1GXDA

Prommp-2/timp-2 complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
631
structure length
624
Chain Sequence
APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 72 KDA TYPE IV COLLAGENASE
publication title Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 115
structure length 624
sequence length 631
chains with identical sequence B
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2002-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1gxdA02
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1gxdA04
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1gxdA03
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 1gxdA05
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1gxdA01
1HOVA 1KUHA 1QUAA 1CAQA 3OYOA 1ROSA 1CXVA 1KS0A 3HY9A 1ND1A 1JJ9A 1D5JA 2K2GA 3S18A 4ZR5A 2JIHA 3L0VA 5L7FA 1CXWA 1C3IA 1C7KA 3F15A 3EDIA 3G42A 1GKDA 1R1IA 4DV8A 3LP9A 1L6JA 1XFVA 3DL1A 3LJGA 1IABA 5D1UA 4A3WA 4FVLA 2JT6A 2KRJA 1GO8P 1G49A 3HDAP 1XFZA 2J83A 2L0RA 1UMSA 2DW1A 1G12A 2O36A 5D1SA 1QJJA 5I0LA 1OM6A 4I35A 2OVXA 3OHLA 4GF1A 2D1OA 4GR3A 1Q3AA 2POJA 2DDFA 1FBLA 1JKYA 1XFUA 4L63A 4DF9A 5JMYA 4R3VA 1E8BA 5BOYA 3C7XA 2FN2A 1SRPA 4ON1A 1XFWA 3UVCA 4WZVA 1I73A 1RTGA 2OW1A 1QIBA 1IACA 2FV5A 3TVCA 3OHOA 3EHYA 2WO8A 1QHUA 1XUCA 2X3CA 3TT4A 3LMCA 3F16A 2W0DA 1O0QA 3LQ0A 1ITVA 1JK3A 2N8RA 1K7IA 1GO7P 2SRTA 4AUOA 3ZVSA 1GE6A 3N2UA 1B8YA 2CKIA 1RM8A 3DNGA 2J0TA 4IUWA 3HBVP 1SATA 1I1IP 3KWVC 3HYGA 2TCLA 2YIGA 2A8HA 4JP4A 5BPAA 1AKLA 1KAPP 4OEIA 2MLSA 2I47A 3KEJA 4XM8A 1HV5A 1BQOA 1IAGA 1K7GA 1UTTA 3HDBA 1J7MA 1QICA 2JNPA 4PKTA 5CXAA 1G9KA 1ZTQA 4FU4A 1XURA 3I7GA 4GWNA 3U1RA 3LIRA 1H8PA 4QKZA 1XUDA 456CA 1KUKA 4L19A 4EFSA 3K7NA 4H76A 1H71P 4GR8A 1JAOA 1KUGA 2OVZA 4PKQA 4FXYP 3M7PA 1YQYA 1IAAA 3LK8A 4AIGA 1G05A 1GKCA 4GQLA 4LL2A 1R1HA 3EDZA 1B3DA 2MZEA 4RT6B 1PWWA 4AYKA 1PWVA 1ZS0A 1BKCA 1BQQM 3O2XA 5I4OA 1QO6A 1HY7A 3P24A 3F18A 2V4BA 5I43A 3SHIA 1A85A 3LEAA 4L6TA 4XM6A 2DW0A 3AIGA 3HB2P 1GE5A 2JT5A 2K9CA 2E3XA 1BKCE 1JIZA 3V96B 3LKAA 3F19A 1Z3JA 3O64A 5BOTA 1XFXA 3KRYA 3P1VA 4G9LA 2W15A 1UEAA 830CA 3F1AA 1PWPA 1YP1A 1JAQA 2DW2A 2QPJA 2X3BA 2X7MA 1GENA 4FXQA 1BUDA 5D7WA 2RJPA 5I12A 1JAPA 2WOAA 1MMPA 4ILWD 4H84A 1AF0A 1RMZA 3LIKA 1JANA 4XM7A 1OO9A 4HX3A 1ZXVA 3DSLA 2E2DA 2D1NA 3ZUKA 2HU6A 3B92A 3TSKA 1PWUA 3HBUP 1QIAA 5LABA 1SLNA 4HMAA 1KUIA 1OM8A 3B8ZA 3K7LA 4H30A 5L79A 3NX7A 3AYUA 2PJTA 2MQSA 1ZP5A 1IAEA 2RJQA 1PWQA 3F17A 3KECA 3EDHA 5I2ZA 3KHIA 1EAKA 3L0TA 1K7QA 3GBOA 1D8FA 3DPEA 1CIZA 4JQGA 1R54A 1ATLA 2MZIA 2OXZA 1I76A 1OMJA 2WO9A 3LUNA 2FV9A 3LJZA 1BUVM 2W13A 4GUYA 3EHXA 1CGLA 4XBHA 1PEXA 4AXQA 4DD8A 5CZMA 3LJTA 1EUBA 1QJSA 2OXWA 2JSDA 3Q2GA 4HSDA 2USNA 1OM7A 4G0DA 1R55A 3KEKA 1DTHA 4PKUA 4A7BA 1USNA 1FM1A 2JXYA 2O3EA 4IJOA 2V5OA 1YOUA 4WKIA 5D1TA 4JIJA 4H2EA 1QJIA 3ZXHA 3N2VA 3LILA 1GE7A 1HXNA 1JIWP 1D7XA 4CTHA 2X3AA 2OY4A 3DWBA 4H1QA 3WV3A 1BIWA 1WNIA 2OI0A 966CA 1YCMA 1Y8JA 5B5PA 3MQLA 1MMQA 2OZRA 1CQRA 4DPEA 2W14A 1MMRA 4I03A 2MLRA 3WV1A 2DDYA 1A86A 5CUHA 3KMEA 3LQBA 3ELMA 2ERQA 2ERPA 4GWMA 1HFSA 4J4MA 1PDCA 1AYKA 1CK7A 2XS4A 4WKEA 2OW0A 1OS2A 4XCTA 1R1JA 1ZVXA 4WK7A 1C8TA 1G4KA 4GR0A 3V6NA 3LUMA 1BZSA 1CGFA 1UMTA 1S4BP 3LGPA 4Q1LA 5H8XA 4H3XA 3BA0A 1MMBA 1Y93A 1BKCI 1HTDA 2CLTA 1KUFA 1BSWA 2EROA 2Y6CA 2AIGP 4IN9A 1IADA 3EWJA 1BM6A 1MNCA 4PKVA 3I7IA 2OXUA 2Z2DA 4PKRA 1FLSA 4H49A 1XFYA 4H82A 1J7NA 1D8MA 3G5CA 2W12A 3Q2HA 3VI1A 3DPFA 4YEHA 3KMCA 5B5OA 2XS3A 3CKIA 4JPAA 1Y0VA 1SU3A 1SMPA 2OW9A 5I3MA 3AYKA 4PKWA 3TS4A 1HFCA 5D3CA 1OS9A 1CGEA 3B2ZA 1JH1A 1SLMA 1UTZA 2OY2A 3E8RA 4JA1A 3RTTA 2MZHA 2OW2A 3HY7A 1O0TA 1EB6A 3RTSA 3WV2A 4WF6A 3USNA 3MA2A 3EDGA 1ASTA 3VTGA 1KBCA 3LE9A 4PKSA 1E88A 1ZXCA 5D2BA 1DMTA 2AYKA 1GXDA 2Y6DA 2YB9A
chains in the Genus database with same CATH superfamily
1HOVA 1KUHA 1QUAA 1CAQA 3OYOA 1ROSA 4NZ1A 4OUIA 1CXVA 1KS0A 3HY9A 1ND1A 1JJ9A 1D5JA 2K2GA 3S18A 4ZR5A 2JIHA 3L0VA 5L7FA 1CXWA 1C3IA 3WD0A 4GHAA 1C7KA 3F15A 4IBJA 3EDIA 3G42A 1GKDA 3FKEA 1R1IA 4DV8A 3LP9A 1L6JA 1XFVA 3DL1A 3LJGA 1IABA 5D1UA 2D49A 4A3WA 4FVLA 1UR8A 2JT6A 2KRJA 1GO8P 1G49A 3HDAP 1XFZA 2J83A 4IBDA 3L2AA 1ED7A 2L0RA 1UMSA 2DW1A 1G12A 2O36A 5D1SA 1QJJA 5I0LA 1OM6A 2BG1A 4I35A 2Y2KA 2OVXA 3OHLA 4GF1A 2D1OA 4GR3A 1Q3AA 2POJA 1O6IA 2DDFA 1W1VA 1FBLA 1JKYA 1XFUA 4L63A 2IOUA 1GOIA 4DF9A 5JMYA 4R3VA 1E8BA 5BOYA 3C7XA 2FN2A 1SRPA 4ON1A 2Y2GA 1XFWA 3UVCA 4WZVA 1I73A 1RTGA 2OW1A 1QIBA 1IACA 2FV5A 3TVCA 3OHOA 3EHYA 2WO8A 1QHUA 1XUCA 2X3CA 3TT4A 3LMCA 1GPFA 3F16A 2W0DA 1O0QA 3LQ0A 1ITVA 1JK3A 2N8RA 1K7IA 1GO7P 2SRTA 4AUOA 3ZVSA 1GE6A 3N2UA 1B8YA 1YU0A 2CKIA 1RM8A 3DNGA 3L27A 2J0TA 4IUWA 3HBVP 1SATA 1I1IP 3KWVC 3HYGA 2TCLA 2YIGA 2A8HA 4JP4A 5BPAA 4OJOA 1AKLA 1KAPP 4OEIA 2I47A 2MLSA 3KEJA 4XM8A 1HV5A 1BQOA 1IAGA 1K7GA 1UTTA 3HDBA 1J7MA 1QICA 4LG2A 2JNPA 4PKTA 5CXAA 1G9KA 1ZTQA 3L26A 4FU4A 1XURA 3I7GA 4GWNA 3U1RA 3LIRA 1H8PA 4QKZA 1XUDA 456CA 1KUKA 1OGBA 4L19A 4EFSA 3K7NA 4H76A 1E15A 1H71P 4GR8A 1JAOA 1KUGA 2OVZA 4PKQA 3L29A 4FXYP 3DTKA 3M7PA 1YQYA 1IAAA 3LK8A 4AIGA 1G05A 1GKCA 4GQLA 4LL2A 2Y2IA 1R1HA 3EDZA 4GH9A 1B3DA 2MZEA 2XD5A 4OJPA 4RT6B 1PWWA 4AYKA 1PWVA 1ZS0A 1BKCA 1BQQM 4IBBA 3O2XA 5I4OA 1QO6A 1HY7A 3L28A 3P24A 4OJLA 3F18A 3L25A 2V4BA 1YU3A 5I43A 3SHIA 1A85A 3LEAA 4L6TA 4XM6A 4HMEA 2DW0A 3AIGA 3HB2P 1GE5A 4NY2A 2JT5A 2K9CA 2E3XA 1BKCE 1JIZA 3V96B 3LKAA 3F19A 1Z3JA 3O64A 5BOTA 1XFXA 3KRYA 3P1VA 4Z2GA 4G9LA 2W15A 1UEAA 830CA 3F1AA 1PWPA 1YP1A 1JAQA 2DW2A 2QPJA 2X3BA 2X7MA 1GENA 4FXQA 2UWXA 1BUDA 4Z2IA 5D7WA 2RJPA 5I12A 1JAPA 2WOAA 1MMPA 4ILWD 4H84A 1AF0A 1RMZA 2Y2HA 3LIKA 2Y2NA 5BPVA 1YUEA 1JANA 4XM7A 1OO9A 4HX3A 1ZXVA 4HMCA 3DSLA 2E2DA 2D1NA 3ZUKA 2HU6A 3B92A 2Y2PA 3TSKA 4OJ6A 1PWUA 4MB3A 3HBUP 1QIAA 5LABA 1SLNA 4IBCA 4HMAA 4IJFA 4IBIA 1KUIA 3WD4A 1OM8A 3DTEA 3B8ZA 3K7LA 3DTIA 4H30A 4IBFA 5L79A 3NX7A 3AYUA 3KS4A 2PJTA 2MQSA 1ZP5A 1IAEA 3WX7A 2RJQA 1PWQA 3F17A 2RTSA 3KECA 3EDHA 5I2ZA 3KHIA 1EAKA 3L0TA 1K7QA 3GBOA 1D8FA 3DPEA 1CIZA 1OGGA 4JQGA 2Y2OA 1R54A 4HMDA 1ATLA 2MZIA 2OXZA 1I76A 1OMJA 4TX8A 2WO9A 3LUNA 2JCHA 4NZ5A 2FV9A 3LJZA 1BUVM 2W13A 4GUYA 4Z2HA 3EHXA 1CGLA 4XBHA 1PEXA 4AXQA 4DD8A 5CZMA 3LJTA 1EUBA 1E6ZA 1XM5A 1QJSA 1OZ9A 2OXWA 2JSDA 3Q2GA 4HSDA 2USNA 1OM7A 4G0DA 1R55A 3KEKA 1DTHA 3N3FA 4PKUA 3WD1A 4A7BA 1USNA 4NZ3A 1FM1A 4IBGA 3KS8A 1UR9A 2JXYA 2O3EA 4IJOA 2V5OA 1YOUA 4WKIA 5D1TA 4JIJA 4H2EA 1H0IA 1QJIA 3ZXHA 2Y2JA 3LILA 3N2VA 1TVIA 1GE7A 1HXNA 3HSHA 1W1PA 1JIWP 1D7XA 4MB4A 4IBKA 2XD1A 4Z2KA 4CTHA 2X3AA 2OY4A 2Y2MA 1W1YA 3DWBA 1E6PA 4OJ5A 4H1QA 3WV3A 2Y2LA 1YU2A 1BIWA 2JE5A 1WNIA 2OI0A 1YU4A 966CA 1YCMA 1Y8JA 5B5PA 3MQLA 1MMQA 2OZRA 1CQRA 4DPEA 2W14A 1MMRA 4I03A 2MLRA 3WV1A 2DDYA 1A86A 5CUHA 3KMEA 3LQBA 4GHLA 3ELMA 1XAXA 2ERQA 2ERPA 4GWMA 1HFSA 4J4MA 1PDCA 1AYKA 1CK7A 2XS4A 4WKEA 2OW0A 4NYYA 2Y2QA 1E6RA 1OS2A 4L7AA 4XCTA 1R1JA 1ZVXA 4WK7A 1C8TA 1G4KA 4GR0A 3V6NA 3LUMA 1BZSA 1CGFA 1UMTA 1S4BP 4MB5A 2YUFA 3LGPA 4Q1LA 5H8XA 4IJEA 4H3XA 1AIWA 3BA0A 1MMBA 1Y93A 1BKCI 1HTDA 1W1TA 2CLTA 1KUFA 1BSWA 2EROA 2Y6CA 2AIGP 4IN9A 1E6NA 1IADA 3EWJA 1BM6A 1MNCA 4PKVA 3I7IA 2OXUA 2Z2DA 4IBEA 4PKRA 1FLSA 4H49A 1XFYA 4H82A 4Z2JA 1J7NA 4NYUA 1D8MA 3G5CA 2W12A 3Q2HA 3VI1A 3DPFA 4YEHA 3KMCA 5B5OA 2XS3A 3CKIA 4JPAA 1Y0VA 1SU3A 1SMPA 2OW9A 5I3MA 3AYKA 4PKWA 3TS4A 1HFCA 5D3CA 1OS9A 1H0GA 1CGEA 3B2ZA 1JH1A 4QNLA 1SLMA 1UTZA 3WD3A 2OY2A 3E8RA 4JA1A 3RTTA 2MZHA 2OW2A 3HY7A 3WD2A 1O0TA 1EB6A 3RTSA 3WV2A 4WF6A 3USNA 3MA2A 3EDGA 1ASTA 4Z2LA 3VTGA 1KBCA 3LE9A 4PKSA 1YU1A 4NZ4A 1E88A 1ZXCA 2FFFB 3HONA 5D2BA 1DMTA 2AYKA 1GXDA 2Y6DA 2YB9A
chains in the Genus database with same CATH topology
1HOVA 1KUHA 1QUAA 1CAQA 3OYOA 1ROSA 1CXVA 1KS0A 3HY9A 1ND1A 1JJ9A 1D5JA 2K2GA 3S18A 4ZR5A 2JIHA 3L0VA 5L7FA 1CXWA 1C3IA 1C7KA 3F15A 3EDIA 3G42A 1GKDA 1R1IA 4DV8A 3LP9A 1L6JA 1XFVA 3DL1A 3LJGA 1IABA 5D1UA 4A3WA 4FVLA 2JT6A 2KRJA 1GO8P 1G49A 3HDAP 1XFZA 2J83A 2L0RA 1UMSA 2DW1A 1G12A 2O36A 5D1SA 1QJJA 5I0LA 1OM6A 4I35A 2OVXA 3OHLA 4GF1A 2D1OA 4GR3A 1Q3AA 2POJA 2DDFA 1FBLA 1JKYA 1XFUA 4L63A 4DF9A 5JMYA 4R3VA 1E8BA 5BOYA 3C7XA 2FN2A 1SRPA 4ON1A 1XFWA 3UVCA 4WZVA 1I73A 1RTGA 2OW1A 1QIBA 1IACA 2FV5A 3TVCA 3OHOA 3EHYA 2WO8A 1QHUA 1XUCA 2X3CA 3TT4A 3LMCA 3F16A 2W0DA 1O0QA 3LQ0A 1ITVA 1JK3A 2N8RA 1K7IA 1GO7P 2SRTA 4AUOA 3ZVSA 1GE6A 3N2UA 1B8YA 2CKIA 1RM8A 3DNGA 2J0TA 4IUWA 3HBVP 1SATA 1I1IP 3KWVC 3HYGA 2TCLA 2YIGA 2A8HA 4JP4A 5BPAA 1AKLA 1KAPP 4OEIA 2MLSA 2I47A 3KEJA 4XM8A 1HV5A 1BQOA 1IAGA 1K7GA 1UTTA 3HDBA 1J7MA 1QICA 2JNPA 4PKTA 5CXAA 1G9KA 1ZTQA 4FU4A 1XURA 3I7GA 4GWNA 3U1RA 3LIRA 1H8PA 4QKZA 1XUDA 456CA 1KUKA 4L19A 4EFSA 3K7NA 4H76A 1H71P 4GR8A 1JAOA 1KUGA 2OVZA 4PKQA 4FXYP 3DTKA 3M7PA 1YQYA 1IAAA 3LK8A 4AIGA 1G05A 1GKCA 4GQLA 4LL2A 1R1HA 3EDZA 1B3DA 2MZEA 4RT6B 1PWWA 4AYKA 1PWVA 1ZS0A 1BKCA 1BQQM 3O2XA 5I4OA 1QO6A 1HY7A 3P24A 3F18A 2V4BA 5I43A 3SHIA 1A85A 3LEAA 4L6TA 4XM6A 2DW0A 3AIGA 3HB2P 1GE5A 2JT5A 2K9CA 2E3XA 1BKCE 1JIZA 3V96B 3LKAA 3F19A 1Z3JA 3O64A 5BOTA 1XFXA 3KRYA 3P1VA 4G9LA 2W15A 1UEAA 830CA 3F1AA 1PWPA 1YP1A 1JAQA 2DW2A 2QPJA 2X3BA 2X7MA 1GENA 4FXQA 1BUDA 5D7WA 2RJPA 5I12A 1JAPA 2WOAA 1MMPA 4ILWD 4H84A 1AF0A 1RMZA 3LIKA 1JANA 4XM7A 1OO9A 4HX3A 1ZXVA 3DSLA 2E2DA 2D1NA 3ZUKA 2HU6A 3B92A 3TSKA 1PWUA 3HBUP 1QIAA 5LABA 1SLNA 4HMAA 1KUIA 1OM8A 3DTEA 3B8ZA 3K7LA 3DTIA 4H30A 5L79A 3NX7A 3AYUA 2PJTA 2MQSA 1ZP5A 1IAEA 2RJQA 1PWQA 3F17A 3KECA 3EDHA 5I2ZA 3KHIA 1EAKA 3L0TA 1K7QA 3GBOA 1D8FA 3DPEA 1CIZA 4JQGA 1R54A 1ATLA 2MZIA 2OXZA 1I76A 1OMJA 2WO9A 3LUNA 2FV9A 3LJZA 1BUVM 2W13A 4GUYA 3EHXA 1CGLA 4XBHA 1PEXA 4AXQA 4DD8A 5CZMA 3LJTA 1EUBA 1QJSA 2OXWA 2JSDA 3Q2GA 4HSDA 2USNA 1OM7A 4G0DA 1R55A 3KEKA 1DTHA 4PKUA 4A7BA 1USNA 1FM1A 2JXYA 2O3EA 4IJOA 2V5OA 1YOUA 4WKIA 5D1TA 4JIJA 4H2EA 1QJIA 3ZXHA 3N2VA 3LILA 1GE7A 1HXNA 1JIWP 1D7XA 4CTHA 2X3AA 2OY4A 3DWBA 4H1QA 3WV3A 1BIWA 1WNIA 2OI0A 966CA 1YCMA 1Y8JA 5B5PA 3MQLA 1MMQA 2OZRA 1CQRA 4DPEA 2W14A 1MMRA 4I03A 2MLRA 3WV1A 2DDYA 1A86A 5CUHA 3KMEA 3LQBA 3ELMA 2ERQA 2ERPA 4GWMA 1HFSA 4J4MA 1PDCA 1AYKA 1CK7A 2XS4A 4WKEA 2OW0A 1OS2A 4L7AA 4XCTA 1R1JA 1ZVXA 4WK7A 1C8TA 1G4KA 4GR0A 3V6NA 3LUMA 1BZSA 1CGFA 1UMTA 1S4BP 2YUFA 3LGPA 4Q1LA 5H8XA 4H3XA 3BA0A 1MMBA 1Y93A 1BKCI 1HTDA 2CLTA 1KUFA 1BSWA 2EROA 2Y6CA 2AIGP 4IN9A 1IADA 3EWJA 1BM6A 1MNCA 4PKVA 3I7IA 2OXUA 2Z2DA 4PKRA 1FLSA 4H49A 1XFYA 4H82A 1J7NA 1D8MA 3G5CA 2W12A 3Q2HA 3VI1A 3DPFA 4YEHA 3KMCA 5B5OA 2XS3A 3CKIA 4JPAA 1Y0VA 1SU3A 1SMPA 2OW9A 5I3MA 3AYKA 4PKWA 3TS4A 1HFCA 5D3CA 1OS9A 1CGEA 3B2ZA 1JH1A 1SLMA 1UTZA 2OY2A 3E8RA 4JA1A 3RTTA 2MZHA 2OW2A 3HY7A 1O0TA 1EB6A 3RTSA 3WV2A 4WF6A 3USNA 3MA2A 3EDGA 1ASTA 3VTGA 1KBCA 3LE9A 4PKSA 1E88A 1ZXCA 5D2BA 1DMTA 2AYKA 1GXDA 2Y6DA 2YB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HOV A;  1KUH A;  1QUA A;  1CAQ A;  3OYO A;  1ROS A;  1CXV A;  1KS0 A;  3HY9 A;  1ND1 A;  1JJ9 A;  1D5J A;  2K2G A;  3S18 A;  4ZR5 A;  2JIH A;  3L0V A;  5L7F A;  1CXW A;  1C3I A;  1C7K A;  3F15 A;  3EDI A;  3G42 A;  1GKD A;  1R1I A;  4DV8 A;  3LP9 A;  1L6J A;  1XFV A;  3DL1 A;  3LJG A;  1IAB A;  5D1U A;  4A3W A;  4FVL A;  2JT6 A;  2KRJ A;  1GO8 P;  1G49 A;  3HDA P;  1XFZ A;  2J83 A;  2L0R A;  1UMS A;  2DW1 A;  1G12 A;  2O36 A;  5D1S A;  1QJJ A;  5I0L A;  1OM6 A;  4I35 A;  2OVX A;  3OHL A;  4GF1 A;  2D1O A;  4GR3 A;  1Q3A A;  2POJ A;  2DDF A;  1FBL A;  1JKY A;  1XFU A;  4L63 A;  4DF9 A;  5JMY A;  4R3V A;  1E8B A;  5BOY A;  3C7X A;  2FN2 A;  1SRP A;  4ON1 A;  1XFW A;  3UVC A;  4WZV A;  1I73 A;  1RTG A;  2OW1 A;  1QIB A;  1IAC A;  2FV5 A;  3TVC A;  3OHO A;  3EHY A;  2WO8 A;  1QHU A;  1XUC A;  2X3C A;  3TT4 A;  3LMC A;  3F16 A;  2W0D A;  1O0Q A;  3LQ0 A;  1ITV A;  1JK3 A;  2N8R A;  1K7I A;  1GO7 P;  2SRT A;  4AUO A;  3ZVS A;  1GE6 A;  3N2U A;  1B8Y A;  2CKI A;  1RM8 A;  3DNG A;  2J0T A;  4IUW A;  3HBV P;  1SAT A;  1I1I P;  3KWV C;  3HYG A;  2TCL A;  2YIG A;  2A8H A;  4JP4 A;  5BPA A;  1AKL A;  1KAP P;  4OEI A;  2MLS A;  2I47 A;  3KEJ A;  4XM8 A;  1HV5 A;  1BQO A;  1IAG A;  1K7G A;  1UTT A;  3HDB A;  1J7M A;  1QIC A;  2JNP A;  4PKT A;  5CXA A;  1G9K A;  1ZTQ A;  4FU4 A;  1XUR A;  3I7G A;  4GWN A;  3U1R A;  3LIR A;  1H8P A;  4QKZ A;  1XUD A;  456C A;  1KUK A;  4L19 A;  4EFS A;  3K7N A;  4H76 A;  1H71 P;  4GR8 A;  1JAO A;  1KUG A;  2OVZ A;  4PKQ A;  4FXY P;  3M7P A;  1YQY A;  1IAA A;  3LK8 A;  4AIG A;  1G05 A;  1GKC A;  4GQL A;  4LL2 A;  1R1H A;  3EDZ A;  1B3D A;  2MZE A;  4RT6 B;  1PWW A;  4AYK A;  1PWV A;  1ZS0 A;  1BKC A;  1BQQ M;  3O2X A;  5I4O A;  1QO6 A;  1HY7 A;  3P24 A;  3F18 A;  2V4B A;  5I43 A;  3SHI A;  1A85 A;  3LEA A;  4L6T A;  4XM6 A;  2DW0 A;  3AIG A;  3HB2 P;  1GE5 A;  2JT5 A;  2K9C A;  2E3X A;  1BKC E;  1JIZ A;  3V96 B;  3LKA A;  3F19 A;  1Z3J A;  3O64 A;  5BOT A;  1XFX A;  3KRY A;  3P1V A;  4G9L A;  2W15 A;  1UEA A;  830C A;  3F1A A;  1PWP A;  1YP1 A;  1JAQ A;  2DW2 A;  2QPJ A;  2X3B A;  2X7M A;  1GEN A;  4FXQ A;  1BUD A;  5D7W A;  2RJP A;  5I12 A;  1JAP A;  2WOA A;  1MMP A;  4ILW D;  4H84 A;  1AF0 A;  1RMZ A;  3LIK A;  1JAN A;  4XM7 A;  1OO9 A;  4HX3 A;  1ZXV A;  3DSL A;  2E2D A;  2D1N A;  3ZUK A;  2HU6 A;  3B92 A;  3TSK A;  1PWU A;  3HBU P;  1QIA A;  5LAB A;  1SLN A;  4HMA A;  1KUI A;  1OM8 A;  3B8Z A;  3K7L A;  4H30 A;  5L79 A;  3NX7 A;  3AYU A;  2PJT A;  2MQS A;  1ZP5 A;  1IAE A;  2RJQ A;  1PWQ A;  3F17 A;  3KEC A;  3EDH A;  5I2Z A;  3KHI A;  1EAK A;  3L0T A;  1K7Q A;  3GBO A;  1D8F A;  3DPE A;  1CIZ A;  4JQG A;  1R54 A;  1ATL A;  2MZI A;  2OXZ A;  1I76 A;  1OMJ A;  2WO9 A;  3LUN A;  2FV9 A;  3LJZ A;  1BUV M;  2W13 A;  4GUY A;  3EHX A;  1CGL A;  4XBH A;  1PEX A;  4AXQ A;  4DD8 A;  5CZM A;  3LJT A;  1EUB A;  1QJS A;  2OXW A;  2JSD A;  3Q2G A;  4HSD A;  2USN A;  1OM7 A;  4G0D A;  1R55 A;  3KEK A;  1DTH A;  4PKU A;  4A7B A;  1USN A;  1FM1 A;  2JXY A;  2O3E A;  4IJO A;  2V5O A;  1YOU A;  4WKI A;  5D1T A;  4JIJ A;  4H2E A;  1QJI A;  3ZXH A;  3N2V A;  3LIL A;  1GE7 A;  1HXN A;  1JIW P;  1D7X A;  4CTH A;  2X3A A;  2OY4 A;  3DWB A;  4H1Q A;  3WV3 A;  1BIW A;  1WNI A;  2OI0 A;  966C A;  1YCM A;  1Y8J A;  5B5P A;  3MQL A;  1MMQ A;  2OZR A;  1CQR A;  4DPE A;  2W14 A;  1MMR A;  4I03 A;  2MLR A;  3WV1 A;  2DDY A;  1A86 A;  5CUH A;  3KME A;  3LQB A;  3ELM A;  2ERQ A;  2ERP A;  4GWM A;  1HFS A;  4J4M A;  1PDC A;  1AYK A;  1CK7 A;  2XS4 A;  4WKE A;  2OW0 A;  1OS2 A;  4XCT A;  1R1J A;  1ZVX A;  4WK7 A;  1C8T A;  1G4K A;  4GR0 A;  3V6N A;  3LUM A;  1BZS A;  1CGF A;  1UMT A;  1S4B P;  3LGP A;  4Q1L A;  5H8X A;  4H3X A;  3BA0 A;  1MMB A;  1Y93 A;  1BKC I;  1HTD A;  2CLT A;  1KUF A;  1BSW A;  2ERO A;  2Y6C A;  2AIG P;  4IN9 A;  1IAD A;  3EWJ A;  1BM6 A;  1MNC A;  4PKV A;  3I7I A;  2OXU A;  2Z2D A;  4PKR A;  1FLS A;  4H49 A;  1XFY A;  4H82 A;  1J7N A;  1D8M A;  3G5C A;  2W12 A;  3Q2H A;  3VI1 A;  3DPF A;  4YEH A;  3KMC A;  5B5O A;  2XS3 A;  3CKI A;  4JPA A;  1Y0V A;  1SU3 A;  1SMP A;  2OW9 A;  5I3M A;  3AYK A;  4PKW A;  3TS4 A;  1HFC A;  5D3C A;  1OS9 A;  1CGE A;  3B2Z A;  1JH1 A;  1SLM A;  1UTZ A;  2OY2 A;  3E8R A;  4JA1 A;  3RTT A;  2MZH A;  2OW2 A;  3HY7 A;  1O0T A;  1EB6 A;  3RTS A;  3WV2 A;  4WF6 A;  3USN A;  3MA2 A;  3EDG A;  1AST A;  3VTG A;  1KBC A;  3LE9 A;  4PKS A;  1E88 A;  1ZXC A;  5D2B A;  1DMT A;  2AYK A;  1GXD A;  2Y6D A;  2YB9 A; 
#chains in the Genus database with same CATH topology
 1HOV A;  1KUH A;  1QUA A;  1CAQ A;  3OYO A;  1ROS A;  4NZ1 A;  4OUI A;  1CXV A;  1KS0 A;  3HY9 A;  1ND1 A;  1JJ9 A;  1D5J A;  2K2G A;  3S18 A;  4ZR5 A;  2JIH A;  3L0V A;  5L7F A;  1CXW A;  1C3I A;  3WD0 A;  4GHA A;  1C7K A;  3F15 A;  4IBJ A;  3EDI A;  3G42 A;  1GKD A;  3FKE A;  1R1I A;  4DV8 A;  3LP9 A;  1L6J A;  1XFV A;  3DL1 A;  3LJG A;  1IAB A;  5D1U A;  2D49 A;  4A3W A;  4FVL A;  1UR8 A;  2JT6 A;  2KRJ A;  1GO8 P;  1G49 A;  3HDA P;  1XFZ A;  2J83 A;  4IBD A;  3L2A A;  1ED7 A;  2L0R A;  1UMS A;  2DW1 A;  1G12 A;  2O36 A;  5D1S A;  1QJJ A;  5I0L A;  1OM6 A;  2BG1 A;  4I35 A;  2Y2K A;  2OVX A;  3OHL A;  4GF1 A;  2D1O A;  4GR3 A;  1Q3A A;  2POJ A;  1O6I A;  2DDF A;  1W1V A;  1FBL A;  1JKY A;  1XFU A;  4L63 A;  2IOU A;  1GOI A;  4DF9 A;  5JMY A;  4R3V A;  1E8B A;  5BOY A;  3C7X A;  2FN2 A;  1SRP A;  4ON1 A;  2Y2G A;  1XFW A;  3UVC A;  4WZV A;  1I73 A;  1RTG A;  2OW1 A;  1QIB A;  1IAC A;  2FV5 A;  3TVC A;  3OHO A;  3EHY A;  2WO8 A;  1QHU A;  1XUC A;  2X3C A;  3TT4 A;  3LMC A;  1GPF A;  3F16 A;  2W0D A;  1O0Q A;  3LQ0 A;  1ITV A;  1JK3 A;  2N8R A;  1K7I A;  1GO7 P;  2SRT A;  4AUO A;  3ZVS A;  1GE6 A;  3N2U A;  1B8Y A;  1YU0 A;  2CKI A;  1RM8 A;  3DNG A;  3L27 A;  2J0T A;  4IUW A;  3HBV P;  1SAT A;  1I1I P;  3KWV C;  3HYG A;  2TCL A;  2YIG A;  2A8H A;  4JP4 A;  5BPA A;  4OJO A;  1AKL A;  1KAP P;  4OEI A;  2I47 A;  2MLS A;  3KEJ A;  4XM8 A;  1HV5 A;  1BQO A;  1IAG A;  1K7G A;  1UTT A;  3HDB A;  1J7M A;  1QIC A;  4LG2 A;  2JNP A;  4PKT A;  5CXA A;  1G9K A;  1ZTQ A;  3L26 A;  4FU4 A;  1XUR A;  3I7G A;  4GWN A;  3U1R A;  3LIR A;  1H8P A;  4QKZ A;  1XUD A;  456C A;  1KUK A;  1OGB A;  4L19 A;  4EFS A;  3K7N A;  4H76 A;  1E15 A;  1H71 P;  4GR8 A;  1JAO A;  1KUG A;  2OVZ A;  4PKQ A;  3L29 A;  4FXY P;  3DTK A;  3M7P A;  1YQY A;  1IAA A;  3LK8 A;  4AIG A;  1G05 A;  1GKC A;  4GQL A;  4LL2 A;  2Y2I A;  1R1H A;  3EDZ A;  4GH9 A;  1B3D A;  2MZE A;  2XD5 A;  4OJP A;  4RT6 B;  1PWW A;  4AYK A;  1PWV A;  1ZS0 A;  1BKC A;  1BQQ M;  4IBB A;  3O2X A;  5I4O A;  1QO6 A;  1HY7 A;  3L28 A;  3P24 A;  4OJL A;  3F18 A;  3L25 A;  2V4B A;  1YU3 A;  5I43 A;  3SHI A;  1A85 A;  3LEA A;  4L6T A;  4XM6 A;  4HME A;  2DW0 A;  3AIG A;  3HB2 P;  1GE5 A;  4NY2 A;  2JT5 A;  2K9C A;  2E3X A;  1BKC E;  1JIZ A;  3V96 B;  3LKA A;  3F19 A;  1Z3J A;  3O64 A;  5BOT A;  1XFX A;  3KRY A;  3P1V A;  4Z2G A;  4G9L A;  2W15 A;  1UEA A;  830C A;  3F1A A;  1PWP A;  1YP1 A;  1JAQ A;  2DW2 A;  2QPJ A;  2X3B A;  2X7M A;  1GEN A;  4FXQ A;  2UWX A;  1BUD A;  4Z2I A;  5D7W A;  2RJP A;  5I12 A;  1JAP A;  2WOA A;  1MMP A;  4ILW D;  4H84 A;  1AF0 A;  1RMZ A;  2Y2H A;  3LIK A;  2Y2N A;  5BPV A;  1YUE A;  1JAN A;  4XM7 A;  1OO9 A;  4HX3 A;  1ZXV A;  4HMC A;  3DSL A;  2E2D A;  2D1N A;  3ZUK A;  2HU6 A;  3B92 A;  2Y2P A;  3TSK A;  4OJ6 A;  1PWU A;  4MB3 A;  3HBU P;  1QIA A;  5LAB A;  1SLN A;  4IBC A;  4HMA A;  4IJF A;  4IBI A;  1KUI A;  3WD4 A;  1OM8 A;  3DTE A;  3B8Z A;  3K7L A;  3DTI A;  4H30 A;  4IBF A;  5L79 A;  3NX7 A;  3AYU A;  3KS4 A;  2PJT A;  2MQS A;  1ZP5 A;  1IAE A;  3WX7 A;  2RJQ A;  1PWQ A;  3F17 A;  2RTS A;  3KEC A;  3EDH A;  5I2Z A;  3KHI A;  1EAK A;  3L0T A;  1K7Q A;  3GBO A;  1D8F A;  3DPE A;  1CIZ A;  1OGG A;  4JQG A;  2Y2O A;  1R54 A;  4HMD A;  1ATL A;  2MZI A;  2OXZ A;  1I76 A;  1OMJ A;  4TX8 A;  2WO9 A;  3LUN A;  2JCH A;  4NZ5 A;  2FV9 A;  3LJZ A;  1BUV M;  2W13 A;  4GUY A;  4Z2H A;  3EHX A;  1CGL A;  4XBH A;  1PEX A;  4AXQ A;  4DD8 A;  5CZM A;  3LJT A;  1EUB A;  1E6Z A;  1XM5 A;  1QJS A;  1OZ9 A;  2OXW A;  2JSD A;  3Q2G A;  4HSD A;  2USN A;  1OM7 A;  4G0D A;  1R55 A;  3KEK A;  1DTH A;  3N3F A;  4PKU A;  3WD1 A;  4A7B A;  1USN A;  4NZ3 A;  1FM1 A;  4IBG A;  3KS8 A;  1UR9 A;  2JXY A;  2O3E A;  4IJO A;  2V5O A;  1YOU A;  4WKI A;  5D1T A;  4JIJ A;  4H2E A;  1H0I A;  1QJI A;  3ZXH A;  2Y2J A;  3LIL A;  3N2V A;  1TVI A;  1GE7 A;  1HXN A;  3HSH A;  1W1P A;  1JIW P;  1D7X A;  4MB4 A;  4IBK A;  2XD1 A;  4Z2K A;  4CTH A;  2X3A A;  2OY4 A;  2Y2M A;  1W1Y A;  3DWB A;  1E6P A;  4OJ5 A;  4H1Q A;  3WV3 A;  2Y2L A;  1YU2 A;  1BIW A;  2JE5 A;  1WNI A;  2OI0 A;  1YU4 A;  966C A;  1YCM A;  1Y8J A;  5B5P A;  3MQL A;  1MMQ A;  2OZR A;  1CQR A;  4DPE A;  2W14 A;  1MMR A;  4I03 A;  2MLR A;  3WV1 A;  2DDY A;  1A86 A;  5CUH A;  3KME A;  3LQB A;  4GHL A;  3ELM A;  1XAX A;  2ERQ A;  2ERP A;  4GWM A;  1HFS A;  4J4M A;  1PDC A;  1AYK A;  1CK7 A;  2XS4 A;  4WKE A;  2OW0 A;  4NYY A;  2Y2Q A;  1E6R A;  1OS2 A;  4L7A A;  4XCT A;  1R1J A;  1ZVX A;  4WK7 A;  1C8T A;  1G4K A;  4GR0 A;  3V6N A;  3LUM A;  1BZS A;  1CGF A;  1UMT A;  1S4B P;  4MB5 A;  2YUF A;  3LGP A;  4Q1L A;  5H8X A;  4IJE A;  4H3X A;  1AIW A;  3BA0 A;  1MMB A;  1Y93 A;  1BKC I;  1HTD A;  1W1T A;  2CLT A;  1KUF A;  1BSW A;  2ERO A;  2Y6C A;  2AIG P;  4IN9 A;  1E6N A;  1IAD A;  3EWJ A;  1BM6 A;  1MNC A;  4PKV A;  3I7I A;  2OXU A;  2Z2D A;  4IBE A;  4PKR A;  1FLS A;  4H49 A;  1XFY A;  4H82 A;  4Z2J A;  1J7N A;  4NYU A;  1D8M A;  3G5C A;  2W12 A;  3Q2H A;  3VI1 A;  3DPF A;  4YEH A;  3KMC A;  5B5O A;  2XS3 A;  3CKI A;  4JPA A;  1Y0V A;  1SU3 A;  1SMP A;  2OW9 A;  5I3M A;  3AYK A;  4PKW A;  3TS4 A;  1HFC A;  5D3C A;  1OS9 A;  1H0G A;  1CGE A;  3B2Z A;  1JH1 A;  4QNL A;  1SLM A;  1UTZ A;  3WD3 A;  2OY2 A;  3E8R A;  4JA1 A;  3RTT A;  2MZH A;  2OW2 A;  3HY7 A;  3WD2 A;  1O0T A;  1EB6 A;  3RTS A;  3WV2 A;  4WF6 A;  3USN A;  3MA2 A;  3EDG A;  1AST A;  4Z2L A;  3VTG A;  1KBC A;  3LE9 A;  4PKS A;  1YU1 A;  4NZ4 A;  1E88 A;  1ZXC A;  2FFF B;  3HON A;  5D2B A;  1DMT A;  2AYK A;  1GXD A;  2Y6D A;  2YB9 A; 
#chains in the Genus database with same CATH homology
 1HOV A;  1KUH A;  1QUA A;  1CAQ A;  3OYO A;  1ROS A;  1CXV A;  1KS0 A;  3HY9 A;  1ND1 A;  1JJ9 A;  1D5J A;  2K2G A;  3S18 A;  4ZR5 A;  2JIH A;  3L0V A;  5L7F A;  1CXW A;  1C3I A;  1C7K A;  3F15 A;  3EDI A;  3G42 A;  1GKD A;  1R1I A;  4DV8 A;  3LP9 A;  1L6J A;  1XFV A;  3DL1 A;  3LJG A;  1IAB A;  5D1U A;  4A3W A;  4FVL A;  2JT6 A;  2KRJ A;  1GO8 P;  1G49 A;  3HDA P;  1XFZ A;  2J83 A;  2L0R A;  1UMS A;  2DW1 A;  1G12 A;  2O36 A;  5D1S A;  1QJJ A;  5I0L A;  1OM6 A;  4I35 A;  2OVX A;  3OHL A;  4GF1 A;  2D1O A;  4GR3 A;  1Q3A A;  2POJ A;  2DDF A;  1FBL A;  1JKY A;  1XFU A;  4L63 A;  4DF9 A;  5JMY A;  4R3V A;  1E8B A;  5BOY A;  3C7X A;  2FN2 A;  1SRP A;  4ON1 A;  1XFW A;  3UVC A;  4WZV A;  1I73 A;  1RTG A;  2OW1 A;  1QIB A;  1IAC A;  2FV5 A;  3TVC A;  3OHO A;  3EHY A;  2WO8 A;  1QHU A;  1XUC A;  2X3C A;  3TT4 A;  3LMC A;  3F16 A;  2W0D A;  1O0Q A;  3LQ0 A;  1ITV A;  1JK3 A;  2N8R A;  1K7I A;  1GO7 P;  2SRT A;  4AUO A;  3ZVS A;  1GE6 A;  3N2U A;  1B8Y A;  2CKI A;  1RM8 A;  3DNG A;  2J0T A;  4IUW A;  3HBV P;  1SAT A;  1I1I P;  3KWV C;  3HYG A;  2TCL A;  2YIG A;  2A8H A;  4JP4 A;  5BPA A;  1AKL A;  1KAP P;  4OEI A;  2MLS A;  2I47 A;  3KEJ A;  4XM8 A;  1HV5 A;  1BQO A;  1IAG A;  1K7G A;  1UTT A;  3HDB A;  1J7M A;  1QIC A;  2JNP A;  4PKT A;  5CXA A;  1G9K A;  1ZTQ A;  4FU4 A;  1XUR A;  3I7G A;  4GWN A;  3U1R A;  3LIR A;  1H8P A;  4QKZ A;  1XUD A;  456C A;  1KUK A;  4L19 A;  4EFS A;  3K7N A;  4H76 A;  1H71 P;  4GR8 A;  1JAO A;  1KUG A;  2OVZ A;  4PKQ A;  4FXY P;  3DTK A;  3M7P A;  1YQY A;  1IAA A;  3LK8 A;  4AIG A;  1G05 A;  1GKC A;  4GQL A;  4LL2 A;  1R1H A;  3EDZ A;  1B3D A;  2MZE A;  4RT6 B;  1PWW A;  4AYK A;  1PWV A;  1ZS0 A;  1BKC A;  1BQQ M;  3O2X A;  5I4O A;  1QO6 A;  1HY7 A;  3P24 A;  3F18 A;  2V4B A;  5I43 A;  3SHI A;  1A85 A;  3LEA A;  4L6T A;  4XM6 A;  2DW0 A;  3AIG A;  3HB2 P;  1GE5 A;  2JT5 A;  2K9C A;  2E3X A;  1BKC E;  1JIZ A;  3V96 B;  3LKA A;  3F19 A;  1Z3J A;  3O64 A;  5BOT A;  1XFX A;  3KRY A;  3P1V A;  4G9L A;  2W15 A;  1UEA A;  830C A;  3F1A A;  1PWP A;  1YP1 A;  1JAQ A;  2DW2 A;  2QPJ A;  2X3B A;  2X7M A;  1GEN A;  4FXQ A;  1BUD A;  5D7W A;  2RJP A;  5I12 A;  1JAP A;  2WOA A;  1MMP A;  4ILW D;  4H84 A;  1AF0 A;  1RMZ A;  3LIK A;  1JAN A;  4XM7 A;  1OO9 A;  4HX3 A;  1ZXV A;  3DSL A;  2E2D A;  2D1N A;  3ZUK A;  2HU6 A;  3B92 A;  3TSK A;  1PWU A;  3HBU P;  1QIA A;  5LAB A;  1SLN A;  4HMA A;  1KUI A;  1OM8 A;  3DTE A;  3B8Z A;  3K7L A;  3DTI A;  4H30 A;  5L79 A;  3NX7 A;  3AYU A;  2PJT A;  2MQS A;  1ZP5 A;  1IAE A;  2RJQ A;  1PWQ A;  3F17 A;  3KEC A;  3EDH A;  5I2Z A;  3KHI A;  1EAK A;  3L0T A;  1K7Q A;  3GBO A;  1D8F A;  3DPE A;  1CIZ A;  4JQG A;  1R54 A;  1ATL A;  2MZI A;  2OXZ A;  1I76 A;  1OMJ A;  2WO9 A;  3LUN A;  2FV9 A;  3LJZ A;  1BUV M;  2W13 A;  4GUY A;  3EHX A;  1CGL A;  4XBH A;  1PEX A;  4AXQ A;  4DD8 A;  5CZM A;  3LJT A;  1EUB A;  1QJS A;  2OXW A;  2JSD A;  3Q2G A;  4HSD A;  2USN A;  1OM7 A;  4G0D A;  1R55 A;  3KEK A;  1DTH A;  4PKU A;  4A7B A;  1USN A;  1FM1 A;  2JXY A;  2O3E A;  4IJO A;  2V5O A;  1YOU A;  4WKI A;  5D1T A;  4JIJ A;  4H2E A;  1QJI A;  3ZXH A;  3N2V A;  3LIL A;  1GE7 A;  1HXN A;  1JIW P;  1D7X A;  4CTH A;  2X3A A;  2OY4 A;  3DWB A;  4H1Q A;  3WV3 A;  1BIW A;  1WNI A;  2OI0 A;  966C A;  1YCM A;  1Y8J A;  5B5P A;  3MQL A;  1MMQ A;  2OZR A;  1CQR A;  4DPE A;  2W14 A;  1MMR A;  4I03 A;  2MLR A;  3WV1 A;  2DDY A;  1A86 A;  5CUH A;  3KME A;  3LQB A;  3ELM A;  2ERQ A;  2ERP A;  4GWM A;  1HFS A;  4J4M A;  1PDC A;  1AYK A;  1CK7 A;  2XS4 A;  4WKE A;  2OW0 A;  1OS2 A;  4L7A A;  4XCT A;  1R1J A;  1ZVX A;  4WK7 A;  1C8T A;  1G4K A;  4GR0 A;  3V6N A;  3LUM A;  1BZS A;  1CGF A;  1UMT A;  1S4B P;  2YUF A;  3LGP A;  4Q1L A;  5H8X A;  4H3X A;  3BA0 A;  1MMB A;  1Y93 A;  1BKC I;  1HTD A;  2CLT A;  1KUF A;  1BSW A;  2ERO A;  2Y6C A;  2AIG P;  4IN9 A;  1IAD A;  3EWJ A;  1BM6 A;  1MNC A;  4PKV A;  3I7I A;  2OXU A;  2Z2D A;  4PKR A;  1FLS A;  4H49 A;  1XFY A;  4H82 A;  1J7N A;  1D8M A;  3G5C A;  2W12 A;  3Q2H A;  3VI1 A;  3DPF A;  4YEH A;  3KMC A;  5B5O A;  2XS3 A;  3CKI A;  4JPA A;  1Y0V A;  1SU3 A;  1SMP A;  2OW9 A;  5I3M A;  3AYK A;  4PKW A;  3TS4 A;  1HFC A;  5D3C A;  1OS9 A;  1CGE A;  3B2Z A;  1JH1 A;  1SLM A;  1UTZ A;  2OY2 A;  3E8R A;  4JA1 A;  3RTT A;  2MZH A;  2OW2 A;  3HY7 A;  1O0T A;  1EB6 A;  3RTS A;  3WV2 A;  4WF6 A;  3USN A;  3MA2 A;  3EDG A;  1AST A;  3VTG A;  1KBC A;  3LE9 A;  4PKS A;  1E88 A;  1ZXC A;  5D2B A;  1DMT A;  2AYK A;  1GXD A;  2Y6D A;  2YB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...