1GXDA

Prommp-2/timp-2 complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
631
structure length
624
Chain Sequence
b'APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 72 KDA TYPE IV COLLAGENASE
publication title Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 115
structure length 624
sequence length 631
chains with identical sequence B
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2002-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1gxdA02
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1gxdA04
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1gxdA03
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 1gxdA05
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1gxdA01
1PDCA 3LUNA 1C8TA 2D1OA 2OY2A 2K2GA 3DWBA 3LIRA 4A7BA 1B8YA 4XM7A 1R1IA 1BQOA 3M7PA 3V6NA 1JK3A 1OS2A 4HX3A 3KEKA 1QHUA 1SU3A 1JIZA 3F19A 2USNA 5D2BA 2OY4A 4H82A 1CXWA 1Q3AA 3B2ZA 5BOYA 4YEHA 5B5PA 1KUIA 1ASTA 5BPAA 966CA 1B3DA 3O2XA 1CGLA 5D1UA 3EHXA 1S4BP 1GE5A 5D1SA 1YP1A 1IAAA 1QJJA 2YB9A 4CTHA 3I7GA 3LJZA 3P1VA 2FV9A 3HBVP 1SATA 4ILWD 1IADA 4PKSA 1QJSA 1G05A 2OVZA 3HY7A 3TT4A 3F18A 1ITVA 2E2DA 2MLSA 4PKWA 2JXYA 3LMCA 1I73A 3AIGA 3AYKA 3TSKA 1BKCE 3KRYA 4H30A 1UTTA 3LGPA 5L79A 2YIGA 2JSDA 2WOAA 1JIWP 3BA0A 4RT6B 2JT5A 1XFYA 1WNIA 4ON1A 5I43A 3ZUKA 1XFUA 2DDFA 1Y93A 1I1IP 2ERPA 3LQBA 2D1NA 1BQQM 4DF9A 1OO9A 3EDIA 2JNPA 4GF1A 3HYGA 1JAPA 1GKDA 2QPJA 4H2EA 2O36A 2X3BA 1EUBA 1JKYA 2W14A 5B5OA 4HMAA 1HFCA 1BM6A 1GE6A 4L63A 2I47A 2SRTA 1KUFA 1D5JA 1BIWA 4I03A 2O3EA 1SRPA 5I0LA 1KBCA 1I76A 1HOVA 1K7GA 1CIZA 2MQSA 2FV5A 4OEIA 4J4MA 5D3CA 2MZIA 4H49A 4Q1LA 1GE7A 3B8ZA 1UMSA 3HB2P 3OHLA 1ND1A 3P24A 4AYKA 4I35A 1KUKA 2AIGP 5L7FA 3ZVSA 3GBOA 3LJGA 2V4BA 2A8HA 5D7WA 3C7XA 1Z3JA 1J7NA 2OW1A 3NX7A 4G9LA 4WF6A 3ZXHA 3L0TA 4HSDA 2PJTA 1QIBA 3O64A 1Y0VA 3F15A 4WK7A 1JANA 3TS4A 4PKVA 2Z2DA 1GENA 1CAQA 2OXZA 4LL2A 1SLNA 2AYKA 2OXUA 2W13A 4JA1A 1HXNA 4QKZA 4FXYP 5BOTA 1QIAA 1BUVM 1PWPA 3DPEA 1KUHA 1FLSA 1MMRA 2JIHA 3EDGA 1JJ9A 2K9CA 3DSLA 1D7XA 4WKIA 1CQRA 4A3WA 3LE9A 4JQGA 4JP4A 1RMZA 2WO9A 1GXDA 5CZMA 5I4OA 1ZTQA 3G42A 2XS3A 4GUYA 2HU6A 4ZR5A 4DPEA 2DW2A 1ZVXA 1IAGA 3EDZA 4FXQA 4JPAA 2Y6DA 3KWVC 1CXVA 1EB6A 1JH1A 1AKLA 3CKIA 1KAPP 1OM6A 1FBLA 1USNA 3DPFA 2OXWA 2J83A 1ZXCA 3OYOA 1SLMA 1YCMA 1RM8A 1ATLA 5I3MA 3LKAA 3USNA 2E3XA 2WO8A 4H76A 3V96B 5JMYA 1QUAA 3UVCA 1HFSA 3AYUA 2X3AA 3K7NA 4L19A 1E88A 3EHYA 2KRJA 5H8XA 1YOUA 1G9KA 1R54A 1D8FA 4WZVA 1KUGA 1IAEA 3F1AA 2OZRA 4GR0A 1H71P 1EAKA 3DNGA 3TVCA 1E8BA 1G12A 4AUOA 3Q2GA 1CGFA 1GO7P 1BZSA 1JAOA 1BUDA 2MLRA 4FVLA 4G0DA 4H1QA 3HDAP 2L0RA 1OMJA 1AF0A 4L6TA 1BSWA 4DD8A 1J7MA 2W12A 2MZHA 3L0VA 1QJIA 4XCTA 1XUCA 456CA 1IACA 1XUDA 1MMPA 1ZXVA 2W0DA 2FN2A 3KEJA 1K7QA 4XBHA 1PWQA 2JT6A 4GR3A 3KMEA 3EWJA 1OS9A 1G49A 1MNCA 830CA 2DW1A 3LQ0A 5I2ZA 1PEXA 1UEAA 1JAQA 1FM1A 4JIJA 1ROSA 3LEAA 4R3VA 3RTTA 3LIKA 3B92A 2POJA 2J0TA 4H3XA 4IN9A 1HV5A 3KHIA 1O0TA 2OW0A 1PWWA 3LP9A 1MMBA 1A85A 1R55A 2RJQA 1XFXA 5LABA 1PWVA 3Q2HA 1XURA 1H8PA 3EDHA 4IUWA 4AIGA 3MQLA 1IABA 2ERQA 1GO8P 1D8MA 4GR8A 2V5OA 1OM8A 2RJPA 4DV8A 1HY7A 3VTGA 2MZEA 2W15A 2OW9A 3WV1A 4GWMA 3WV3A 1G4KA 1QO6A 2TCLA 4WKEA 3LJTA 1XFZA 3S18A 1UMTA 4XM6A 1L6JA 1O0QA 1AYKA 3I7IA 1RTGA 1XFVA 3LK8A 3E8RA 3HDBA 4AXQA 3OHOA 1UTZA 1KS0A 5D1TA 3F17A 1YQYA 3F16A 4EFSA 5CXAA 1R1JA 4FU4A 2CLTA 1DTHA 2XS4A 1PWUA 1ZP5A 1SMPA 3ELMA 3U1RA 1OM7A 2OI0A 4GWNA 1XFWA 2CKIA 3K7LA 1QICA 4PKUA 4IJOA 1C7KA 1ZS0A 3KECA 1BKCI 3HY9A 4H84A 4GQLA 1MMQA 3KMCA 2OVXA 1GKCA 1Y8JA 3HBUP 3LUMA 4XM8A 3RTSA 1CGEA 1BKCA 2X7MA 3DL1A 3N2UA 3WV2A 3MA2A 2N8RA 4PKRA 2DW0A 4PKQA 3N2VA 3VI1A 1A86A 2EROA 3LILA 1R1HA 3SHIA 1C3IA 4PKTA 1K7IA 5CUHA 5I12A 1HTDA 1CK7A 2Y6CA 3G5CA 2DDYA 2OW2A 1DMTA 2X3CA
chains in the Genus database with same CATH superfamily
1PDCA 3LUNA 1C8TA 2D1OA 2OY2A 2K2GA 3DWBA 3LIRA 4A7BA 1B8YA 4XM7A 1R1IA 1BQOA 3M7PA 3V6NA 1JK3A 1OS2A 4HX3A 3KEKA 1QHUA 1SU3A 1JIZA 3F19A 2JCHA 2USNA 5D2BA 1AIWA 2OY4A 4H82A 1CXWA 1H0GA 1Q3AA 3B2ZA 1YU3A 5BOYA 4YEHA 5B5PA 1KUIA 1ASTA 5BPAA 966CA 1B3DA 3O2XA 1CGLA 5D1UA 3EHXA 1S4BP 4NZ3A 1GE5A 2Y2MA 4HMDA 5D1SA 3L29A 1YP1A 1IAAA 1QJJA 2Y2KA 2YB9A 1W1TA 3KS8A 4CTHA 4MB3A 3L27A 3I7GA 3LJZA 3P1VA 2FV9A 3HBVP 4OUIA 1SATA 4ILWD 1IADA 4PKSA 1QJSA 1G05A 2OVZA 3HY7A 3TT4A 3F18A 1ITVA 2E2DA 2MLSA 4PKWA 2JXYA 3LMCA 1I73A 3AIGA 4NZ5A 3AYKA 3TSKA 1BKCE 3KRYA 4H30A 4Z2JA 1UTTA 3WD0A 3LGPA 5L79A 1OZ9A 2YIGA 2JSDA 2WOAA 1JIWP 3BA0A 4RT6B 2JT5A 1XFYA 1WNIA 4ON1A 5I43A 4NYUA 3ZUKA 1XFUA 2DDFA 1E15A 4Z2GA 1Y93A 4NZ4A 1I1IP 2ERPA 3LQBA 2D1NA 1BQQM 4DF9A 1OO9A 3EDIA 2JNPA 4GF1A 3HYGA 1JAPA 4MB5A 1GKDA 2QPJA 4H2EA 2O36A 2X3BA 1EUBA 1JKYA 2W14A 5B5OA 4HMAA 1HFCA 1BM6A 1E6NA 4IBGA 1GE6A 4IBEA 2I47A 2SRTA 4L63A 1GOIA 1KUFA 2Y2HA 1D5JA 1BIWA 4I03A 2O3EA 1SRPA 5I0LA 1TVIA 4OJOA 1KBCA 1I76A 1HOVA 4QNLA 1K7GA 1CIZA 2MQSA 2FV5A 4OEIA 4J4MA 5D3CA 4NYYA 2MZIA 4H49A 4Q1LA 1GE7A 3B8ZA 1UMSA 3HB2P 3OHLA 1ND1A 3P24A 4AYKA 4I35A 1KUKA 2AIGP 5L7FA 3ZVSA 3GBOA 3LJGA 2V4BA 2A8HA 5D7WA 3C7XA 4TX8A 1Z3JA 1J7NA 2OW1A 1YU1A 3NX7A 4G9LA 2YUFA 4WF6A 3ZXHA 3L0TA 4HSDA 1XAXA 2PJTA 1QIBA 2RTSA 3O64A 1Y0VA 4NZ1A 3F15A 4WK7A 1JANA 2Y2OA 4GH9A 4Z2KA 3TS4A 4PKVA 2Z2DA 1GENA 1CAQA 2OXZA 4LL2A 1SLNA 2AYKA 2OXUA 2W13A 4JA1A 1HXNA 4QKZA 4FXYP 5BOTA 4IBKA 1QIAA 1BUVM 1PWPA 3DPEA 1KUHA 2FFFB 1FLSA 4LG2A 3L25A 1MMRA 2JIHA 3EDGA 1JJ9A 4IJEA 2K9CA 2D49A 3DSLA 3WD4A 1D7XA 4WKIA 1CQRA 4A3WA 3HONA 3LE9A 4JQGA 4JP4A 1RMZA 2WO9A 1GXDA 5CZMA 4Z2LA 5I4OA 1ZTQA 3G42A 3WD1A 2XS3A 4GUYA 2HU6A 4NY2A 4ZR5A 4DPEA 2DW2A 1ZVXA 1IAGA 3EDZA 4FXQA 4JPAA 2Y6DA 3KWVC 1CXVA 1EB6A 1JH1A 1AKLA 3CKIA 1KAPP 1UR8A 1OM6A 4L7AA 1FBLA 1XM5A 1USNA 3DPFA 2OXWA 4IJFA 3N3FA 2J83A 1ZXCA 3OYOA 1SLMA 1YCMA 1RM8A 1ATLA 5I3MA 3LKAA 3USNA 2E3XA 4GHLA 2WO8A 4H76A 3V96B 5JMYA 1QUAA 3UVCA 1HFSA 3AYUA 2X3AA 4IBJA 1E6ZA 3K7NA 4L19A 1E88A 3EHYA 2KRJA 5H8XA 1YOUA 1G9KA 1R54A 1D8FA 4WZVA 1W1PA 1KUGA 2XD5A 1IAEA 3F1AA 2OZRA 4GR0A 1H71P 1EAKA 4IBBA 4OJPA 3DNGA 1E6PA 3TVCA 1E8BA 2Y2GA 1G12A 4AUOA 3Q2GA 2BG1A 3L28A 1CGFA 1GO7P 4OJLA 1BZSA 1JAOA 1BUDA 2MLRA 4FVLA 4G0DA 4H1QA 3HDAP 2L0RA 1OMJA 1AF0A 4L6TA 1BSWA 4DD8A 2Y2JA 1J7MA 1W1VA 2W12A 2MZHA 3L0VA 1QJIA 1OGGA 4XCTA 1XUCA 456CA 1IACA 2IOUA 1XUDA 1MMPA 4IBIA 2Y2PA 1ZXVA 2W0DA 2FN2A 3KEJA 1K7QA 4XBHA 1PWQA 2JT6A 4GR3A 3KMEA 2Y2IA 3EWJA 4OJ5A 1OS9A 1G49A 1MNCA 1E6RA 2DW1A 3LQ0A 830CA 5I2ZA 1PEXA 1UEAA 1JAQA 1FM1A 4JIJA 1GPFA 1ROSA 3LEAA 3FKEA 2JE5A 4R3VA 3RTTA 3LIKA 3B92A 2POJA 2J0TA 4H3XA 4IBDA 4IN9A 1HV5A 3KHIA 1O0TA 2OW0A 1PWWA 3LP9A 2Y2LA 1MMBA 1A85A 2Y2QA 1R55A 2RJQA 1XFXA 3HSHA 5LABA 1PWVA 3Q2HA 1XURA 1H8PA 3EDHA 4GHAA 4IUWA 4AIGA 3MQLA 1IABA 1W1YA 2ERQA 1GO8P 1D8MA 4GR8A 2V5OA 1OM8A 2RJPA 4DV8A 1HY7A 3VTGA 2MZEA 2W15A 2OW9A 3WV1A 4GWMA 3WV3A 1G4KA 1QO6A 3WX7A 3WD3A 2Y2NA 2TCLA 4WKEA 3LJTA 1XFZA 3S18A 1UMTA 4XM6A 1L6JA 1O0QA 1OGBA 1AYKA 4Z2HA 4HMEA 3I7IA 1RTGA 1XFVA 4IBFA 3LK8A 3E8RA 3HDBA 3DTIA 4AXQA 3OHOA 1UTZA 5BPVA 1KS0A 5D1TA 3F17A 3KS4A 1YQYA 3F16A 4EFSA 5CXAA 1YU2A 1R1JA 4FU4A 2CLTA 1DTHA 2XS4A 1ED7A 1PWUA 4HMCA 1ZP5A 3DTEA 1YU4A 1SMPA 3ELMA 1UR9A 3U1RA 1OM7A 2OI0A 4GWNA 1XFWA 2CKIA 3K7LA 1QICA 4PKUA 3L2AA 4IJOA 4OJ6A 1C7KA 1ZS0A 3KECA 1H0IA 1BKCI 3HY9A 4H84A 1O6IA 4Z2IA 4GQLA 1MMQA 3KMCA 2OVXA 1GKCA 1Y8JA 4MB4A 3HBUP 3LUMA 4XM8A 3RTSA 1CGEA 1YU0A 1BKCA 2X7MA 3DL1A 4IBCA 3N2UA 3WV2A 3WD2A 3MA2A 2N8RA 4PKRA 2DW0A 4PKQA 2UWXA 2XD1A 1YUEA 3N2VA 3VI1A 1A86A 2EROA 3LILA 3DTKA 1R1HA 3SHIA 1C3IA 4PKTA 1K7IA 3L26A 5CUHA 5I12A 1HTDA 1CK7A 2Y6CA 3G5CA 2DDYA 2OW2A 1DMTA 2X3CA
chains in the Genus database with same CATH topology
1PDCA 3LUNA 1C8TA 2D1OA 2OY2A 2K2GA 3DWBA 3LIRA 4A7BA 1B8YA 4XM7A 1R1IA 1BQOA 3M7PA 3V6NA 1JK3A 1OS2A 4HX3A 3KEKA 1QHUA 1SU3A 1JIZA 3F19A 2USNA 5D2BA 2OY4A 4H82A 1CXWA 1Q3AA 3B2ZA 5BOYA 4YEHA 5B5PA 1KUIA 1ASTA 5BPAA 966CA 1B3DA 3O2XA 1CGLA 5D1UA 3EHXA 1S4BP 1GE5A 5D1SA 1YP1A 1IAAA 1QJJA 2YB9A 4CTHA 3I7GA 3LJZA 3P1VA 2FV9A 3HBVP 1SATA 4ILWD 1IADA 4PKSA 1QJSA 1G05A 2OVZA 3HY7A 3TT4A 3F18A 1ITVA 2E2DA 2MLSA 4PKWA 2JXYA 3LMCA 1I73A 3AIGA 3AYKA 3TSKA 1BKCE 3KRYA 4H30A 1UTTA 3LGPA 5L79A 2YIGA 2JSDA 2WOAA 1JIWP 3BA0A 4RT6B 2JT5A 1XFYA 1WNIA 4ON1A 5I43A 3ZUKA 1XFUA 2DDFA 1Y93A 1I1IP 2ERPA 3LQBA 2D1NA 1BQQM 4DF9A 1OO9A 3EDIA 2JNPA 4GF1A 3HYGA 1JAPA 1GKDA 2QPJA 4H2EA 2O36A 2X3BA 1EUBA 1JKYA 2W14A 5B5OA 4HMAA 1HFCA 1BM6A 1GE6A 4L63A 2I47A 2SRTA 1KUFA 1D5JA 1BIWA 4I03A 2O3EA 1SRPA 5I0LA 1KBCA 1I76A 1HOVA 1K7GA 1CIZA 2MQSA 2FV5A 4OEIA 4J4MA 5D3CA 2MZIA 4H49A 4Q1LA 1GE7A 3B8ZA 1UMSA 3HB2P 3OHLA 1ND1A 3P24A 4AYKA 4I35A 1KUKA 2AIGP 5L7FA 3ZVSA 3GBOA 3LJGA 2V4BA 2A8HA 5D7WA 3C7XA 1Z3JA 1J7NA 2OW1A 3NX7A 4G9LA 4WF6A 2YUFA 3ZXHA 3L0TA 4HSDA 2PJTA 1QIBA 3O64A 1Y0VA 3F15A 4WK7A 1JANA 3TS4A 4PKVA 2Z2DA 1GENA 1CAQA 2OXZA 4LL2A 1SLNA 2AYKA 2OXUA 2W13A 4JA1A 1HXNA 4QKZA 4FXYP 5BOTA 1QIAA 1BUVM 1PWPA 3DPEA 1KUHA 1FLSA 1MMRA 2JIHA 3EDGA 1JJ9A 2K9CA 3DSLA 1D7XA 4WKIA 1CQRA 4A3WA 3LE9A 4JQGA 4JP4A 1RMZA 2WO9A 1GXDA 5CZMA 5I4OA 1ZTQA 3G42A 2XS3A 4GUYA 2HU6A 4ZR5A 4DPEA 2DW2A 1ZVXA 1IAGA 3EDZA 4FXQA 4JPAA 2Y6DA 3KWVC 1CXVA 1EB6A 1JH1A 1AKLA 3CKIA 1KAPP 1OM6A 4L7AA 1FBLA 1USNA 3DPFA 2OXWA 2J83A 1ZXCA 3OYOA 1SLMA 1YCMA 1RM8A 1ATLA 5I3MA 3LKAA 3USNA 2E3XA 2WO8A 4H76A 3V96B 5JMYA 1QUAA 3UVCA 1HFSA 3AYUA 2X3AA 3K7NA 4L19A 1E88A 3EHYA 2KRJA 5H8XA 1YOUA 1G9KA 1R54A 1D8FA 4WZVA 1KUGA 1IAEA 3F1AA 2OZRA 4GR0A 1H71P 1EAKA 3DNGA 3TVCA 1E8BA 1G12A 4AUOA 3Q2GA 1CGFA 1GO7P 1BZSA 1JAOA 1BUDA 2MLRA 4FVLA 4G0DA 4H1QA 3HDAP 2L0RA 1OMJA 1AF0A 4L6TA 1BSWA 4DD8A 1J7MA 2W12A 2MZHA 3L0VA 1QJIA 4XCTA 1XUCA 456CA 1IACA 1XUDA 1MMPA 1ZXVA 2W0DA 2FN2A 3KEJA 1K7QA 4XBHA 1PWQA 2JT6A 4GR3A 3KMEA 3EWJA 1OS9A 1G49A 1MNCA 830CA 2DW1A 3LQ0A 5I2ZA 1PEXA 1UEAA 1JAQA 1FM1A 4JIJA 1ROSA 3LEAA 4R3VA 3RTTA 3LIKA 3B92A 2POJA 2J0TA 4H3XA 4IN9A 1HV5A 3KHIA 1O0TA 2OW0A 1PWWA 3LP9A 1MMBA 1A85A 1R55A 2RJQA 1XFXA 5LABA 1PWVA 3Q2HA 1XURA 1H8PA 3EDHA 4IUWA 4AIGA 3MQLA 1IABA 2ERQA 1GO8P 1D8MA 4GR8A 2V5OA 1OM8A 2RJPA 4DV8A 1HY7A 3VTGA 2MZEA 2W15A 2OW9A 3WV1A 4GWMA 3WV3A 1G4KA 1QO6A 2TCLA 4WKEA 3LJTA 1XFZA 3S18A 1UMTA 4XM6A 1L6JA 1O0QA 1AYKA 3I7IA 1RTGA 1XFVA 3LK8A 3E8RA 3HDBA 3DTIA 4AXQA 3OHOA 1UTZA 1KS0A 5D1TA 3F17A 1YQYA 3F16A 4EFSA 5CXAA 1R1JA 4FU4A 2CLTA 1DTHA 2XS4A 1PWUA 1ZP5A 3DTEA 1SMPA 3ELMA 3U1RA 1OM7A 2OI0A 4GWNA 1XFWA 2CKIA 3K7LA 1QICA 4PKUA 4IJOA 1C7KA 1ZS0A 3KECA 1BKCI 3HY9A 4H84A 4GQLA 1MMQA 3KMCA 2OVXA 1GKCA 1Y8JA 3HBUP 3LUMA 4XM8A 3RTSA 1CGEA 1BKCA 2X7MA 3DL1A 3N2UA 3WV2A 3MA2A 2N8RA 4PKRA 2DW0A 4PKQA 3N2VA 3VI1A 1A86A 2EROA 3LILA 3DTKA 1R1HA 3SHIA 1C3IA 4PKTA 1K7IA 5CUHA 5I12A 1HTDA 1CK7A 2Y6CA 3G5CA 2DDYA 2OW2A 1DMTA 2X3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDC A;  3LUN A;  1C8T A;  2D1O A;  2OY2 A;  2K2G A;  3DWB A;  3LIR A;  4A7B A;  1B8Y A;  4XM7 A;  1R1I A;  1BQO A;  3M7P A;  3V6N A;  1JK3 A;  1OS2 A;  4HX3 A;  3KEK A;  1QHU A;  1SU3 A;  1JIZ A;  3F19 A;  2USN A;  5D2B A;  2OY4 A;  4H82 A;  1CXW A;  1Q3A A;  3B2Z A;  5BOY A;  4YEH A;  5B5P A;  1KUI A;  1AST A;  5BPA A;  966C A;  1B3D A;  3O2X A;  1CGL A;  5D1U A;  3EHX A;  1S4B P;  1GE5 A;  5D1S A;  1YP1 A;  1IAA A;  1QJJ A;  2YB9 A;  4CTH A;  3I7G A;  3LJZ A;  3P1V A;  2FV9 A;  3HBV P;  1SAT A;  4ILW D;  1IAD A;  4PKS A;  1QJS A;  1G05 A;  2OVZ A;  3HY7 A;  3TT4 A;  3F18 A;  1ITV A;  2E2D A;  2MLS A;  4PKW A;  2JXY A;  3LMC A;  1I73 A;  3AIG A;  3AYK A;  3TSK A;  1BKC E;  3KRY A;  4H30 A;  1UTT A;  3LGP A;  5L79 A;  2YIG A;  2JSD A;  2WOA A;  1JIW P;  3BA0 A;  4RT6 B;  2JT5 A;  1XFY A;  1WNI A;  4ON1 A;  5I43 A;  3ZUK A;  1XFU A;  2DDF A;  1Y93 A;  1I1I P;  2ERP A;  3LQB A;  2D1N A;  1BQQ M;  4DF9 A;  1OO9 A;  3EDI A;  2JNP A;  4GF1 A;  3HYG A;  1JAP A;  1GKD A;  2QPJ A;  4H2E A;  2O36 A;  2X3B A;  1EUB A;  1JKY A;  2W14 A;  5B5O A;  4HMA A;  1HFC A;  1BM6 A;  1GE6 A;  4L63 A;  2I47 A;  2SRT A;  1KUF A;  1D5J A;  1BIW A;  4I03 A;  2O3E A;  1SRP A;  5I0L A;  1KBC A;  1I76 A;  1HOV A;  1K7G A;  1CIZ A;  2MQS A;  2FV5 A;  4OEI A;  4J4M A;  5D3C A;  2MZI A;  4H49 A;  4Q1L A;  1GE7 A;  3B8Z A;  1UMS A;  3HB2 P;  3OHL A;  1ND1 A;  3P24 A;  4AYK A;  4I35 A;  1KUK A;  2AIG P;  5L7F A;  3ZVS A;  3GBO A;  3LJG A;  2V4B A;  2A8H A;  5D7W A;  3C7X A;  1Z3J A;  1J7N A;  2OW1 A;  3NX7 A;  4G9L A;  4WF6 A;  3ZXH A;  3L0T A;  4HSD A;  2PJT A;  1QIB A;  3O64 A;  1Y0V A;  3F15 A;  4WK7 A;  1JAN A;  3TS4 A;  4PKV A;  2Z2D A;  1GEN A;  1CAQ A;  2OXZ A;  4LL2 A;  1SLN A;  2AYK A;  2OXU A;  2W13 A;  4JA1 A;  1HXN A;  4QKZ A;  4FXY P;  5BOT A;  1QIA A;  1BUV M;  1PWP A;  3DPE A;  1KUH A;  1FLS A;  1MMR A;  2JIH A;  3EDG A;  1JJ9 A;  2K9C A;  3DSL A;  1D7X A;  4WKI A;  1CQR A;  4A3W A;  3LE9 A;  4JQG A;  4JP4 A;  1RMZ A;  2WO9 A;  1GXD A;  5CZM A;  5I4O A;  1ZTQ A;  3G42 A;  2XS3 A;  4GUY A;  2HU6 A;  4ZR5 A;  4DPE A;  2DW2 A;  1ZVX A;  1IAG A;  3EDZ A;  4FXQ A;  4JPA A;  2Y6D A;  3KWV C;  1CXV A;  1EB6 A;  1JH1 A;  1AKL A;  3CKI A;  1KAP P;  1OM6 A;  1FBL A;  1USN A;  3DPF A;  2OXW A;  2J83 A;  1ZXC A;  3OYO A;  1SLM A;  1YCM A;  1RM8 A;  1ATL A;  5I3M A;  3LKA A;  3USN A;  2E3X A;  2WO8 A;  4H76 A;  3V96 B;  5JMY A;  1QUA A;  3UVC A;  1HFS A;  3AYU A;  2X3A A;  3K7N A;  4L19 A;  1E88 A;  3EHY A;  2KRJ A;  5H8X A;  1YOU A;  1G9K A;  1R54 A;  1D8F A;  4WZV A;  1KUG A;  1IAE A;  3F1A A;  2OZR A;  4GR0 A;  1H71 P;  1EAK A;  3DNG A;  3TVC A;  1E8B A;  1G12 A;  4AUO A;  3Q2G A;  1CGF A;  1GO7 P;  1BZS A;  1JAO A;  1BUD A;  2MLR A;  4FVL A;  4G0D A;  4H1Q A;  3HDA P;  2L0R A;  1OMJ A;  1AF0 A;  4L6T A;  1BSW A;  4DD8 A;  1J7M A;  2W12 A;  2MZH A;  3L0V A;  1QJI A;  4XCT A;  1XUC A;  456C A;  1IAC A;  1XUD A;  1MMP A;  1ZXV A;  2W0D A;  2FN2 A;  3KEJ A;  1K7Q A;  4XBH A;  1PWQ A;  2JT6 A;  4GR3 A;  3KME A;  3EWJ A;  1OS9 A;  1G49 A;  1MNC A;  830C A;  2DW1 A;  3LQ0 A;  5I2Z A;  1PEX A;  1UEA A;  1JAQ A;  1FM1 A;  4JIJ A;  1ROS A;  3LEA A;  4R3V A;  3RTT A;  3LIK A;  3B92 A;  2POJ A;  2J0T A;  4H3X A;  4IN9 A;  1HV5 A;  3KHI A;  1O0T A;  2OW0 A;  1PWW A;  3LP9 A;  1MMB A;  1A85 A;  1R55 A;  2RJQ A;  1XFX A;  5LAB A;  1PWV A;  3Q2H A;  1XUR A;  1H8P A;  3EDH A;  4IUW A;  4AIG A;  3MQL A;  1IAB A;  2ERQ A;  1GO8 P;  1D8M A;  4GR8 A;  2V5O A;  1OM8 A;  2RJP A;  4DV8 A;  1HY7 A;  3VTG A;  2MZE A;  2W15 A;  2OW9 A;  3WV1 A;  4GWM A;  3WV3 A;  1G4K A;  1QO6 A;  2TCL A;  4WKE A;  3LJT A;  1XFZ A;  3S18 A;  1UMT A;  4XM6 A;  1L6J A;  1O0Q A;  1AYK A;  3I7I A;  1RTG A;  1XFV A;  3LK8 A;  3E8R A;  3HDB A;  4AXQ A;  3OHO A;  1UTZ A;  1KS0 A;  5D1T A;  3F17 A;  1YQY A;  3F16 A;  4EFS A;  5CXA A;  1R1J A;  4FU4 A;  2CLT A;  1DTH A;  2XS4 A;  1PWU A;  1ZP5 A;  1SMP A;  3ELM A;  3U1R A;  1OM7 A;  2OI0 A;  4GWN A;  1XFW A;  2CKI A;  3K7L A;  1QIC A;  4PKU A;  4IJO A;  1C7K A;  1ZS0 A;  3KEC A;  1BKC I;  3HY9 A;  4H84 A;  4GQL A;  1MMQ A;  3KMC A;  2OVX A;  1GKC A;  1Y8J A;  3HBU P;  3LUM A;  4XM8 A;  3RTS A;  1CGE A;  1BKC A;  2X7M A;  3DL1 A;  3N2U A;  3WV2 A;  3MA2 A;  2N8R A;  4PKR A;  2DW0 A;  4PKQ A;  3N2V A;  3VI1 A;  1A86 A;  2ERO A;  3LIL A;  1R1H A;  3SHI A;  1C3I A;  4PKT A;  1K7I A;  5CUH A;  5I12 A;  1HTD A;  1CK7 A;  2Y6C A;  3G5C A;  2DDY A;  2OW2 A;  1DMT A;  2X3C A; 
#chains in the Genus database with same CATH topology
 1PDC A;  3LUN A;  1C8T A;  2D1O A;  2OY2 A;  2K2G A;  3DWB A;  3LIR A;  4A7B A;  1B8Y A;  4XM7 A;  1R1I A;  1BQO A;  3M7P A;  3V6N A;  1JK3 A;  1OS2 A;  4HX3 A;  3KEK A;  1QHU A;  1SU3 A;  1JIZ A;  3F19 A;  2JCH A;  2USN A;  5D2B A;  1AIW A;  2OY4 A;  4H82 A;  1CXW A;  1H0G A;  1Q3A A;  3B2Z A;  1YU3 A;  5BOY A;  4YEH A;  5B5P A;  1KUI A;  1AST A;  5BPA A;  966C A;  1B3D A;  3O2X A;  1CGL A;  5D1U A;  3EHX A;  1S4B P;  4NZ3 A;  1GE5 A;  2Y2M A;  4HMD A;  5D1S A;  3L29 A;  1YP1 A;  1IAA A;  1QJJ A;  2Y2K A;  2YB9 A;  1W1T A;  3KS8 A;  4CTH A;  4MB3 A;  3L27 A;  3I7G A;  3LJZ A;  3P1V A;  2FV9 A;  3HBV P;  4OUI A;  1SAT A;  4ILW D;  1IAD A;  4PKS A;  1QJS A;  1G05 A;  2OVZ A;  3HY7 A;  3TT4 A;  3F18 A;  1ITV A;  2E2D A;  2MLS A;  4PKW A;  2JXY A;  3LMC A;  1I73 A;  3AIG A;  4NZ5 A;  3AYK A;  3TSK A;  1BKC E;  3KRY A;  4H30 A;  4Z2J A;  1UTT A;  3WD0 A;  3LGP A;  5L79 A;  1OZ9 A;  2YIG A;  2JSD A;  2WOA A;  1JIW P;  3BA0 A;  4RT6 B;  2JT5 A;  1XFY A;  1WNI A;  4ON1 A;  5I43 A;  4NYU A;  3ZUK A;  1XFU A;  2DDF A;  1E15 A;  4Z2G A;  1Y93 A;  4NZ4 A;  1I1I P;  2ERP A;  3LQB A;  2D1N A;  1BQQ M;  4DF9 A;  1OO9 A;  3EDI A;  2JNP A;  4GF1 A;  3HYG A;  1JAP A;  4MB5 A;  1GKD A;  2QPJ A;  4H2E A;  2O36 A;  2X3B A;  1EUB A;  1JKY A;  2W14 A;  5B5O A;  4HMA A;  1HFC A;  1BM6 A;  1E6N A;  4IBG A;  1GE6 A;  4IBE A;  2I47 A;  2SRT A;  4L63 A;  1GOI A;  1KUF A;  2Y2H A;  1D5J A;  1BIW A;  4I03 A;  2O3E A;  1SRP A;  5I0L A;  1TVI A;  4OJO A;  1KBC A;  1I76 A;  1HOV A;  4QNL A;  1K7G A;  1CIZ A;  2MQS A;  2FV5 A;  4OEI A;  4J4M A;  5D3C A;  4NYY A;  2MZI A;  4H49 A;  4Q1L A;  1GE7 A;  3B8Z A;  1UMS A;  3HB2 P;  3OHL A;  1ND1 A;  3P24 A;  4AYK A;  4I35 A;  1KUK A;  2AIG P;  5L7F A;  3ZVS A;  3GBO A;  3LJG A;  2V4B A;  2A8H A;  5D7W A;  3C7X A;  4TX8 A;  1Z3J A;  1J7N A;  2OW1 A;  1YU1 A;  3NX7 A;  4G9L A;  2YUF A;  4WF6 A;  3ZXH A;  3L0T A;  4HSD A;  1XAX A;  2PJT A;  1QIB A;  2RTS A;  3O64 A;  1Y0V A;  4NZ1 A;  3F15 A;  4WK7 A;  1JAN A;  2Y2O A;  4GH9 A;  4Z2K A;  3TS4 A;  4PKV A;  2Z2D A;  1GEN A;  1CAQ A;  2OXZ A;  4LL2 A;  1SLN A;  2AYK A;  2OXU A;  2W13 A;  4JA1 A;  1HXN A;  4QKZ A;  4FXY P;  5BOT A;  4IBK A;  1QIA A;  1BUV M;  1PWP A;  3DPE A;  1KUH A;  2FFF B;  1FLS A;  4LG2 A;  3L25 A;  1MMR A;  2JIH A;  3EDG A;  1JJ9 A;  4IJE A;  2K9C A;  2D49 A;  3DSL A;  3WD4 A;  1D7X A;  4WKI A;  1CQR A;  4A3W A;  3HON A;  3LE9 A;  4JQG A;  4JP4 A;  1RMZ A;  2WO9 A;  1GXD A;  5CZM A;  4Z2L A;  5I4O A;  1ZTQ A;  3G42 A;  3WD1 A;  2XS3 A;  4GUY A;  2HU6 A;  4NY2 A;  4ZR5 A;  4DPE A;  2DW2 A;  1ZVX A;  1IAG A;  3EDZ A;  4FXQ A;  4JPA A;  2Y6D A;  3KWV C;  1CXV A;  1EB6 A;  1JH1 A;  1AKL A;  3CKI A;  1KAP P;  1UR8 A;  1OM6 A;  4L7A A;  1FBL A;  1XM5 A;  1USN A;  3DPF A;  2OXW A;  4IJF A;  3N3F A;  2J83 A;  1ZXC A;  3OYO A;  1SLM A;  1YCM A;  1RM8 A;  1ATL A;  5I3M A;  3LKA A;  3USN A;  2E3X A;  4GHL A;  2WO8 A;  4H76 A;  3V96 B;  5JMY A;  1QUA A;  3UVC A;  1HFS A;  3AYU A;  2X3A A;  4IBJ A;  1E6Z A;  3K7N A;  4L19 A;  1E88 A;  3EHY A;  2KRJ A;  5H8X A;  1YOU A;  1G9K A;  1R54 A;  1D8F A;  4WZV A;  1W1P A;  1KUG A;  2XD5 A;  1IAE A;  3F1A A;  2OZR A;  4GR0 A;  1H71 P;  1EAK A;  4IBB A;  4OJP A;  3DNG A;  1E6P A;  3TVC A;  1E8B A;  2Y2G A;  1G12 A;  4AUO A;  3Q2G A;  2BG1 A;  3L28 A;  1CGF A;  1GO7 P;  4OJL A;  1BZS A;  1JAO A;  1BUD A;  2MLR A;  4FVL A;  4G0D A;  4H1Q A;  3HDA P;  2L0R A;  1OMJ A;  1AF0 A;  4L6T A;  1BSW A;  4DD8 A;  2Y2J A;  1J7M A;  1W1V A;  2W12 A;  2MZH A;  3L0V A;  1QJI A;  1OGG A;  4XCT A;  1XUC A;  456C A;  1IAC A;  2IOU A;  1XUD A;  1MMP A;  4IBI A;  2Y2P A;  1ZXV A;  2W0D A;  2FN2 A;  3KEJ A;  1K7Q A;  4XBH A;  1PWQ A;  2JT6 A;  4GR3 A;  3KME A;  2Y2I A;  3EWJ A;  4OJ5 A;  1OS9 A;  1G49 A;  1MNC A;  1E6R A;  2DW1 A;  3LQ0 A;  830C A;  5I2Z A;  1PEX A;  1UEA A;  1JAQ A;  1FM1 A;  4JIJ A;  1GPF A;  1ROS A;  3LEA A;  3FKE A;  2JE5 A;  4R3V A;  3RTT A;  3LIK A;  3B92 A;  2POJ A;  2J0T A;  4H3X A;  4IBD A;  4IN9 A;  1HV5 A;  3KHI A;  1O0T A;  2OW0 A;  1PWW A;  3LP9 A;  2Y2L A;  1MMB A;  1A85 A;  2Y2Q A;  1R55 A;  2RJQ A;  1XFX A;  3HSH A;  5LAB A;  1PWV A;  3Q2H A;  1XUR A;  1H8P A;  3EDH A;  4GHA A;  4IUW A;  4AIG A;  3MQL A;  1IAB A;  1W1Y A;  2ERQ A;  1GO8 P;  1D8M A;  4GR8 A;  2V5O A;  1OM8 A;  2RJP A;  4DV8 A;  1HY7 A;  3VTG A;  2MZE A;  2W15 A;  2OW9 A;  3WV1 A;  4GWM A;  3WV3 A;  1G4K A;  1QO6 A;  3WX7 A;  3WD3 A;  2Y2N A;  2TCL A;  4WKE A;  3LJT A;  1XFZ A;  3S18 A;  1UMT A;  4XM6 A;  1L6J A;  1O0Q A;  1OGB A;  1AYK A;  4Z2H A;  4HME A;  3I7I A;  1RTG A;  1XFV A;  4IBF A;  3LK8 A;  3E8R A;  3HDB A;  3DTI A;  4AXQ A;  3OHO A;  1UTZ A;  5BPV A;  1KS0 A;  5D1T A;  3F17 A;  3KS4 A;  1YQY A;  3F16 A;  4EFS A;  5CXA A;  1YU2 A;  1R1J A;  4FU4 A;  2CLT A;  1DTH A;  2XS4 A;  1ED7 A;  1PWU A;  4HMC A;  1ZP5 A;  3DTE A;  1YU4 A;  1SMP A;  3ELM A;  1UR9 A;  3U1R A;  1OM7 A;  2OI0 A;  4GWN A;  1XFW A;  2CKI A;  3K7L A;  1QIC A;  4PKU A;  3L2A A;  4IJO A;  4OJ6 A;  1C7K A;  1ZS0 A;  3KEC A;  1H0I A;  1BKC I;  3HY9 A;  4H84 A;  1O6I A;  4Z2I A;  4GQL A;  1MMQ A;  3KMC A;  2OVX A;  1GKC A;  1Y8J A;  4MB4 A;  3HBU P;  3LUM A;  4XM8 A;  3RTS A;  1CGE A;  1YU0 A;  1BKC A;  2X7M A;  3DL1 A;  4IBC A;  3N2U A;  3WV2 A;  3WD2 A;  3MA2 A;  2N8R A;  4PKR A;  2DW0 A;  4PKQ A;  2UWX A;  2XD1 A;  1YUE A;  3N2V A;  3VI1 A;  1A86 A;  2ERO A;  3LIL A;  3DTK A;  1R1H A;  3SHI A;  1C3I A;  4PKT A;  1K7I A;  3L26 A;  5CUH A;  5I12 A;  1HTD A;  1CK7 A;  2Y6C A;  3G5C A;  2DDY A;  2OW2 A;  1DMT A;  2X3C A; 
#chains in the Genus database with same CATH homology
 1PDC A;  3LUN A;  1C8T A;  2D1O A;  2OY2 A;  2K2G A;  3DWB A;  3LIR A;  4A7B A;  1B8Y A;  4XM7 A;  1R1I A;  1BQO A;  3M7P A;  3V6N A;  1JK3 A;  1OS2 A;  4HX3 A;  3KEK A;  1QHU A;  1SU3 A;  1JIZ A;  3F19 A;  2USN A;  5D2B A;  2OY4 A;  4H82 A;  1CXW A;  1Q3A A;  3B2Z A;  5BOY A;  4YEH A;  5B5P A;  1KUI A;  1AST A;  5BPA A;  966C A;  1B3D A;  3O2X A;  1CGL A;  5D1U A;  3EHX A;  1S4B P;  1GE5 A;  5D1S A;  1YP1 A;  1IAA A;  1QJJ A;  2YB9 A;  4CTH A;  3I7G A;  3LJZ A;  3P1V A;  2FV9 A;  3HBV P;  1SAT A;  4ILW D;  1IAD A;  4PKS A;  1QJS A;  1G05 A;  2OVZ A;  3HY7 A;  3TT4 A;  3F18 A;  1ITV A;  2E2D A;  2MLS A;  4PKW A;  2JXY A;  3LMC A;  1I73 A;  3AIG A;  3AYK A;  3TSK A;  1BKC E;  3KRY A;  4H30 A;  1UTT A;  3LGP A;  5L79 A;  2YIG A;  2JSD A;  2WOA A;  1JIW P;  3BA0 A;  4RT6 B;  2JT5 A;  1XFY A;  1WNI A;  4ON1 A;  5I43 A;  3ZUK A;  1XFU A;  2DDF A;  1Y93 A;  1I1I P;  2ERP A;  3LQB A;  2D1N A;  1BQQ M;  4DF9 A;  1OO9 A;  3EDI A;  2JNP A;  4GF1 A;  3HYG A;  1JAP A;  1GKD A;  2QPJ A;  4H2E A;  2O36 A;  2X3B A;  1EUB A;  1JKY A;  2W14 A;  5B5O A;  4HMA A;  1HFC A;  1BM6 A;  1GE6 A;  4L63 A;  2I47 A;  2SRT A;  1KUF A;  1D5J A;  1BIW A;  4I03 A;  2O3E A;  1SRP A;  5I0L A;  1KBC A;  1I76 A;  1HOV A;  1K7G A;  1CIZ A;  2MQS A;  2FV5 A;  4OEI A;  4J4M A;  5D3C A;  2MZI A;  4H49 A;  4Q1L A;  1GE7 A;  3B8Z A;  1UMS A;  3HB2 P;  3OHL A;  1ND1 A;  3P24 A;  4AYK A;  4I35 A;  1KUK A;  2AIG P;  5L7F A;  3ZVS A;  3GBO A;  3LJG A;  2V4B A;  2A8H A;  5D7W A;  3C7X A;  1Z3J A;  1J7N A;  2OW1 A;  3NX7 A;  4G9L A;  4WF6 A;  2YUF A;  3ZXH A;  3L0T A;  4HSD A;  2PJT A;  1QIB A;  3O64 A;  1Y0V A;  3F15 A;  4WK7 A;  1JAN A;  3TS4 A;  4PKV A;  2Z2D A;  1GEN A;  1CAQ A;  2OXZ A;  4LL2 A;  1SLN A;  2AYK A;  2OXU A;  2W13 A;  4JA1 A;  1HXN A;  4QKZ A;  4FXY P;  5BOT A;  1QIA A;  1BUV M;  1PWP A;  3DPE A;  1KUH A;  1FLS A;  1MMR A;  2JIH A;  3EDG A;  1JJ9 A;  2K9C A;  3DSL A;  1D7X A;  4WKI A;  1CQR A;  4A3W A;  3LE9 A;  4JQG A;  4JP4 A;  1RMZ A;  2WO9 A;  1GXD A;  5CZM A;  5I4O A;  1ZTQ A;  3G42 A;  2XS3 A;  4GUY A;  2HU6 A;  4ZR5 A;  4DPE A;  2DW2 A;  1ZVX A;  1IAG A;  3EDZ A;  4FXQ A;  4JPA A;  2Y6D A;  3KWV C;  1CXV A;  1EB6 A;  1JH1 A;  1AKL A;  3CKI A;  1KAP P;  1OM6 A;  4L7A A;  1FBL A;  1USN A;  3DPF A;  2OXW A;  2J83 A;  1ZXC A;  3OYO A;  1SLM A;  1YCM A;  1RM8 A;  1ATL A;  5I3M A;  3LKA A;  3USN A;  2E3X A;  2WO8 A;  4H76 A;  3V96 B;  5JMY A;  1QUA A;  3UVC A;  1HFS A;  3AYU A;  2X3A A;  3K7N A;  4L19 A;  1E88 A;  3EHY A;  2KRJ A;  5H8X A;  1YOU A;  1G9K A;  1R54 A;  1D8F A;  4WZV A;  1KUG A;  1IAE A;  3F1A A;  2OZR A;  4GR0 A;  1H71 P;  1EAK A;  3DNG A;  3TVC A;  1E8B A;  1G12 A;  4AUO A;  3Q2G A;  1CGF A;  1GO7 P;  1BZS A;  1JAO A;  1BUD A;  2MLR A;  4FVL A;  4G0D A;  4H1Q A;  3HDA P;  2L0R A;  1OMJ A;  1AF0 A;  4L6T A;  1BSW A;  4DD8 A;  1J7M A;  2W12 A;  2MZH A;  3L0V A;  1QJI A;  4XCT A;  1XUC A;  456C A;  1IAC A;  1XUD A;  1MMP A;  1ZXV A;  2W0D A;  2FN2 A;  3KEJ A;  1K7Q A;  4XBH A;  1PWQ A;  2JT6 A;  4GR3 A;  3KME A;  3EWJ A;  1OS9 A;  1G49 A;  1MNC A;  830C A;  2DW1 A;  3LQ0 A;  5I2Z A;  1PEX A;  1UEA A;  1JAQ A;  1FM1 A;  4JIJ A;  1ROS A;  3LEA A;  4R3V A;  3RTT A;  3LIK A;  3B92 A;  2POJ A;  2J0T A;  4H3X A;  4IN9 A;  1HV5 A;  3KHI A;  1O0T A;  2OW0 A;  1PWW A;  3LP9 A;  1MMB A;  1A85 A;  1R55 A;  2RJQ A;  1XFX A;  5LAB A;  1PWV A;  3Q2H A;  1XUR A;  1H8P A;  3EDH A;  4IUW A;  4AIG A;  3MQL A;  1IAB A;  2ERQ A;  1GO8 P;  1D8M A;  4GR8 A;  2V5O A;  1OM8 A;  2RJP A;  4DV8 A;  1HY7 A;  3VTG A;  2MZE A;  2W15 A;  2OW9 A;  3WV1 A;  4GWM A;  3WV3 A;  1G4K A;  1QO6 A;  2TCL A;  4WKE A;  3LJT A;  1XFZ A;  3S18 A;  1UMT A;  4XM6 A;  1L6J A;  1O0Q A;  1AYK A;  3I7I A;  1RTG A;  1XFV A;  3LK8 A;  3E8R A;  3HDB A;  3DTI A;  4AXQ A;  3OHO A;  1UTZ A;  1KS0 A;  5D1T A;  3F17 A;  1YQY A;  3F16 A;  4EFS A;  5CXA A;  1R1J A;  4FU4 A;  2CLT A;  1DTH A;  2XS4 A;  1PWU A;  1ZP5 A;  3DTE A;  1SMP A;  3ELM A;  3U1R A;  1OM7 A;  2OI0 A;  4GWN A;  1XFW A;  2CKI A;  3K7L A;  1QIC A;  4PKU A;  4IJO A;  1C7K A;  1ZS0 A;  3KEC A;  1BKC I;  3HY9 A;  4H84 A;  4GQL A;  1MMQ A;  3KMC A;  2OVX A;  1GKC A;  1Y8J A;  3HBU P;  3LUM A;  4XM8 A;  3RTS A;  1CGE A;  1BKC A;  2X7M A;  3DL1 A;  3N2U A;  3WV2 A;  3MA2 A;  2N8R A;  4PKR A;  2DW0 A;  4PKQ A;  3N2V A;  3VI1 A;  1A86 A;  2ERO A;  3LIL A;  3DTK A;  1R1H A;  3SHI A;  1C3I A;  4PKT A;  1K7I A;  5CUH A;  5I12 A;  1HTD A;  1CK7 A;  2Y6C A;  3G5C A;  2DDY A;  2OW2 A;  1DMT A;  2X3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...