4G0DA

Human collagenase 3 (mmp-13) full form with peptides from pro-domain
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
368
structure length
368
Chain Sequence
YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHAFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Collagenase 3
publication title Crystal structure of full-length human collagenase 3 (MMP-13) with peptides in the active site defines exosites in the catalytic domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 368
sequence length 368
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.-:
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 4g0dA02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4g0dA01
3V96B 1SRPA 1G9KA 1GE6A 4FU4A 4AUOA 1PWPA 3HYGA 4PKQA 4XCTA 4G9LA 3ELMA 4GQLA 4JA1A 2W13A 1G12A 1XURA 3Q2HA 1BQQM 1XUDA 4H84A 2W14A 2WO9A 1ND1A 4IJOA 3WV3A 3KHIA 1R1HA 4J4MA 1AF0A 2POJA 3S18A 4GUYA 1UTZA 4WF6A 1QIAA 4PKUA 1RTGA 3LGPA 1GO7P 2MZIA 1HTDA 3F16A 4YEHA 4XM7A 1BKCE 1AKLA 1CQRA 2V4BA 1DTHA 5BOYA 1G49A 3LKAA 4EFSA 4H49A 1PWVA 4Q1LA 4L19A 1ZTQA 5D7WA 1FBLA 2PJTA 2DW1A 3NX7A 3LK8A 4WK7A 1JIWP 4WKEA 3I7GA 1YP1A 5I43A 3LJZA 2MZEA 2HU6A 2USNA 3F18A 4PKWA 1IADA 2ERQA 966CA 3DPFA 1Z3JA 2E3XA 5D2BA 1CXVA 1OO9A 4FXYP 1CIZA 1XUCA 1HV5A 3L0TA 3LEAA 3HY7A 1XFUA 3F1AA 3LJTA 2WOAA 3U1RA 2L0RA 1Y93A 2JXYA 1HXNA 3AYKA 4GR8A 2MLRA 5B5PA 4DPEA 3DNGA 1GKDA 3EHXA 4H30A 3G5CA 2D1NA 1IAAA 1MMBA 4OEIA 1JAPA 4XM6A 4I03A 1AYKA 1UMSA 4GR0A 5I2ZA 1IAEA 1QHUA 4PKRA 2AYKA 5LABA 1RMZA 2DW0A 1XFWA 2OXWA 2J0TA 3KRYA 2X3AA 1YOUA 4GWNA 2CLTA 2QPJA 1R1JA 3KMEA 1IAGA 3HBUP 4CTHA 4HSDA 4L6TA 1GKCA 1RM8A 1SU3A 4H2EA 4I35A 2OW2A 4GF1A 2I47A 4AXQA 3HBVP 2OI0A 2X3BA 5I4OA 4WZVA 2DW2A 3VI1A 5D1UA 1Y0VA 3HY9A 1USNA 1YCMA 3GBOA 4WKIA 2FV5A 4ILWD 1UMTA 4JIJA 1D5JA 3DWBA 4PKTA 1GE7A 5D1SA 1BKCA 4AIGA 1ASTA 4ZR5A 1MNCA 4DD8A 1L6JA 1JJ9A 3B92A 1EAKA 2J83A 4JPAA 1QJJA 4G0DA 2JT6A 1J7NA 1OS2A 1JH1A 2JIHA 3UVCA 3ZVSA 1R55A 3L0VA 4H82A 3EDZA 1C7KA 1A86A 3G42A 3K7NA 1QICA 1O0QA 3SHIA 5B5OA 1KUFA 4JQGA 2XS4A 4PKVA 3ZUKA 1D8MA 1EUBA 1DMTA 3OHLA 1BIWA 2AIGP 1MMRA 2ERPA 3LIKA 1I73A 2JSDA 3OYOA 2OW0A 4H76A 4PKSA 3Q2GA 1JKYA 3KECA 4XM8A 1K7IA 1HFSA 2Y6CA 5L79A 3VTGA 1JANA 1OMJA 4GR3A 1JIZA 3MA2A 1G4KA 2W15A 1XFVA 2O36A 2RJQA 3EDGA 1A85A 3RTTA 3P1VA 3EHYA 4A7BA 1KUIA 1CGEA 4QKZA 5CXAA 1FLSA 2K2GA 2K9CA 2EROA 3TSKA 3N2VA 1PWWA 1KAPP 2N8RA 1K7GA 1I1IP 4DF9A 3V6NA 3LMCA 2CKIA 3LP9A 1ZXVA 3I7IA 1SMPA 2DDFA 4RT6B 3KEJA 1HY7A 3F15A 456CA 2Y6DA 3KMCA 2O3EA 2OVZA 1YQYA 4FXQA 4H1QA 2A8HA 3LQBA 1ZP5A 2OXUA 4HX3A 1D7XA 2OW9A 1BKCI 2D1OA 3TVCA 2OVXA 3LJGA 3LUMA 1SATA 2WO8A 1WNIA 1QUAA 2JNPA 3CKIA 1KUKA 1OM8A 3LUNA 2DDYA 4IN9A 1KUHA 1PWQA 1OM7A 3EDHA 4FVLA 3EWJA 1GXDA 3EDIA 2OXZA 4H3XA 3TT4A 4XBHA 3RTSA 1IABA 1OS9A 4LL2A 1SLMA 3K7LA 5CZMA 1MMPA 1GO8P 1BUDA 4HMAA 2X3CA 3HDBA 5H8XA 1ATLA 1BZSA 1CK7A 1BM6A 1IACA 4JP4A 3B8ZA 3LILA 1K7QA 1S4BP 3WV2A 3DL1A 1JAOA 1C3IA 1XFYA 3C7XA 2OW1A 4A3WA 2RJPA 1B3DA 2W12A 3BA0A 2OZRA 2JT5A 3TS4A 1QJIA 1ROSA 3O2XA 3LE9A 1JK3A 1SLNA 5JMYA 2MZHA 1H71P 1XFXA 1R54A 2MLSA 1Q3AA 5I12A 1FM1A 1KBCA 1BQOA 2FV9A 1OM6A 2KRJA 1EB6A 3HB2P 1UTTA 2XS3A 2W0DA 3AIGA 1MMQA 1CGLA 1G05A 5I3MA 1ZS0A 2MQSA 2SRTA 4AYKA 3LIRA 1ZXCA 3ZXHA 1C8TA 830CA 3E8RA 1UEAA 1BSWA 1ZVXA 5D1TA 5CUHA 2OY2A 2X7MA 1HOVA 1BUVM 2Z2DA 1I76A 3O64A 1QJSA 4GWMA 5BPAA 3KEKA 3HDAP 4R3VA 3B2ZA 3P24A 5L7FA 5BOTA 3OHOA 1B8YA 3DPEA 1XFZA 3KWVC 1CAQA 3AYUA 1QIBA 1D8FA 4L63A 2OY4A 4DV8A 4IUWA 1HFCA 1PWUA 3LQ0A 3WV1A 1O0TA 2YIGA 4ON1A 2TCLA 1PEXA 5I0LA 3DSLA 1KUGA 1R1IA 1Y8JA 3N2UA 1GE5A 1CGFA 1JAQA 2YB9A 3F17A 1ITVA 2E2DA 3F19A 3USNA 1GENA 5D3CA
chains in the Genus database with same CATH superfamily
3V96B 1SRPA 1G9KA 1GE6A 4FU4A 4AUOA 1PWPA 3HYGA 4PKQA 4XCTA 4G9LA 3ELMA 4GQLA 4JA1A 2W13A 1G12A 1XURA 3Q2HA 1BQQM 1XUDA 4H84A 2W14A 2WO9A 1ND1A 4IJOA 3WV3A 3KHIA 1R1HA 4J4MA 1AF0A 2POJA 3S18A 4GUYA 1UTZA 4WF6A 1QIAA 4PKUA 1RTGA 3LGPA 1GO7P 2MZIA 1HTDA 3F16A 4YEHA 4XM7A 1BKCE 1AKLA 1CQRA 2V4BA 1DTHA 5BOYA 1G49A 3LKAA 4EFSA 4H49A 1PWVA 3DTIA 4Q1LA 4L19A 1ZTQA 5D7WA 1FBLA 2PJTA 2DW1A 3NX7A 3LK8A 4WK7A 1JIWP 4WKEA 3I7GA 1YP1A 5I43A 3LJZA 2MZEA 2HU6A 2USNA 3F18A 4PKWA 1IADA 2ERQA 966CA 3DPFA 1Z3JA 2E3XA 5D2BA 1CXVA 1OO9A 4FXYP 1CIZA 1XUCA 1HV5A 3L0TA 3LEAA 3HY7A 1XFUA 3F1AA 3LJTA 2WOAA 3U1RA 2L0RA 1XM5A 1Y93A 2JXYA 1HXNA 3AYKA 4GR8A 2MLRA 5B5PA 4DPEA 3DNGA 1GKDA 3EHXA 4H30A 3G5CA 2D1NA 1IAAA 1MMBA 4OEIA 1JAPA 4XM6A 4I03A 1AYKA 1UMSA 4GR0A 5I2ZA 1IAEA 1QHUA 4PKRA 2AYKA 5LABA 1RMZA 2DW0A 1XFWA 2OXWA 2J0TA 3KRYA 2X3AA 1YOUA 4GWNA 2CLTA 2QPJA 1R1JA 3KMEA 1IAGA 3HBUP 4CTHA 4HSDA 4L6TA 1GKCA 1RM8A 1SU3A 4H2EA 4I35A 2OW2A 4GF1A 2I47A 4AXQA 3HBVP 2OI0A 2X3BA 5I4OA 4WZVA 2DW2A 3VI1A 5D1UA 1Y0VA 3HY9A 1USNA 1YCMA 3GBOA 4WKIA 2FV5A 4ILWD 1UMTA 4JIJA 1D5JA 3DWBA 4PKTA 1GE7A 5D1SA 1BKCA 4AIGA 1ASTA 4ZR5A 1MNCA 4DD8A 1L6JA 1JJ9A 3B92A 1EAKA 2J83A 4JPAA 1QJJA 4G0DA 2JT6A 1J7NA 1OS2A 1JH1A 2JIHA 3UVCA 3ZVSA 1R55A 3L0VA 4H82A 3EDZA 1C7KA 1A86A 3DTEA 3G42A 3K7NA 1QICA 1O0QA 3SHIA 5B5OA 1KUFA 4JQGA 2XS4A 4PKVA 3ZUKA 1D8MA 1EUBA 2YUFA 1DMTA 3DTKA 3OHLA 1BIWA 2AIGP 1MMRA 1OZ9A 2ERPA 3LIKA 1I73A 2JSDA 3OYOA 2OW0A 4H76A 4PKSA 3Q2GA 1JKYA 3KECA 4XM8A 1K7IA 1HFSA 2Y6CA 5L79A 3VTGA 1JANA 1OMJA 4GR3A 1JIZA 3MA2A 1G4KA 2W15A 1XFVA 2O36A 2RJQA 3EDGA 1A85A 3RTTA 3P1VA 3EHYA 4A7BA 1KUIA 1CGEA 4QKZA 5CXAA 1FLSA 2K2GA 2K9CA 2EROA 3TSKA 3N2VA 1PWWA 1KAPP 2N8RA 1K7GA 1I1IP 4DF9A 3V6NA 3LMCA 2CKIA 3LP9A 1ZXVA 3I7IA 1SMPA 2DDFA 4RT6B 3KEJA 1HY7A 3F15A 456CA 2Y6DA 3KMCA 2O3EA 2OVZA 1YQYA 4FXQA 4H1QA 2A8HA 3LQBA 1ZP5A 2OXUA 4HX3A 1D7XA 2OW9A 1BKCI 2D1OA 3TVCA 2OVXA 3LJGA 3LUMA 1SATA 2WO8A 1WNIA 1QUAA 2JNPA 3CKIA 1KUKA 1OM8A 3LUNA 2DDYA 4IN9A 1KUHA 1PWQA 1OM7A 3EDHA 4FVLA 3EWJA 1GXDA 3EDIA 2OXZA 4H3XA 3TT4A 4XBHA 3RTSA 1IABA 1OS9A 4LL2A 1SLMA 3K7LA 5CZMA 1MMPA 1GO8P 1BUDA 4HMAA 2X3CA 3HDBA 5H8XA 1ATLA 1BZSA 1CK7A 1BM6A 1IACA 4JP4A 3B8ZA 3LILA 1K7QA 1S4BP 3WV2A 3DL1A 1JAOA 1C3IA 1TVIA 1XFYA 3C7XA 2OW1A 4A3WA 2RJPA 1B3DA 2W12A 3BA0A 2OZRA 4L7AA 2JT5A 3TS4A 1QJIA 1ROSA 3O2XA 3LE9A 1JK3A 1SLNA 5JMYA 2MZHA 1H71P 1XFXA 1R54A 2MLSA 1Q3AA 5I12A 1FM1A 1KBCA 1BQOA 2FV9A 1OM6A 2KRJA 1EB6A 3HB2P 1UTTA 2XS3A 2W0DA 3AIGA 1MMQA 1CGLA 1G05A 5I3MA 1ZS0A 2MQSA 2SRTA 4AYKA 3LIRA 1ZXCA 3ZXHA 1C8TA 830CA 3E8RA 1UEAA 1BSWA 1ZVXA 5D1TA 5CUHA 2OY2A 2X7MA 1HOVA 1BUVM 2Z2DA 1I76A 3O64A 1QJSA 4GWMA 5BPAA 3KEKA 3HDAP 4R3VA 3B2ZA 3P24A 5L7FA 5BOTA 3OHOA 1B8YA 3DPEA 1XFZA 3KWVC 1CAQA 3AYUA 1QIBA 1D8FA 4L63A 2OY4A 4DV8A 4IUWA 1HFCA 1PWUA 3LQ0A 3WV1A 1O0TA 2YIGA 4ON1A 1XAXA 2TCLA 1PEXA 5I0LA 3DSLA 1KUGA 1R1IA 1Y8JA 3N2UA 1GE5A 1CGFA 1JAQA 2YB9A 3F17A 1ITVA 2E2DA 3F19A 3USNA 1GENA 5D3CA
chains in the Genus database with same CATH topology
3V96B 1SRPA 1G9KA 1GE6A 4FU4A 4AUOA 1PWPA 3HYGA 4PKQA 4XCTA 4G9LA 3ELMA 4GQLA 4JA1A 2W13A 1G12A 1XURA 3Q2HA 1BQQM 1XUDA 4H84A 2W14A 2WO9A 1ND1A 4IJOA 3WV3A 3KHIA 1R1HA 4J4MA 1AF0A 2POJA 3S18A 4GUYA 1UTZA 4WF6A 1QIAA 4PKUA 1RTGA 3LGPA 1GO7P 2MZIA 1HTDA 3F16A 4YEHA 4XM7A 1BKCE 1AKLA 1CQRA 2V4BA 1DTHA 5BOYA 1G49A 3LKAA 4EFSA 4H49A 1PWVA 3DTIA 4Q1LA 4L19A 1ZTQA 5D7WA 1FBLA 2PJTA 2DW1A 3NX7A 3LK8A 4WK7A 1JIWP 4WKEA 3I7GA 1YP1A 5I43A 3LJZA 2MZEA 2HU6A 2USNA 3F18A 4PKWA 1IADA 2ERQA 966CA 3DPFA 1Z3JA 2E3XA 5D2BA 1CXVA 1OO9A 4FXYP 1CIZA 1XUCA 1HV5A 3L0TA 3LEAA 3HY7A 1XFUA 3F1AA 3LJTA 2WOAA 3U1RA 2L0RA 1Y93A 2JXYA 1HXNA 3AYKA 4GR8A 2MLRA 5B5PA 4DPEA 3DNGA 1GKDA 3EHXA 4H30A 3G5CA 2D1NA 1IAAA 1MMBA 4OEIA 1JAPA 4XM6A 4I03A 1AYKA 1UMSA 4GR0A 5I2ZA 1IAEA 1QHUA 4PKRA 2AYKA 5LABA 1RMZA 2DW0A 1XFWA 2OXWA 2J0TA 3KRYA 2X3AA 1YOUA 4GWNA 2CLTA 2QPJA 1R1JA 3KMEA 1IAGA 3HBUP 4CTHA 4HSDA 4L6TA 1GKCA 1RM8A 1SU3A 4H2EA 4I35A 2OW2A 4GF1A 2I47A 4AXQA 3HBVP 2OI0A 2X3BA 5I4OA 4WZVA 2DW2A 3VI1A 5D1UA 1Y0VA 3HY9A 1USNA 1YCMA 3GBOA 4WKIA 2FV5A 4ILWD 1UMTA 4JIJA 1D5JA 3DWBA 4PKTA 1GE7A 5D1SA 1BKCA 4AIGA 1ASTA 4ZR5A 1MNCA 4DD8A 1L6JA 1JJ9A 3B92A 1EAKA 2J83A 4JPAA 1QJJA 4G0DA 2JT6A 1J7NA 1OS2A 1JH1A 2JIHA 3UVCA 3ZVSA 1R55A 3L0VA 4H82A 3EDZA 1C7KA 1A86A 3DTEA 3G42A 3K7NA 1QICA 1O0QA 3SHIA 5B5OA 1KUFA 4JQGA 2XS4A 4PKVA 3ZUKA 1D8MA 1EUBA 2YUFA 1DMTA 3DTKA 3OHLA 1BIWA 2AIGP 1MMRA 2ERPA 3LIKA 1I73A 2JSDA 3OYOA 2OW0A 4H76A 4PKSA 3Q2GA 1JKYA 3KECA 4XM8A 1K7IA 1HFSA 2Y6CA 5L79A 3VTGA 1JANA 1OMJA 4GR3A 1JIZA 3MA2A 1G4KA 2W15A 1XFVA 2O36A 2RJQA 3EDGA 1A85A 3RTTA 3P1VA 3EHYA 4A7BA 1KUIA 1CGEA 4QKZA 5CXAA 1FLSA 2K2GA 2K9CA 2EROA 3TSKA 3N2VA 1PWWA 1KAPP 2N8RA 1K7GA 1I1IP 4DF9A 3V6NA 3LMCA 2CKIA 3LP9A 1ZXVA 3I7IA 1SMPA 2DDFA 4RT6B 3KEJA 1HY7A 3F15A 456CA 2Y6DA 3KMCA 2O3EA 2OVZA 1YQYA 4FXQA 4H1QA 2A8HA 3LQBA 1ZP5A 2OXUA 4HX3A 1D7XA 2OW9A 1BKCI 2D1OA 3TVCA 2OVXA 3LJGA 3LUMA 1SATA 2WO8A 1WNIA 1QUAA 2JNPA 3CKIA 1KUKA 1OM8A 3LUNA 2DDYA 4IN9A 1KUHA 1PWQA 1OM7A 3EDHA 4FVLA 3EWJA 1GXDA 3EDIA 2OXZA 4H3XA 3TT4A 4XBHA 3RTSA 1IABA 1OS9A 4LL2A 1SLMA 3K7LA 5CZMA 1MMPA 1GO8P 1BUDA 4HMAA 2X3CA 3HDBA 5H8XA 1ATLA 1BZSA 1CK7A 1BM6A 1IACA 4JP4A 3B8ZA 3LILA 1K7QA 1S4BP 3WV2A 3DL1A 1JAOA 1C3IA 1XFYA 3C7XA 2OW1A 4A3WA 2RJPA 1B3DA 2W12A 3BA0A 2OZRA 4L7AA 2JT5A 3TS4A 1QJIA 1ROSA 3O2XA 3LE9A 1JK3A 1SLNA 5JMYA 2MZHA 1H71P 1XFXA 1R54A 2MLSA 1Q3AA 5I12A 1FM1A 1KBCA 1BQOA 2FV9A 1OM6A 2KRJA 1EB6A 3HB2P 1UTTA 2XS3A 2W0DA 3AIGA 1MMQA 1CGLA 1G05A 5I3MA 1ZS0A 2MQSA 2SRTA 4AYKA 3LIRA 1ZXCA 3ZXHA 1C8TA 830CA 3E8RA 1UEAA 1BSWA 1ZVXA 5D1TA 5CUHA 2OY2A 2X7MA 1HOVA 1BUVM 2Z2DA 1I76A 3O64A 1QJSA 4GWMA 5BPAA 3KEKA 3HDAP 4R3VA 3B2ZA 3P24A 5L7FA 5BOTA 3OHOA 1B8YA 3DPEA 1XFZA 3KWVC 1CAQA 3AYUA 1QIBA 1D8FA 4L63A 2OY4A 4DV8A 4IUWA 1HFCA 1PWUA 3LQ0A 3WV1A 1O0TA 2YIGA 4ON1A 2TCLA 1PEXA 5I0LA 3DSLA 1KUGA 1R1IA 1Y8JA 3N2UA 1GE5A 1CGFA 1JAQA 2YB9A 3F17A 1ITVA 2E2DA 3F19A 3USNA 1GENA 5D3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V96 B;  1SRP A;  1G9K A;  1GE6 A;  4FU4 A;  4AUO A;  1PWP A;  3HYG A;  4PKQ A;  4XCT A;  4G9L A;  3ELM A;  4GQL A;  4JA1 A;  2W13 A;  1G12 A;  1XUR A;  3Q2H A;  1BQQ M;  1XUD A;  4H84 A;  2W14 A;  2WO9 A;  1ND1 A;  4IJO A;  3WV3 A;  3KHI A;  1R1H A;  4J4M A;  1AF0 A;  2POJ A;  3S18 A;  4GUY A;  1UTZ A;  4WF6 A;  1QIA A;  4PKU A;  1RTG A;  3LGP A;  1GO7 P;  2MZI A;  1HTD A;  3F16 A;  4YEH A;  4XM7 A;  1BKC E;  1AKL A;  1CQR A;  2V4B A;  1DTH A;  5BOY A;  1G49 A;  3LKA A;  4EFS A;  4H49 A;  1PWV A;  4Q1L A;  4L19 A;  1ZTQ A;  5D7W A;  1FBL A;  2PJT A;  2DW1 A;  3NX7 A;  3LK8 A;  4WK7 A;  1JIW P;  4WKE A;  3I7G A;  1YP1 A;  5I43 A;  3LJZ A;  2MZE A;  2HU6 A;  2USN A;  3F18 A;  4PKW A;  1IAD A;  2ERQ A;  966C A;  3DPF A;  1Z3J A;  2E3X A;  5D2B A;  1CXV A;  1OO9 A;  4FXY P;  1CIZ A;  1XUC A;  1HV5 A;  3L0T A;  3LEA A;  3HY7 A;  1XFU A;  3F1A A;  3LJT A;  2WOA A;  3U1R A;  2L0R A;  1Y93 A;  2JXY A;  1HXN A;  3AYK A;  4GR8 A;  2MLR A;  5B5P A;  4DPE A;  3DNG A;  1GKD A;  3EHX A;  4H30 A;  3G5C A;  2D1N A;  1IAA A;  1MMB A;  4OEI A;  1JAP A;  4XM6 A;  4I03 A;  1AYK A;  1UMS A;  4GR0 A;  5I2Z A;  1IAE A;  1QHU A;  4PKR A;  2AYK A;  5LAB A;  1RMZ A;  2DW0 A;  1XFW A;  2OXW A;  2J0T A;  3KRY A;  2X3A A;  1YOU A;  4GWN A;  2CLT A;  2QPJ A;  1R1J A;  3KME A;  1IAG A;  3HBU P;  4CTH A;  4HSD A;  4L6T A;  1GKC A;  1RM8 A;  1SU3 A;  4H2E A;  4I35 A;  2OW2 A;  4GF1 A;  2I47 A;  4AXQ A;  3HBV P;  2OI0 A;  2X3B A;  5I4O A;  4WZV A;  2DW2 A;  3VI1 A;  5D1U A;  1Y0V A;  3HY9 A;  1USN A;  1YCM A;  3GBO A;  4WKI A;  2FV5 A;  4ILW D;  1UMT A;  4JIJ A;  1D5J A;  3DWB A;  4PKT A;  1GE7 A;  5D1S A;  1BKC A;  4AIG A;  1AST A;  4ZR5 A;  1MNC A;  4DD8 A;  1L6J A;  1JJ9 A;  3B92 A;  1EAK A;  2J83 A;  4JPA A;  1QJJ A;  4G0D A;  2JT6 A;  1J7N A;  1OS2 A;  1JH1 A;  2JIH A;  3UVC A;  3ZVS A;  1R55 A;  3L0V A;  4H82 A;  3EDZ A;  1C7K A;  1A86 A;  3G42 A;  3K7N A;  1QIC A;  1O0Q A;  3SHI A;  5B5O A;  1KUF A;  4JQG A;  2XS4 A;  4PKV A;  3ZUK A;  1D8M A;  1EUB A;  1DMT A;  3OHL A;  1BIW A;  2AIG P;  1MMR A;  2ERP A;  3LIK A;  1I73 A;  2JSD A;  3OYO A;  2OW0 A;  4H76 A;  4PKS A;  3Q2G A;  1JKY A;  3KEC A;  4XM8 A;  1K7I A;  1HFS A;  2Y6C A;  5L79 A;  3VTG A;  1JAN A;  1OMJ A;  4GR3 A;  1JIZ A;  3MA2 A;  1G4K A;  2W15 A;  1XFV A;  2O36 A;  2RJQ A;  3EDG A;  1A85 A;  3RTT A;  3P1V A;  3EHY A;  4A7B A;  1KUI A;  1CGE A;  4QKZ A;  5CXA A;  1FLS A;  2K2G A;  2K9C A;  2ERO A;  3TSK A;  3N2V A;  1PWW A;  1KAP P;  2N8R A;  1K7G A;  1I1I P;  4DF9 A;  3V6N A;  3LMC A;  2CKI A;  3LP9 A;  1ZXV A;  3I7I A;  1SMP A;  2DDF A;  4RT6 B;  3KEJ A;  1HY7 A;  3F15 A;  456C A;  2Y6D A;  3KMC A;  2O3E A;  2OVZ A;  1YQY A;  4FXQ A;  4H1Q A;  2A8H A;  3LQB A;  1ZP5 A;  2OXU A;  4HX3 A;  1D7X A;  2OW9 A;  1BKC I;  2D1O A;  3TVC A;  2OVX A;  3LJG A;  3LUM A;  1SAT A;  2WO8 A;  1WNI A;  1QUA A;  2JNP A;  3CKI A;  1KUK A;  1OM8 A;  3LUN A;  2DDY A;  4IN9 A;  1KUH A;  1PWQ A;  1OM7 A;  3EDH A;  4FVL A;  3EWJ A;  1GXD A;  3EDI A;  2OXZ A;  4H3X A;  3TT4 A;  4XBH A;  3RTS A;  1IAB A;  1OS9 A;  4LL2 A;  1SLM A;  3K7L A;  5CZM A;  1MMP A;  1GO8 P;  1BUD A;  4HMA A;  2X3C A;  3HDB A;  5H8X A;  1ATL A;  1BZS A;  1CK7 A;  1BM6 A;  1IAC A;  4JP4 A;  3B8Z A;  3LIL A;  1K7Q A;  1S4B P;  3WV2 A;  3DL1 A;  1JAO A;  1C3I A;  1XFY A;  3C7X A;  2OW1 A;  4A3W A;  2RJP A;  1B3D A;  2W12 A;  3BA0 A;  2OZR A;  2JT5 A;  3TS4 A;  1QJI A;  1ROS A;  3O2X A;  3LE9 A;  1JK3 A;  1SLN A;  5JMY A;  2MZH A;  1H71 P;  1XFX A;  1R54 A;  2MLS A;  1Q3A A;  5I12 A;  1FM1 A;  1KBC A;  1BQO A;  2FV9 A;  1OM6 A;  2KRJ A;  1EB6 A;  3HB2 P;  1UTT A;  2XS3 A;  2W0D A;  3AIG A;  1MMQ A;  1CGL A;  1G05 A;  5I3M A;  1ZS0 A;  2MQS A;  2SRT A;  4AYK A;  3LIR A;  1ZXC A;  3ZXH A;  1C8T A;  830C A;  3E8R A;  1UEA A;  1BSW A;  1ZVX A;  5D1T A;  5CUH A;  2OY2 A;  2X7M A;  1HOV A;  1BUV M;  2Z2D A;  1I76 A;  3O64 A;  1QJS A;  4GWM A;  5BPA A;  3KEK A;  3HDA P;  4R3V A;  3B2Z A;  3P24 A;  5L7F A;  5BOT A;  3OHO A;  1B8Y A;  3DPE A;  1XFZ A;  3KWV C;  1CAQ A;  3AYU A;  1QIB A;  1D8F A;  4L63 A;  2OY4 A;  4DV8 A;  4IUW A;  1HFC A;  1PWU A;  3LQ0 A;  3WV1 A;  1O0T A;  2YIG A;  4ON1 A;  2TCL A;  1PEX A;  5I0L A;  3DSL A;  1KUG A;  1R1I A;  1Y8J A;  3N2U A;  1GE5 A;  1CGF A;  1JAQ A;  2YB9 A;  3F17 A;  1ITV A;  2E2D A;  3F19 A;  3USN A;  1GEN A;  5D3C A; 
#chains in the Genus database with same CATH topology
 3V96 B;  1SRP A;  1G9K A;  1GE6 A;  4FU4 A;  4AUO A;  1PWP A;  3HYG A;  4PKQ A;  4XCT A;  4G9L A;  3ELM A;  4GQL A;  4JA1 A;  2W13 A;  1G12 A;  1XUR A;  3Q2H A;  1BQQ M;  1XUD A;  4H84 A;  2W14 A;  2WO9 A;  1ND1 A;  4IJO A;  3WV3 A;  3KHI A;  1R1H A;  4J4M A;  1AF0 A;  2POJ A;  3S18 A;  4GUY A;  1UTZ A;  4WF6 A;  1QIA A;  4PKU A;  1RTG A;  3LGP A;  1GO7 P;  2MZI A;  1HTD A;  3F16 A;  4YEH A;  4XM7 A;  1BKC E;  1AKL A;  1CQR A;  2V4B A;  1DTH A;  5BOY A;  1G49 A;  3LKA A;  4EFS A;  4H49 A;  1PWV A;  3DTI A;  4Q1L A;  4L19 A;  1ZTQ A;  5D7W A;  1FBL A;  2PJT A;  2DW1 A;  3NX7 A;  3LK8 A;  4WK7 A;  1JIW P;  4WKE A;  3I7G A;  1YP1 A;  5I43 A;  3LJZ A;  2MZE A;  2HU6 A;  2USN A;  3F18 A;  4PKW A;  1IAD A;  2ERQ A;  966C A;  3DPF A;  1Z3J A;  2E3X A;  5D2B A;  1CXV A;  1OO9 A;  4FXY P;  1CIZ A;  1XUC A;  1HV5 A;  3L0T A;  3LEA A;  3HY7 A;  1XFU A;  3F1A A;  3LJT A;  2WOA A;  3U1R A;  2L0R A;  1XM5 A;  1Y93 A;  2JXY A;  1HXN A;  3AYK A;  4GR8 A;  2MLR A;  5B5P A;  4DPE A;  3DNG A;  1GKD A;  3EHX A;  4H30 A;  3G5C A;  2D1N A;  1IAA A;  1MMB A;  4OEI A;  1JAP A;  4XM6 A;  4I03 A;  1AYK A;  1UMS A;  4GR0 A;  5I2Z A;  1IAE A;  1QHU A;  4PKR A;  2AYK A;  5LAB A;  1RMZ A;  2DW0 A;  1XFW A;  2OXW A;  2J0T A;  3KRY A;  2X3A A;  1YOU A;  4GWN A;  2CLT A;  2QPJ A;  1R1J A;  3KME A;  1IAG A;  3HBU P;  4CTH A;  4HSD A;  4L6T A;  1GKC A;  1RM8 A;  1SU3 A;  4H2E A;  4I35 A;  2OW2 A;  4GF1 A;  2I47 A;  4AXQ A;  3HBV P;  2OI0 A;  2X3B A;  5I4O A;  4WZV A;  2DW2 A;  3VI1 A;  5D1U A;  1Y0V A;  3HY9 A;  1USN A;  1YCM A;  3GBO A;  4WKI A;  2FV5 A;  4ILW D;  1UMT A;  4JIJ A;  1D5J A;  3DWB A;  4PKT A;  1GE7 A;  5D1S A;  1BKC A;  4AIG A;  1AST A;  4ZR5 A;  1MNC A;  4DD8 A;  1L6J A;  1JJ9 A;  3B92 A;  1EAK A;  2J83 A;  4JPA A;  1QJJ A;  4G0D A;  2JT6 A;  1J7N A;  1OS2 A;  1JH1 A;  2JIH A;  3UVC A;  3ZVS A;  1R55 A;  3L0V A;  4H82 A;  3EDZ A;  1C7K A;  1A86 A;  3DTE A;  3G42 A;  3K7N A;  1QIC A;  1O0Q A;  3SHI A;  5B5O A;  1KUF A;  4JQG A;  2XS4 A;  4PKV A;  3ZUK A;  1D8M A;  1EUB A;  2YUF A;  1DMT A;  3DTK A;  3OHL A;  1BIW A;  2AIG P;  1MMR A;  1OZ9 A;  2ERP A;  3LIK A;  1I73 A;  2JSD A;  3OYO A;  2OW0 A;  4H76 A;  4PKS A;  3Q2G A;  1JKY A;  3KEC A;  4XM8 A;  1K7I A;  1HFS A;  2Y6C A;  5L79 A;  3VTG A;  1JAN A;  1OMJ A;  4GR3 A;  1JIZ A;  3MA2 A;  1G4K A;  2W15 A;  1XFV A;  2O36 A;  2RJQ A;  3EDG A;  1A85 A;  3RTT A;  3P1V A;  3EHY A;  4A7B A;  1KUI A;  1CGE A;  4QKZ A;  5CXA A;  1FLS A;  2K2G A;  2K9C A;  2ERO A;  3TSK A;  3N2V A;  1PWW A;  1KAP P;  2N8R A;  1K7G A;  1I1I P;  4DF9 A;  3V6N A;  3LMC A;  2CKI A;  3LP9 A;  1ZXV A;  3I7I A;  1SMP A;  2DDF A;  4RT6 B;  3KEJ A;  1HY7 A;  3F15 A;  456C A;  2Y6D A;  3KMC A;  2O3E A;  2OVZ A;  1YQY A;  4FXQ A;  4H1Q A;  2A8H A;  3LQB A;  1ZP5 A;  2OXU A;  4HX3 A;  1D7X A;  2OW9 A;  1BKC I;  2D1O A;  3TVC A;  2OVX A;  3LJG A;  3LUM A;  1SAT A;  2WO8 A;  1WNI A;  1QUA A;  2JNP A;  3CKI A;  1KUK A;  1OM8 A;  3LUN A;  2DDY A;  4IN9 A;  1KUH A;  1PWQ A;  1OM7 A;  3EDH A;  4FVL A;  3EWJ A;  1GXD A;  3EDI A;  2OXZ A;  4H3X A;  3TT4 A;  4XBH A;  3RTS A;  1IAB A;  1OS9 A;  4LL2 A;  1SLM A;  3K7L A;  5CZM A;  1MMP A;  1GO8 P;  1BUD A;  4HMA A;  2X3C A;  3HDB A;  5H8X A;  1ATL A;  1BZS A;  1CK7 A;  1BM6 A;  1IAC A;  4JP4 A;  3B8Z A;  3LIL A;  1K7Q A;  1S4B P;  3WV2 A;  3DL1 A;  1JAO A;  1C3I A;  1TVI A;  1XFY A;  3C7X A;  2OW1 A;  4A3W A;  2RJP A;  1B3D A;  2W12 A;  3BA0 A;  2OZR A;  4L7A A;  2JT5 A;  3TS4 A;  1QJI A;  1ROS A;  3O2X A;  3LE9 A;  1JK3 A;  1SLN A;  5JMY A;  2MZH A;  1H71 P;  1XFX A;  1R54 A;  2MLS A;  1Q3A A;  5I12 A;  1FM1 A;  1KBC A;  1BQO A;  2FV9 A;  1OM6 A;  2KRJ A;  1EB6 A;  3HB2 P;  1UTT A;  2XS3 A;  2W0D A;  3AIG A;  1MMQ A;  1CGL A;  1G05 A;  5I3M A;  1ZS0 A;  2MQS A;  2SRT A;  4AYK A;  3LIR A;  1ZXC A;  3ZXH A;  1C8T A;  830C A;  3E8R A;  1UEA A;  1BSW A;  1ZVX A;  5D1T A;  5CUH A;  2OY2 A;  2X7M A;  1HOV A;  1BUV M;  2Z2D A;  1I76 A;  3O64 A;  1QJS A;  4GWM A;  5BPA A;  3KEK A;  3HDA P;  4R3V A;  3B2Z A;  3P24 A;  5L7F A;  5BOT A;  3OHO A;  1B8Y A;  3DPE A;  1XFZ A;  3KWV C;  1CAQ A;  3AYU A;  1QIB A;  1D8F A;  4L63 A;  2OY4 A;  4DV8 A;  4IUW A;  1HFC A;  1PWU A;  3LQ0 A;  3WV1 A;  1O0T A;  2YIG A;  4ON1 A;  1XAX A;  2TCL A;  1PEX A;  5I0L A;  3DSL A;  1KUG A;  1R1I A;  1Y8J A;  3N2U A;  1GE5 A;  1CGF A;  1JAQ A;  2YB9 A;  3F17 A;  1ITV A;  2E2D A;  3F19 A;  3USN A;  1GEN A;  5D3C A; 
#chains in the Genus database with same CATH homology
 3V96 B;  1SRP A;  1G9K A;  1GE6 A;  4FU4 A;  4AUO A;  1PWP A;  3HYG A;  4PKQ A;  4XCT A;  4G9L A;  3ELM A;  4GQL A;  4JA1 A;  2W13 A;  1G12 A;  1XUR A;  3Q2H A;  1BQQ M;  1XUD A;  4H84 A;  2W14 A;  2WO9 A;  1ND1 A;  4IJO A;  3WV3 A;  3KHI A;  1R1H A;  4J4M A;  1AF0 A;  2POJ A;  3S18 A;  4GUY A;  1UTZ A;  4WF6 A;  1QIA A;  4PKU A;  1RTG A;  3LGP A;  1GO7 P;  2MZI A;  1HTD A;  3F16 A;  4YEH A;  4XM7 A;  1BKC E;  1AKL A;  1CQR A;  2V4B A;  1DTH A;  5BOY A;  1G49 A;  3LKA A;  4EFS A;  4H49 A;  1PWV A;  3DTI A;  4Q1L A;  4L19 A;  1ZTQ A;  5D7W A;  1FBL A;  2PJT A;  2DW1 A;  3NX7 A;  3LK8 A;  4WK7 A;  1JIW P;  4WKE A;  3I7G A;  1YP1 A;  5I43 A;  3LJZ A;  2MZE A;  2HU6 A;  2USN A;  3F18 A;  4PKW A;  1IAD A;  2ERQ A;  966C A;  3DPF A;  1Z3J A;  2E3X A;  5D2B A;  1CXV A;  1OO9 A;  4FXY P;  1CIZ A;  1XUC A;  1HV5 A;  3L0T A;  3LEA A;  3HY7 A;  1XFU A;  3F1A A;  3LJT A;  2WOA A;  3U1R A;  2L0R A;  1Y93 A;  2JXY A;  1HXN A;  3AYK A;  4GR8 A;  2MLR A;  5B5P A;  4DPE A;  3DNG A;  1GKD A;  3EHX A;  4H30 A;  3G5C A;  2D1N A;  1IAA A;  1MMB A;  4OEI A;  1JAP A;  4XM6 A;  4I03 A;  1AYK A;  1UMS A;  4GR0 A;  5I2Z A;  1IAE A;  1QHU A;  4PKR A;  2AYK A;  5LAB A;  1RMZ A;  2DW0 A;  1XFW A;  2OXW A;  2J0T A;  3KRY A;  2X3A A;  1YOU A;  4GWN A;  2CLT A;  2QPJ A;  1R1J A;  3KME A;  1IAG A;  3HBU P;  4CTH A;  4HSD A;  4L6T A;  1GKC A;  1RM8 A;  1SU3 A;  4H2E A;  4I35 A;  2OW2 A;  4GF1 A;  2I47 A;  4AXQ A;  3HBV P;  2OI0 A;  2X3B A;  5I4O A;  4WZV A;  2DW2 A;  3VI1 A;  5D1U A;  1Y0V A;  3HY9 A;  1USN A;  1YCM A;  3GBO A;  4WKI A;  2FV5 A;  4ILW D;  1UMT A;  4JIJ A;  1D5J A;  3DWB A;  4PKT A;  1GE7 A;  5D1S A;  1BKC A;  4AIG A;  1AST A;  4ZR5 A;  1MNC A;  4DD8 A;  1L6J A;  1JJ9 A;  3B92 A;  1EAK A;  2J83 A;  4JPA A;  1QJJ A;  4G0D A;  2JT6 A;  1J7N A;  1OS2 A;  1JH1 A;  2JIH A;  3UVC A;  3ZVS A;  1R55 A;  3L0V A;  4H82 A;  3EDZ A;  1C7K A;  1A86 A;  3DTE A;  3G42 A;  3K7N A;  1QIC A;  1O0Q A;  3SHI A;  5B5O A;  1KUF A;  4JQG A;  2XS4 A;  4PKV A;  3ZUK A;  1D8M A;  1EUB A;  2YUF A;  1DMT A;  3DTK A;  3OHL A;  1BIW A;  2AIG P;  1MMR A;  2ERP A;  3LIK A;  1I73 A;  2JSD A;  3OYO A;  2OW0 A;  4H76 A;  4PKS A;  3Q2G A;  1JKY A;  3KEC A;  4XM8 A;  1K7I A;  1HFS A;  2Y6C A;  5L79 A;  3VTG A;  1JAN A;  1OMJ A;  4GR3 A;  1JIZ A;  3MA2 A;  1G4K A;  2W15 A;  1XFV A;  2O36 A;  2RJQ A;  3EDG A;  1A85 A;  3RTT A;  3P1V A;  3EHY A;  4A7B A;  1KUI A;  1CGE A;  4QKZ A;  5CXA A;  1FLS A;  2K2G A;  2K9C A;  2ERO A;  3TSK A;  3N2V A;  1PWW A;  1KAP P;  2N8R A;  1K7G A;  1I1I P;  4DF9 A;  3V6N A;  3LMC A;  2CKI A;  3LP9 A;  1ZXV A;  3I7I A;  1SMP A;  2DDF A;  4RT6 B;  3KEJ A;  1HY7 A;  3F15 A;  456C A;  2Y6D A;  3KMC A;  2O3E A;  2OVZ A;  1YQY A;  4FXQ A;  4H1Q A;  2A8H A;  3LQB A;  1ZP5 A;  2OXU A;  4HX3 A;  1D7X A;  2OW9 A;  1BKC I;  2D1O A;  3TVC A;  2OVX A;  3LJG A;  3LUM A;  1SAT A;  2WO8 A;  1WNI A;  1QUA A;  2JNP A;  3CKI A;  1KUK A;  1OM8 A;  3LUN A;  2DDY A;  4IN9 A;  1KUH A;  1PWQ A;  1OM7 A;  3EDH A;  4FVL A;  3EWJ A;  1GXD A;  3EDI A;  2OXZ A;  4H3X A;  3TT4 A;  4XBH A;  3RTS A;  1IAB A;  1OS9 A;  4LL2 A;  1SLM A;  3K7L A;  5CZM A;  1MMP A;  1GO8 P;  1BUD A;  4HMA A;  2X3C A;  3HDB A;  5H8X A;  1ATL A;  1BZS A;  1CK7 A;  1BM6 A;  1IAC A;  4JP4 A;  3B8Z A;  3LIL A;  1K7Q A;  1S4B P;  3WV2 A;  3DL1 A;  1JAO A;  1C3I A;  1XFY A;  3C7X A;  2OW1 A;  4A3W A;  2RJP A;  1B3D A;  2W12 A;  3BA0 A;  2OZR A;  4L7A A;  2JT5 A;  3TS4 A;  1QJI A;  1ROS A;  3O2X A;  3LE9 A;  1JK3 A;  1SLN A;  5JMY A;  2MZH A;  1H71 P;  1XFX A;  1R54 A;  2MLS A;  1Q3A A;  5I12 A;  1FM1 A;  1KBC A;  1BQO A;  2FV9 A;  1OM6 A;  2KRJ A;  1EB6 A;  3HB2 P;  1UTT A;  2XS3 A;  2W0D A;  3AIG A;  1MMQ A;  1CGL A;  1G05 A;  5I3M A;  1ZS0 A;  2MQS A;  2SRT A;  4AYK A;  3LIR A;  1ZXC A;  3ZXH A;  1C8T A;  830C A;  3E8R A;  1UEA A;  1BSW A;  1ZVX A;  5D1T A;  5CUH A;  2OY2 A;  2X7M A;  1HOV A;  1BUV M;  2Z2D A;  1I76 A;  3O64 A;  1QJS A;  4GWM A;  5BPA A;  3KEK A;  3HDA P;  4R3V A;  3B2Z A;  3P24 A;  5L7F A;  5BOT A;  3OHO A;  1B8Y A;  3DPE A;  1XFZ A;  3KWV C;  1CAQ A;  3AYU A;  1QIB A;  1D8F A;  4L63 A;  2OY4 A;  4DV8 A;  4IUW A;  1HFC A;  1PWU A;  3LQ0 A;  3WV1 A;  1O0T A;  2YIG A;  4ON1 A;  2TCL A;  1PEX A;  5I0L A;  3DSL A;  1KUG A;  1R1I A;  1Y8J A;  3N2U A;  1GE5 A;  1CGF A;  1JAQ A;  2YB9 A;  3F17 A;  1ITV A;  2E2D A;  3F19 A;  3USN A;  1GEN A;  5D3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...