA 3LE9A 1CK7A 3DWBA 4ILWD 1PWUA 4FU4A 4FXQA 2J0TA 1MNCA 5I4OA 2FV9A 2OW9A 3AYUA 5L79A 3LK8A 3V6NA 2AIGP 2Y6CA 4FXYP 1XUCA 1K7GA 1OMJA 2OW2A 2MLRA 4L63A 1CIZA 830CA 1ZXCA 1IABA 1IAGA 4WKEA 1SATA 2I47A 2WO9A 1KUIA 1OM8A 5H8XA 1R1HA 1EUBA 1UEAA 3HBUP 1HTDA 4GQLA 1ROSA 4RT6B 1BUVM 1XURA 3DNGA 4WZVA 2PJTA 2OXUA 4JIJA 1XFZA 3KMEA 3AIGA 1CAQA 1BUDA 1YQYA 3EDIA 3Q2GA 3K7NA 2EROA 4DD8A 4JP4A 4JQGA 456CA 3LQ0A 3ZXHA 2OXWA 4QKZA 3HB2P 1GENA 2MZHA 3TT4A 1AF0A 1OM7A 3HYGA 1BQQM 3KEKA 1EB6A 1Y93A 3F1AA 1GKCA 1XFUA 1XFWA 1PWVA 3HBVP 4JA1A 2D1NA 2W14A 1JH1A 1ZP5A 1JKYA 3F18A 1CGEA 1CGFA 4GR3A 1SLMA 1YP1A 2FV5A 2CKIA 2E3XA 1BM6A 1AKLA 4LL2A 1GE6A 1OO9A 4A7BA 4XM7A 1GXDA 1IAEA 5JMYA 5CXAA 3MA2A 4GWNA 2J83A 1Y8JA 2OVZA 1HFCA 5I43A 1FBLA 2E2DA 2WO8A 4I35A 3LEAA 2DDFA 1J7NA 4H84A 1GE7A 1BZSA 4YEHA 2X3BA 2RJPA 3DSLA 3OHOA 1R54A 1GKDA 5CUHA 3LUNA 1OM6A 3N2VA 1KUGA 1BKCE 1BKCA 1GE5A 1FLSA 4HMAA 3TVCA 5I2ZA 1FM1A 4EFSA 1MMBA 1H71P 1RTGA 2XS4A 1D8MA 1YCMA 1WNIA 1QJIA 3KHIA 4PKRA 2KRJA 2AYKA 2JT5A 1CQRA 3LGPA 2MLSA 1QJJA 2USNA 3DPFA 1JANA 2MZEA 4PKTA 3EDZA 3F17A 3WV2A 3HDBA 1GO8P 5D1TA 1PWPA 4HSDA 1ZXVA 1D7XA 1GO7P 1G9KA 4H3XA 5CZMA 4FVLA 3LQBA 3HY9A 2POJA 4IUWA 1HY7A 4ON1A 1ND1A 3Q2HA 3WV1A 1ASTA 1HXNA 5I12A 3CKIA 2ERPA 2JXYA 4H76A 3O2XA 3I7GA 1QIAA 1QIBA 3B2ZA 1XUDA 3LKAA 3KWVC 3S18A 1KUKA 1HFSA 3P24A 1JIWP 1OS9A 1IACA 1BQOA 3ELMA 1ATLA 4GR8A 1DTHA 5D2BA 3K7LA 2W13A 4L6TA 4WKIA 1PWQA 1XFYA 1PWWA 1CXVA 1D8FA 1Z3JA 3RTTA 2X3CA 4ZR5A 2X7MA 1I76A 1B8YA 1RM8A 2RJQA 2W15A 2JIHA 2TCLA 3LJGA 4AUOA 1IADA 3EHYA 3G5CA 4XM6A 1SMPA 4I03A 5B5OA 5BOYA 966CA 4H2EA 2YB9A 4XCTA 1JAOA 1Q3AA 3UVCA 5B5PA 3RTSA 3F19A 1C8TA 1CGLA 3EDGA 4XBHA 1JIZA 1KUHA 1XFVA 2DW0A 3E8RA 3L0TA 3P1VA 1QICA 1ITVA 1BIWA 3DPEA 4H30A 1JAQA 4G0DA 2JT6A 2L0RA 4H1QA 3O64A 4AXQA 2K9CA 2W12A 2OY2A 5BOTA 1JK3A 3C7XA 3USNA 1A86A 3EDHA 4IJOA 3HDAP 4OEIA 3WV3A 2OI0A 4G9LA 1SRPA 2N8RA 3KEJA 1K7IA 3OHLA 1ZVXA 3F16A 2Y6DA 4AIGA 3NX7A 1SU3A 3LJZA 3VTGA 4IN9A 3LIKA 4DF9A 4DV8A 1KUFA 2YIGA 1EAKA 2W0DA 3HY7A 3ZUKA 1DMTA 2K2GA 3ZVSA 1I1IP 1YOUA 3KMCA 3EWJA 1L6JA 3LP9A 1KAPP 1R55A 1JJ9A 1SLNA 4WF6A 4AYKA 1OS2A 5I0LA 3N2UA 1B3DA 1RMZA 4GUYA 4HX3A 4GR0A 5D1UA 3VI1A
chains in the Genus database with same CATH superfamily
3TS4A 3DL1A 1ZS0A 1G4KA 1HV5A 1QUAA 1UTZA 2DDYA 2OW1A 1O0QA 4GWMA 1ZTQA 3I7IA 3BA0A 1O0TA 2QPJA 1MMPA 1G05A 1I73A 3KECA 2OXZA 2ERQA 3B8ZA 1JAPA 3AYKA 4R3VA 2V4BA 2X3AA 1R1JA 1KBCA 2JSDA 4WK7A 2XS3A 1MMRA 4H82A 1C3IA 3EHXA 4XM8A 4PKQA 3LIRA 5D7WA 5BPAA 2O3EA 1R1IA 2OY4A 5LABA 1QJSA 4H49A 4PKVA 4JPAA 3TSKA 1Y0VA 4DPEA 3LJTA 2MQSA 4PKUA 3L0VA 1XFXA 4Q1LA 1UMSA 2D1OA 2OW0A 2DW2A 2MZIA 1UTTA 2DW1A 5L7FA 3LMCA 4PKWA 1A85A 1MMQA 3KRYA 5I3MA 3SHIA 4GF1A 4J4MA 1C7KA 2Z2DA 3G42A 1K7QA 1IAAA 2JNPA 4A3WA 3OYOA 3GBOA 1G12A 5D1SA 2SRTA 3LUMA 2CLTA 2A8HA 1G49A 1QHUA 1XAXA 2O36A 3B92A 1HOVA 1D5JA 1BSWA 3V96B 1S4BP 1AYKA 3U1RA 3F15A 1BKCI 2OVXA 1PEXA 4PKSA 1USNA 2OZRA 5D3CA 4CTHA 1UMTA 2HU6A 1TVIA 2WOAA 4L19A 3LILA 3LE9A 1CK7A 3DWBA 4ILWD 1PWUA 4FU4A 4FXQA 2J0TA 1MNCA 5I4OA 2FV9A 2OW9A 3DTEA 3AYUA 5L79A 3LK8A 3V6NA 2AIGP 2Y6CA 4FXYP 1XUCA 1K7GA 1OMJA 2OW2A 2MLRA 4L63A 1CIZA 830CA 1ZXCA 1IABA 1IAGA 4WKEA 1SATA 2I47A 2WO9A 1KUIA 1OZ9A 1OM8A 5H8XA 1R1HA 1EUBA 1UEAA 3HBUP 1HTDA 4GQLA 1ROSA 4RT6B 1BUVM 1XURA 3DNGA 4WZVA 2PJTA 2OXUA 4JIJA 1XFZA 3KMEA 3AIGA 1CAQA 1BUDA 1YQYA 3EDIA 3Q2GA 3K7NA 2EROA 4DD8A 4JP4A 4JQGA 456CA 3LQ0A 3ZXHA 2OXWA 4QKZA 3HB2P 1GENA 2MZHA 3TT4A 1AF0A 1OM7A 3DTIA 3HYGA 1BQQM 3KEKA 1EB6A 1Y93A 3F1AA 1GKCA 1XFUA 1XFWA 1PWVA 3HBVP 4JA1A 2D1NA 2W14A 1JH1A 1ZP5A 1JKYA 3F18A 1CGEA 1CGFA 4GR3A 1SLMA 1YP1A 2FV5A 2CKIA 2E3XA 1BM6A 1AKLA 4LL2A 1GE6A 1OO9A 4A7BA 4XM7A 1GXDA 1IAEA 5JMYA 5CXAA 3MA2A 4GWNA 2J83A 1Y8JA 2OVZA 1HFCA 5I43A 1FBLA 2E2DA 2WO8A 4I35A 3LEAA 2DDFA 1J7NA 4H84A 1GE7A 1BZSA 4YEHA 2X3BA 2RJPA 3DSLA 3DTKA 3OHOA 1R54A 1GKDA 5CUHA 3LUNA 1OM6A 3N2VA 1KUGA 1BKCE 1BKCA 1GE5A 1FLSA 4HMAA 3TVCA 5I2ZA 1FM1A 4EFSA 1MMBA 1H71P 1RTGA 2XS4A 1D8MA 1YCMA 1WNIA 1QJIA 3KHIA 4PKRA 2KRJA 2AYKA 2JT5A 1CQRA 3LGPA 2MLSA 1QJJA 2USNA 3DPFA 1JANA 2MZEA 4PKTA 3EDZA 3F17A 3WV2A 3HDBA 1GO8P 2YUFA 5D1TA 1PWPA 4HSDA 1ZXVA 1D7XA 1GO7P 1G9KA 4H3XA 5CZMA 4FVLA 3LQBA 3HY9A 2POJA 4IUWA 1HY7A 4ON1A 1ND1A 3Q2HA 3WV1A 1ASTA 1HXNA 5I12A 3CKIA 2ERPA 2JXYA 4H76A 3O2XA 3I7GA 1QIAA 1QIBA 3B2ZA 1XUDA 3LKAA 3KWVC 3S18A 1KUKA 1HFSA 3P24A 1JIWP 1OS9A 1IACA 1BQOA 3ELMA 1ATLA 4GR8A 1DTHA 5D2BA 3K7LA 2W13A 4L6TA 4WKIA 1PWQA 1XFYA 1PWWA 1CXVA 1D8FA 1Z3JA 3RTTA 2X3CA 4ZR5A 2X7MA 1I76A 1B8YA 1RM8A 2RJQA 2W15A 2JIHA 2TCLA 3LJGA 4AUOA 1IADA 3EHYA 3G5CA 4XM6A 1SMPA 4I03A 5B5OA 5BOYA 966CA 4H2EA 2YB9A 4XCTA 1JAOA 1Q3AA 3UVCA 5B5PA 3RTSA 3F19A 1C8TA 1CGLA 3EDGA 4XBHA 1JIZA 1KUHA 1XFVA 2DW0A 3E8RA 3L0TA 3P1VA 1QICA 1ITVA 1BIWA 3DPEA 4H30A 1JAQA 4G0DA 2JT6A 2L0RA 4H1QA 3O64A 4AXQA 2K9CA 2W12A 2OY2A 4L7AA 5BOTA 1JK3A 3C7XA 3USNA 1XM5A 1A86A 3EDHA 4IJOA 3HDAP 4OEIA 3WV3A 2OI0A 4G9LA 1SRPA 2N8RA 3KEJA 1K7IA 3OHLA 1ZVXA 3F16A 2Y6DA 4AIGA 3NX7A 1SU3A 3LJZA 3VTGA 4IN9A 3LIKA 4DF9A 4DV8A 1KUFA 2YIGA 1EAKA 2W0DA 3HY7A 3ZUKA 1DMTA 2K2GA 3ZVSA 1I1IP 1YOUA 3KMCA 3EWJA 1L6JA 3LP9A 1KAPP 1R55A 1JJ9A 1SLNA 4WF6A 4AYKA 1OS2A 5I0LA 3N2UA 1B3DA 1RMZA 4GUYA 4HX3A 4GR0A 5D1UA 3VI1A
chains in the Genus database with same CATH topology
3TS4A 3DL1A 1ZS0A 1G4KA 1HV5A 1QUAA 1UTZA 2DDYA 2OW1A 1O0QA 4GWMA 1ZTQA 3I7IA 3BA0A 1O0TA 2QPJA 1MMPA 1G05A 1I73A 3KECA 2OXZA 2ERQA 3B8ZA 1JAPA 3AYKA 4R3VA 2V4BA 2X3AA 1R1JA 1KBCA 2JSDA 4WK7A 2XS3A 1MMRA 4H82A 1C3IA 3EHXA 4XM8A 4PKQA 3LIRA 5D7WA 5BPAA 2O3EA 1R1IA 2OY4A 5LABA 1QJSA 4H49A 4PKVA 4JPAA 3TSKA 1Y0VA 4DPEA 3LJTA 2MQSA 4PKUA 3L0VA 1XFXA 4Q1LA 1UMSA 2D1OA 2OW0A 2DW2A 2MZIA 1UTTA 2DW1A 5L7FA 3LMCA 4PKWA 1A85A 1MMQA 3KRYA 5I3MA 3SHIA 4GF1A 4J4MA 1C7KA 2Z2DA 3G42A 1K7QA 1IAAA 2JNPA 4A3WA 3OYOA 3GBOA 1G12A 5D1SA 2SRTA 3LUMA 2CLTA 2A8HA 1G49A 1QHUA 2O36A 3B92A 1HOVA 1D5JA 1BSWA 3V96B 1S4BP 1AYKA 3U1RA 3F15A 1BKCI 2OVXA 1PEXA 4PKSA 1USNA 2OZRA 5D3CA 4CTHA 1UMTA 2HU6A 2WOAA 4L19A 3LILA 3LE9A 1CK7A 3DWBA 4ILWD 1PWUA 4FU4A 4FXQA 2J0TA 1MNCA 5I4OA 2FV9A 2OW9A 3DTEA 3AYUA 5L79A 3LK8A 3V6NA 2AIGP 2Y6CA 4FXYP 1XUCA 1K7GA 1OMJA 2OW2A 2MLRA 4L63A 1CIZA 830CA 1ZXCA 1IABA 1IAGA 4WKEA 1SATA 2I47A 2WO9A 1KUIA 1OM8A 5H8XA 1R1HA 1EUBA 1UEAA 3HBUP 1HTDA 4GQLA 1ROSA 4RT6B 1BUVM 1XURA 3DNGA 4WZVA 2PJTA 2OXUA 4JIJA 1XFZA 3KMEA 3AIGA 1CAQA 1BUDA 1YQYA 3EDIA 3Q2GA 3K7NA 2EROA 4DD8A 4JP4A 4JQGA 456CA 3LQ0A 3ZXHA 2OXWA 4QKZA 3HB2P 1GENA 2MZHA 3TT4A 1AF0A 1OM7A 3DTIA 3HYGA 1BQQM 3KEKA 1EB6A 1Y93A 3F1AA 1GKCA 1XFUA 1XFWA 1PWVA 3HBVP 4JA1A 2D1NA 2W14A 1JH1A 1ZP5A 1JKYA 3F18A 1CGEA 1CGFA 4GR3A 1SLMA 1YP1A 2FV5A 2CKIA 2E3XA 1BM6A 1AKLA 4LL2A 1GE6A 1OO9A 4A7BA 4XM7A 1GXDA 1IAEA 5JMYA 5CXAA 3MA2A 4GWNA 2J83A 1Y8JA 2OVZA 1HFCA 5I43A 1FBLA 2E2DA 2WO8A 4I35A 3LEAA 2DDFA 1J7NA 4H84A 1GE7A 1BZSA 4YEHA 2X3BA 2RJPA 3DSLA 3DTKA 3OHOA 1R54A 1GKDA 5CUHA 3LUNA 1OM6A 3N2VA 1KUGA 1BKCE 1BKCA 1GE5A 1FLSA 4HMAA 3TVCA 5I2ZA 1FM1A 4EFSA 1MMBA 1H71P 1RTGA 2XS4A 1D8MA 1YCMA 1WNIA 1QJIA 3KHIA 4PKRA 2KRJA 2AYKA 2JT5A 1CQRA 3LGPA 2MLSA 1QJJA 2USNA 3DPFA 1JANA 2MZEA 4PKTA 3EDZA 3F17A 3WV2A 3HDBA 1GO8P 2YUFA 5D1TA 1PWPA 4HSDA 1ZXVA 1D7XA 1GO7P 1G9KA 4H3XA 5CZMA 4FVLA 3LQBA 3HY9A 2POJA 4IUWA 1HY7A 4ON1A 1ND1A 3Q2HA 3WV1A 1ASTA 1HXNA 5I12A 3CKIA 2ERPA 2JXYA 4H76A 3O2XA 3I7GA 1QIAA 1QIBA 3B2ZA 1XUDA 3LKAA 3KWVC 3S18A 1KUKA 1HFSA 3P24A 1JIWP 1OS9A 1IACA 1BQOA 3ELMA 1ATLA 4GR8A 1DTHA 5D2BA 3K7LA 2W13A 4L6TA 4WKIA 1PWQA 1XFYA 1PWWA 1CXVA 1D8FA 1Z3JA 3RTTA 2X3CA 4ZR5A 2X7MA 1I76A 1B8YA 1RM8A 2RJQA 2W15A 2JIHA 2TCLA 3LJGA 4AUOA 1IADA 3EHYA 3G5CA 4XM6A 1SMPA 4I03A 5B5OA 5BOYA 966CA 4H2EA 2YB9A 4XCTA 1JAOA 1Q3AA 3UVCA 5B5PA 3RTSA 3F19A 1C8TA 1CGLA 3EDGA 4XBHA 1JIZA 1KUHA 1XFVA 2DW0A 3E8RA 3L0TA 3P1VA 1QICA 1ITVA 1BIWA 3DPEA 4H30A 1JAQA 4G0DA 2JT6A 2L0RA 4H1QA 3O64A 4AXQA 2K9CA 2W12A 2OY2A 4L7AA 5BOTA 1JK3A 3C7XA 3USNA 1A86A 3EDHA 4IJOA 3HDAP 4OEIA 3WV3A 2OI0A 4G9LA 1SRPA 2N8RA 3KEJA 1K7IA 3OHLA 1ZVXA 3F16A 2Y6DA 4AIGA 3NX7A 1SU3A 3LJZA 3VTGA 4IN9A 3LIKA 4DF9A 4DV8A 1KUFA 2YIGA 1EAKA 2W0DA 3HY7A 3ZUKA 1DMTA 2K2GA 3ZVSA 1I1IP 1YOUA 3KMCA 3EWJA 1L6JA 3LP9A 1KAPP 1R55A 1JJ9A 1SLNA 4WF6A 4AYKA 1OS2A 5I0LA 3N2UA 1B3DA 1RMZA 4GUYA 4HX3A 4GR0A 5D1UA 3VI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TS4 A;  3DL1 A;  1ZS0 A;  1G4K A;  1HV5 A;  1QUA A;  1UTZ A;  2DDY A;  2OW1 A;  1O0Q A;  4GWM A;  1ZTQ A;  3I7I A;  3BA0 A;  1O0T A;  2QPJ A;  1MMP A;  1G05 A;  1I73 A;  3KEC A;  2OXZ A;  2ERQ A;  3B8Z A;  1JAP A;  3AYK A;  4R3V A;  2V4B A;  2X3A A;  1R1J A;  1KBC A;  2JSD A;  4WK7 A;  2XS3 A;  1MMR A;  4H82 A;  1C3I A;  3EHX A;  4XM8 A;  4PKQ A;  3LIR A;  5D7W A;  5BPA A;  2O3E A;  1R1I A;  2OY4 A;  5LAB A;  1QJS A;  4H49 A;  4PKV A;  4JPA A;  3TSK A;  1Y0V A;  4DPE A;  3LJT A;  2MQS A;  4PKU A;  3L0V A;  1XFX A;  4Q1L A;  1UMS A;  2D1O A;  2OW0 A;  2DW2 A;  2MZI A;  1UTT A;  2DW1 A;  5L7F A;  3LMC A;  4PKW A;  1A85 A;  1MMQ A;  3KRY A;  5I3M A;  3SHI A;  4GF1 A;  4J4M A;  1C7K A;  2Z2D A;  3G42 A;  1K7Q A;  1IAA A;  2JNP A;  4A3W A;  3OYO A;  3GBO A;  1G12 A;  5D1S A;  2SRT A;  3LUM A;  2CLT A;  2A8H A;  1G49 A;  1QHU A;  2O36 A;  3B92 A;  1HOV A;  1D5J A;  1BSW A;  3V96 B;  1S4B P;  1AYK A;  3U1R A;  3F15 A;  1BKC I;  2OVX A;  1PEX A;  4PKS A;  1USN A;  2OZR A;  5D3C A;  4CTH A;  1UMT A;  2HU6 A;  2WOA A;  4L19 A;  3LIL A;  3LE9 A;  1CK7 A;  3DWB A;  4ILW D;  1PWU A;  4FU4 A;  4FXQ A;  2J0T A;  1MNC A;  5I4O A;  2FV9 A;  2OW9 A;  3AYU A;  5L79 A;  3LK8 A;  3V6N A;  2AIG P;  2Y6C A;  4FXY P;  1XUC A;  1K7G A;  1OMJ A;  2OW2 A;  2MLR A;  4L63 A;  1CIZ A;  830C A;  1ZXC A;  1IAB A;  1IAG A;  4WKE A;  1SAT A;  2I47 A;  2WO9 A;  1KUI A;  1OM8 A;  5H8X A;  1R1H A;  1EUB A;  1UEA A;  3HBU P;  1HTD A;  4GQL A;  1ROS A;  4RT6 B;  1BUV M;  1XUR A;  3DNG A;  4WZV A;  2PJT A;  2OXU A;  4JIJ A;  1XFZ A;  3KME A;  3AIG A;  1CAQ A;  1BUD A;  1YQY A;  3EDI A;  3Q2G A;  3K7N A;  2ERO A;  4DD8 A;  4JP4 A;  4JQG A;  456C A;  3LQ0 A;  3ZXH A;  2OXW A;  4QKZ A;  3HB2 P;  1GEN A;  2MZH A;  3TT4 A;  1AF0 A;  1OM7 A;  3HYG A;  1BQQ M;  3KEK A;  1EB6 A;  1Y93 A;  3F1A A;  1GKC A;  1XFU A;  1XFW A;  1PWV A;  3HBV P;  4JA1 A;  2D1N A;  2W14 A;  1JH1 A;  1ZP5 A;  1JKY A;  3F18 A;  1CGE A;  1CGF A;  4GR3 A;  1SLM A;  1YP1 A;  2FV5 A;  2CKI A;  2E3X A;  1BM6 A;  1AKL A;  4LL2 A;  1GE6 A;  1OO9 A;  4A7B A;  4XM7 A;  1GXD A;  1IAE A;  5JMY A;  5CXA A;  3MA2 A;  4GWN A;  2J83 A;  1Y8J A;  2OVZ A;  1HFC A;  5I43 A;  1FBL A;  2E2D A;  2WO8 A;  4I35 A;  3LEA A;  2DDF A;  1J7N A;  4H84 A;  1GE7 A;  1BZS A;  4YEH A;  2X3B A;  2RJP A;  3DSL A;  3OHO A;  1R54 A;  1GKD A;  5CUH A;  3LUN A;  1OM6 A;  3N2V A;  1KUG A;  1BKC E;  1BKC A;  1GE5 A;  1FLS A;  4HMA A;  3TVC A;  5I2Z A;  1FM1 A;  4EFS A;  1MMB A;  1H71 P;  1RTG A;  2XS4 A;  1D8M A;  1YCM A;  1WNI A;  1QJI A;  3KHI A;  4PKR A;  2KRJ A;  2AYK A;  2JT5 A;  1CQR A;  3LGP A;  2MLS A;  1QJJ A;  2USN A;  3DPF A;  1JAN A;  2MZE A;  4PKT A;  3EDZ A;  3F17 A;  3WV2 A;  3HDB A;  1GO8 P;  5D1T A;  1PWP A;  4HSD A;  1ZXV A;  1D7X A;  1GO7 P;  1G9K A;  4H3X A;  5CZM A;  4FVL A;  3LQB A;  3HY9 A;  2POJ A;  4IUW A;  1HY7 A;  4ON1 A;  1ND1 A;  3Q2H A;  3WV1 A;  1AST A;  1HXN A;  5I12 A;  3CKI A;  2ERP A;  2JXY A;  4H76 A;  3O2X A;  3I7G A;  1QIA A;  1QIB A;  3B2Z A;  1XUD A;  3LKA A;  3KWV C;  3S18 A;  1KUK A;  1HFS A;  3P24 A;  1JIW P;  1OS9 A;  1IAC A;  1BQO A;  3ELM A;  1ATL A;  4GR8 A;  1DTH A;  5D2B A;  3K7L A;  2W13 A;  4L6T A;  4WKI A;  1PWQ A;  1XFY A;  1PWW A;  1CXV A;  1D8F A;  1Z3J A;  3RTT A;  2X3C A;  4ZR5 A;  2X7M A;  1I76 A;  1B8Y A;  1RM8 A;  2RJQ A;  2W15 A;  2JIH A;  2TCL A;  3LJG A;  4AUO A;  1IAD A;  3EHY A;  3G5C A;  4XM6 A;  1SMP A;  4I03 A;  5B5O A;  5BOY A;  966C A;  4H2E A;  2YB9 A;  4XCT A;  1JAO A;  1Q3A A;  3UVC A;  5B5P A;  3RTS A;  3F19 A;  1C8T A;  1CGL A;  3EDG A;  4XBH A;  1JIZ A;  1KUH A;  1XFV A;  2DW0 A;  3E8R A;  3L0T A;  3P1V A;  1QIC A;  1ITV A;  1BIW A;  3DPE A;  4H30 A;  1JAQ A;  4G0D A;  2JT6 A;  2L0R A;  4H1Q A;  3O64 A;  4AXQ A;  2K9C A;  2W12 A;  2OY2 A;  5BOT A;  1JK3 A;  3C7X A;  3USN A;  1A86 A;  3EDH A;  4IJO A;  3HDA P;  4OEI A;  3WV3 A;  2OI0 A;  4G9L A;  1SRP A;  2N8R A;  3KEJ A;  1K7I A;  3OHL A;  1ZVX A;  3F16 A;  2Y6D A;  4AIG A;  3NX7 A;  1SU3 A;  3LJZ A;  3VTG A;  4IN9 A;  3LIK A;  4DF9 A;  4DV8 A;  1KUF A;  2YIG A;  1EAK A;  2W0D A;  3HY7 A;  3ZUK A;  1DMT A;  2K2G A;  3ZVS A;  1I1I P;  1YOU A;  3KMC A;  3EWJ A;  1L6J A;  3LP9 A;  1KAP P;  1R55 A;  1JJ9 A;  1SLN A;  4WF6 A;  4AYK A;  1OS2 A;  5I0L A;  3N2U A;  1B3D A;  1RMZ A;  4GUY A;  4HX3 A;  4GR0 A;  5D1U A;  3VI1 A; 
#chains in the Genus database with same CATH topology
 3TS4 A;  3DL1 A;  1ZS0 A;  1G4K A;  1HV5 A;  1QUA A;  1UTZ A;  2DDY A;  2OW1 A;  1O0Q A;  4GWM A;  1ZTQ A;  3I7I A;  3BA0 A;  1O0T A;  2QPJ A;  1MMP A;  1G05 A;  1I73 A;  3KEC A;  2OXZ A;  2ERQ A;  3B8Z A;  1JAP A;  3AYK A;  4R3V A;  2V4B A;  2X3A A;  1R1J A;  1KBC A;  2JSD A;  4WK7 A;  2XS3 A;  1MMR A;  4H82 A;  1C3I A;  3EHX A;  4XM8 A;  4PKQ A;  3LIR A;  5D7W A;  5BPA A;  2O3E A;  1R1I A;  2OY4 A;  5LAB A;  1QJS A;  4H49 A;  4PKV A;  4JPA A;  3TSK A;  1Y0V A;  4DPE A;  3LJT A;  2MQS A;  4PKU A;  3L0V A;  1XFX A;  4Q1L A;  1UMS A;  2D1O A;  2OW0 A;  2DW2 A;  2MZI A;  1UTT A;  2DW1 A;  5L7F A;  3LMC A;  4PKW A;  1A85 A;  1MMQ A;  3KRY A;  5I3M A;  3SHI A;  4GF1 A;  4J4M A;  1C7K A;  2Z2D A;  3G42 A;  1K7Q A;  1IAA A;  2JNP A;  4A3W A;  3OYO A;  3GBO A;  1G12 A;  5D1S A;  2SRT A;  3LUM A;  2CLT A;  2A8H A;  1G49 A;  1QHU A;  1XAX A;  2O36 A;  3B92 A;  1HOV A;  1D5J A;  1BSW A;  3V96 B;  1S4B P;  1AYK A;  3U1R A;  3F15 A;  1BKC I;  2OVX A;  1PEX A;  4PKS A;  1USN A;  2OZR A;  5D3C A;  4CTH A;  1UMT A;  2HU6 A;  1TVI A;  2WOA A;  4L19 A;  3LIL A;  3LE9 A;  1CK7 A;  3DWB A;  4ILW D;  1PWU A;  4FU4 A;  4FXQ A;  2J0T A;  1MNC A;  5I4O A;  2FV9 A;  2OW9 A;  3DTE A;  3AYU A;  5L79 A;  3LK8 A;  3V6N A;  2AIG P;  2Y6C A;  4FXY P;  1XUC A;  1K7G A;  1OMJ A;  2OW2 A;  2MLR A;  4L63 A;  1CIZ A;  830C A;  1ZXC A;  1IAB A;  1IAG A;  4WKE A;  1SAT A;  2I47 A;  2WO9 A;  1KUI A;  1OZ9 A;  1OM8 A;  5H8X A;  1R1H A;  1EUB A;  1UEA A;  3HBU P;  1HTD A;  4GQL A;  1ROS A;  4RT6 B;  1BUV M;  1XUR A;  3DNG A;  4WZV A;  2PJT A;  2OXU A;  4JIJ A;  1XFZ A;  3KME A;  3AIG A;  1CAQ A;  1BUD A;  1YQY A;  3EDI A;  3Q2G A;  3K7N A;  2ERO A;  4DD8 A;  4JP4 A;  4JQG A;  456C A;  3LQ0 A;  3ZXH A;  2OXW A;  4QKZ A;  3HB2 P;  1GEN A;  2MZH A;  3TT4 A;  1AF0 A;  1OM7 A;  3DTI A;  3HYG A;  1BQQ M;  3KEK A;  1EB6 A;  1Y93 A;  3F1A A;  1GKC A;  1XFU A;  1XFW A;  1PWV A;  3HBV P;  4JA1 A;  2D1N A;  2W14 A;  1JH1 A;  1ZP5 A;  1JKY A;  3F18 A;  1CGE A;  1CGF A;  4GR3 A;  1SLM A;  1YP1 A;  2FV5 A;  2CKI A;  2E3X A;  1BM6 A;  1AKL A;  4LL2 A;  1GE6 A;  1OO9 A;  4A7B A;  4XM7 A;  1GXD A;  1IAE A;  5JMY A;  5CXA A;  3MA2 A;  4GWN A;  2J83 A;  1Y8J A;  2OVZ A;  1HFC A;  5I43 A;  1FBL A;  2E2D A;  2WO8 A;  4I35 A;  3LEA A;  2DDF A;  1J7N A;  4H84 A;  1GE7 A;  1BZS A;  4YEH A;  2X3B A;  2RJP A;  3DSL A;  3DTK A;  3OHO A;  1R54 A;  1GKD A;  5CUH A;  3LUN A;  1OM6 A;  3N2V A;  1KUG A;  1BKC E;  1BKC A;  1GE5 A;  1FLS A;  4HMA A;  3TVC A;  5I2Z A;  1FM1 A;  4EFS A;  1MMB A;  1H71 P;  1RTG A;  2XS4 A;  1D8M A;  1YCM A;  1WNI A;  1QJI A;  3KHI A;  4PKR A;  2KRJ A;  2AYK A;  2JT5 A;  1CQR A;  3LGP A;  2MLS A;  1QJJ A;  2USN A;  3DPF A;  1JAN A;  2MZE A;  4PKT A;  3EDZ A;  3F17 A;  3WV2 A;  3HDB A;  1GO8 P;  2YUF A;  5D1T A;  1PWP A;  4HSD A;  1ZXV A;  1D7X A;  1GO7 P;  1G9K A;  4H3X A;  5CZM A;  4FVL A;  3LQB A;  3HY9 A;  2POJ A;  4IUW A;  1HY7 A;  4ON1 A;  1ND1 A;  3Q2H A;  3WV1 A;  1AST A;  1HXN A;  5I12 A;  3CKI A;  2ERP A;  2JXY A;  4H76 A;  3O2X A;  3I7G A;  1QIA A;  1QIB A;  3B2Z A;  1XUD A;  3LKA A;  3KWV C;  3S18 A;  1KUK A;  1HFS A;  3P24 A;  1JIW P;  1OS9 A;  1IAC A;  1BQO A;  3ELM A;  1ATL A;  4GR8 A;  1DTH A;  5D2B A;  3K7L A;  2W13 A;  4L6T A;  4WKI A;  1PWQ A;  1XFY A;  1PWW A;  1CXV A;  1D8F A;  1Z3J A;  3RTT A;  2X3C A;  4ZR5 A;  2X7M A;  1I76 A;  1B8Y A;  1RM8 A;  2RJQ A;  2W15 A;  2JIH A;  2TCL A;  3LJG A;  4AUO A;  1IAD A;  3EHY A;  3G5C A;  4XM6 A;  1SMP A;  4I03 A;  5B5O A;  5BOY A;  966C A;  4H2E A;  2YB9 A;  4XCT A;  1JAO A;  1Q3A A;  3UVC A;  5B5P A;  3RTS A;  3F19 A;  1C8T A;  1CGL A;  3EDG A;  4XBH A;  1JIZ A;  1KUH A;  1XFV A;  2DW0 A;  3E8R A;  3L0T A;  3P1V A;  1QIC A;  1ITV A;  1BIW A;  3DPE A;  4H30 A;  1JAQ A;  4G0D A;  2JT6 A;  2L0R A;  4H1Q A;  3O64 A;  4AXQ A;  2K9C A;  2W12 A;  2OY2 A;  4L7A A;  5BOT A;  1JK3 A;  3C7X A;  3USN A;  1XM5 A;  1A86 A;  3EDH A;  4IJO A;  3HDA P;  4OEI A;  3WV3 A;  2OI0 A;  4G9L A;  1SRP A;  2N8R A;  3KEJ A;  1K7I A;  3OHL A;  1ZVX A;  3F16 A;  2Y6D A;  4AIG A;  3NX7 A;  1SU3 A;  3LJZ A;  3VTG A;  4IN9 A;  3LIK A;  4DF9 A;  4DV8 A;  1KUF A;  2YIG A;  1EAK A;  2W0D A;  3HY7 A;  3ZUK A;  1DMT A;  2K2G A;  3ZVS A;  1I1I P;  1YOU A;  3KMC A;  3EWJ A;  1L6J A;  3LP9 A;  1KAP P;  1R55 A;  1JJ9 A;  1SLN A;  4WF6 A;  4AYK A;  1OS2 A;  5I0L A;  3N2U A;  1B3D A;  1RMZ A;  4GUY A;  4HX3 A;  4GR0 A;  5D1U A;  3VI1 A; 
#chains in the Genus database with same CATH homology
 3TS4 A;  3DL1 A;  1ZS0 A;  1G4K A;  1HV5 A;  1QUA A;  1UTZ A;  2DDY A;  2OW1 A;  1O0Q A;  4GWM A;  1ZTQ A;  3I7I A;  3BA0 A;  1O0T A;  2QPJ A;  1MMP A;  1G05 A;  1I73 A;  3KEC A;  2OXZ A;  2ERQ A;  3B8Z A;  1JAP A;  3AYK A;  4R3V A;  2V4B A;  2X3A A;  1R1J A;  1KBC A;  2JSD A;  4WK7 A;  2XS3 A;  1MMR A;  4H82 A;  1C3I A;  3EHX A;  4XM8 A;  4PKQ A;  3LIR A;  5D7W A;  5BPA A;  2O3E A;  1R1I A;  2OY4 A;  5LAB A;  1QJS A;  4H49 A;  4PKV A;  4JPA A;  3TSK A;  1Y0V A;  4DPE A;  3LJT A;  2MQS A;  4PKU A;  3L0V A;  1XFX A;  4Q1L A;  1UMS A;  2D1O A;  2OW0 A;  2DW2 A;  2MZI A;  1UTT A;  2DW1 A;  5L7F A;  3LMC A;  4PKW A;  1A85 A;  1MMQ A;  3KRY A;  5I3M A;  3SHI A;  4GF1 A;  4J4M A;  1C7K A;  2Z2D A;  3G42 A;  1K7Q A;  1IAA A;  2JNP A;  4A3W A;  3OYO A;  3GBO A;  1G12 A;  5D1S A;  2SRT A;  3LUM A;  2CLT A;  2A8H A;  1G49 A;  1QHU A;  2O36 A;  3B92 A;  1HOV A;  1D5J A;  1BSW A;  3V96 B;  1S4B P;  1AYK A;  3U1R A;  3F15 A;  1BKC I;  2OVX A;  1PEX A;  4PKS A;  1USN A;  2OZR A;  5D3C A;  4CTH A;  1UMT A;  2HU6 A;  2WOA A;  4L19 A;  3LIL A;  3LE9 A;  1CK7 A;  3DWB A;  4ILW D;  1PWU A;  4FU4 A;  4FXQ A;  2J0T A;  1MNC A;  5I4O A;  2FV9 A;  2OW9 A;  3DTE A;  3AYU A;  5L79 A;  3LK8 A;  3V6N A;  2AIG P;  2Y6C A;  4FXY P;  1XUC A;  1K7G A;  1OMJ A;  2OW2 A;  2MLR A;  4L63 A;  1CIZ A;  830C A;  1ZXC A;  1IAB A;  1IAG A;  4WKE A;  1SAT A;  2I47 A;  2WO9 A;  1KUI A;  1OM8 A;  5H8X A;  1R1H A;  1EUB A;  1UEA A;  3HBU P;  1HTD A;  4GQL A;  1ROS A;  4RT6 B;  1BUV M;  1XUR A;  3DNG A;  4WZV A;  2PJT A;  2OXU A;  4JIJ A;  1XFZ A;  3KME A;  3AIG A;  1CAQ A;  1BUD A;  1YQY A;  3EDI A;  3Q2G A;  3K7N A;  2ERO A;  4DD8 A;  4JP4 A;  4JQG A;  456C A;  3LQ0 A;  3ZXH A;  2OXW A;  4QKZ A;  3HB2 P;  1GEN A;  2MZH A;  3TT4 A;  1AF0 A;  1OM7 A;  3DTI A;  3HYG A;  1BQQ M;  3KEK A;  1EB6 A;  1Y93 A;  3F1A A;  1GKC A;  1XFU A;  1XFW A;  1PWV A;  3HBV P;  4JA1 A;  2D1N A;  2W14 A;  1JH1 A;  1ZP5 A;  1JKY A;  3F18 A;  1CGE A;  1CGF A;  4GR3 A;  1SLM A;  1YP1 A;  2FV5 A;  2CKI A;  2E3X A;  1BM6 A;  1AKL A;  4LL2 A;  1GE6 A;  1OO9 A;  4A7B A;  4XM7 A;  1GXD A;  1IAE A;  5JMY A;  5CXA A;  3MA2 A;  4GWN A;  2J83 A;  1Y8J A;  2OVZ A;  1HFC A;  5I43 A;  1FBL A;  2E2D A;  2WO8 A;  4I35 A;  3LEA A;  2DDF A;  1J7N A;  4H84 A;  1GE7 A;  1BZS A;  4YEH A;  2X3B A;  2RJP A;  3DSL A;  3DTK A;  3OHO A;  1R54 A;  1GKD A;  5CUH A;  3LUN A;  1OM6 A;  3N2V A;  1KUG A;  1BKC E;  1BKC A;  1GE5 A;  1FLS A;  4HMA A;  3TVC A;  5I2Z A;  1FM1 A;  4EFS A;  1MMB A;  1H71 P;  1RTG A;  2XS4 A;  1D8M A;  1YCM A;  1WNI A;  1QJI A;  3KHI A;  4PKR A;  2KRJ A;  2AYK A;  2JT5 A;  1CQR A;  3LGP A;  2MLS A;  1QJJ A;  2USN A;  3DPF A;  1JAN A;  2MZE A;  4PKT A;  3EDZ A;  3F17 A;  3WV2 A;  3HDB A;  1GO8 P;  2YUF A;  5D1T A;  1PWP A;  4HSD A;  1ZXV A;  1D7X A;  1GO7 P;  1G9K A;  4H3X A;  5CZM A;  4FVL A;  3LQB A;  3HY9 A;  2POJ A;  4IUW A;  1HY7 A;  4ON1 A;  1ND1 A;  3Q2H A;  3WV1 A;  1AST A;  1HXN A;  5I12 A;  3CKI A;  2ERP A;  2JXY A;  4H76 A;  3O2X A;  3I7G A;  1QIA A;  1QIB A;  3B2Z A;  1XUD A;  3LKA A;  3KWV C;  3S18 A;  1KUK A;  1HFS A;  3P24 A;  1JIW P;  1OS9 A;  1IAC A;  1BQO A;  3ELM A;  1ATL A;  4GR8 A;  1DTH A;  5D2B A;  3K7L A;  2W13 A;  4L6T A;  4WKI A;  1PWQ A;  1XFY A;  1PWW A;  1CXV A;  1D8F A;  1Z3J A;  3RTT A;  2X3C A;  4ZR5 A;  2X7M A;  1I76 A;  1B8Y A;  1RM8 A;  2RJQ A;  2W15 A;  2JIH A;  2TCL A;  3LJG A;  4AUO A;  1IAD A;  3EHY A;  3G5C A;  4XM6 A;  1SMP A;  4I03 A;  5B5O A;  5BOY A;  966C A;  4H2E A;  2YB9 A;  4XCT A;  1JAO A;  1Q3A A;  3UVC A;  5B5P A;  3RTS A;  3F19 A;  1C8T A;  1CGL A;  3EDG A;  4XBH A;  1JIZ A;  1KUH A;  1XFV A;  2DW0 A;  3E8R A;  3L0T A;  3P1V A;  1QIC A;  1ITV A;  1BIW A;  3DPE A;  4H30 A;  1JAQ A;  4G0D A;  2JT6 A;  2L0R A;  4H1Q A;  3O64 A;  4AXQ A;  2K9C A;  2W12 A;  2OY2 A;  4L7A A;  5BOT A;  1JK3 A;  3C7X A;  3USN A;  1A86 A;  3EDH A;  4IJO A;  3HDA P;  4OEI A;  3WV3 A;  2OI0 A;  4G9L A;  1SRP A;  2N8R A;  3KEJ A;  1K7I A;  3OHL A;  1ZVX A;  3F16 A;  2Y6D A;  4AIG A;  3NX7 A;  1SU3 A;  3LJZ A;  3VTG A;  4IN9 A;  3LIK A;  4DF9 A;  4DV8 A;  1KUF A;  2YIG A;  1EAK A;  2W0D A;  3HY7 A;  3ZUK A;  1DMT A;  2K2G A;  3ZVS A;  1I1I P;  1YOU A;  3KMC A;  3EWJ A;  1L6J A;  3LP9 A;  1KAP P;  1R55 A;  1JJ9 A;  1SLN A;  4WF6 A;  4AYK A;  1OS2 A;  5I0L A;  3N2U A;  1B3D A;  1RMZ A;  4GUY A;  4HX3 A;  4GR0 A;  5D1U A;  3VI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...