1GXDA

Prommp-2/timp-2 complex
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
631
structure length
624
Chain Sequence
APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords 72 KDA TYPE IV COLLAGENASE
publication title Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 624
sequence length 631
chains with identical sequence B
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 2002-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00040 fn2 Fibronectin type II domain
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1gxdA02
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1gxdA04
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1gxdA03
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 1gxdA05
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1gxdA01
1G9KA 1CGLA 3DNGA 3C7XA 3RTTA 2OW1A 3V96B 3LJTA 3I7IA 4H49A 3EDZA 3KHIA 4A3WA 3KMEA 1OS9A 1HTDA 2DDFA 4AUOA 1GENA 4PKTA 2JNPA 4DF9A 4ILWD 4AIGA 1AKLA 4IUWA 4RT6B 2OW0A 2W0DA 1JJ9A 4PKRA 1SMPA 1GO7P 2Y6CA 3LE9A 1CGFA 2MZIA 4JIJA 3LUNA 1BM6A 1GKDA 1CXVA 2W15A 3L0VA 2E3XA 1ZTQA 3K7LA 3F15A 3AIGA 5BOTA 1E8BA 1CQRA 2CLTA 1ASTA 1HOVA 3S18A 1JKYA 2WO9A 1Y93A 4LL2A 1AF0A 1QIBA 4DPEA 2O3EA 1QIAA 1BKCE 5I4OA 4L63A 4EFSA 2MZHA 1Q3AA 3DL1A 1I73A 1R55A 3LQ0A 1CAQA 1HV5A 4XCTA 3SHIA 2OY2A 2JT6A 1YCMA 1UMTA 4J4MA 2XS4A 1ITVA 3HY9A 3AYUA 4IJOA 1KUIA 2TCLA 4FVLA 4GR0A 1QJJA 1YOUA 4H1QA 4I35A 2JSDA 4XM7A 3WV3A 4HX3A 4XBHA 2MZEA 2KRJA 5BPAA 1CIZA 3LGPA 3KECA 3F19A 3HY7A 3LUMA 4PKVA 4A7BA 1JK3A 2MLSA 1PWUA 4AYKA 2ERQA 1QO6A 1GKCA 4JP4A 3L0TA 2SRTA 1QICA 3LMCA 2Y6DA 2OXUA 1QHUA 3EDIA 3F1AA 1DMTA 1JAQA 1O0TA 1KBCA 1I76A 1Z3JA 3O64A 1GE6A 2OI0A 2YB9A 4H30A 2FV5A 3B2ZA 1SLMA 3MA2A 2DW0A 1CXWA 1G05A 1KUFA 3EDHA 3ZXHA 2JT5A 3GBOA 4G9LA 4CTHA 3HDAP 4G0DA 5I12A 4WKEA 966CA 4XM8A 3O2XA 3ZVSA 5D3CA 4H82A 1KUHA 1BKCI 1DTHA 3E8RA 3LK8A 1JH1A 1G12A 1FBLA 4GWNA 1K7QA 4AXQA 2ERPA 2AYKA 1R1IA 1FLSA 1OMJA 1J7NA 1IABA 2MLRA 3EDGA 1SU3A 456CA 5I0LA 3N2VA 3UVCA 1RTGA 4JPAA 4L6TA 5I2ZA 1PDCA 3HDBA 3U1RA 2JXYA 1ZXCA 5L7FA 3EHXA 2D1OA 2OZRA 1OM6A 3LJZA 1PWPA 1OM7A 3LJGA 2OW9A 2X7MA 1E88A 1OM8A 2OXZA 4GF1A 4H84A 4H3XA 1PWQA 2V4BA 2AIGP 4Q1LA 3HBVP 1MMQA 4H76A 1XFVA 2JIHA 2OY4A 1QJIA 1RM8A 1IADA 2RJPA 3TSKA 4H2EA 3N2UA 1Y0VA 2W13A 2XS3A 3LIKA 3ELMA 1ZS0A 1XFYA 3KMCA 3EHYA 3LKAA 2HU6A 2DW2A 1KS0A 1C7KA 4JA1A 3F16A 1XUDA 1ATLA 2FN2A 1H8PA 1ZP5A 5JMYA 1KUKA 2USNA 1R1JA 1YQYA 3OHLA 3HYGA 4I03A 3MQLA 1JAOA 3KEJA 5B5PA 1UEAA 3LEAA 3OHOA 1YP1A 3DPEA 1PEXA 1BQQM 1MNCA 2OXWA 4PKQA 2OW2A 4R3VA 5BOYA 1GE5A 3OYOA 5D1UA 1I1IP 830CA 5D1TA 4ZR5A 2YIGA 1UMSA 2WOAA 1K7IA 4PKUA 4IN9A 1RMZA 4GQLA 2J83A 1JIWP 2PJTA 4WZVA 2J0TA 3F18A 1BUVM 1HFCA 1FM1A 4PKSA 3LP9A 2EROA 2O36A 2OVXA 3VI1A 1D8FA 1IACA 4PKWA 1ROSA 4DV8A 4WKIA 1EAKA 3G5CA 4GUYA 1MMRA 2X3CA 2K9CA 4YEHA 2RJQA 4GR3A 1BUDA 1XFUA 1CGEA 3KWVC 1KUGA 1JAPA 1QUAA 1K7GA 2V5OA 1A86A 1KAPP 3G42A 1XUCA 5L79A 1GO8P 4GR8A 1R1HA 1G49A 4QKZA 1CK7A 2FV9A 4OEIA 1BSWA 2X3BA 5D1SA 1BKCA 1ZXVA 3Q2GA 2X3AA 1XURA 3USNA 1AYKA 1EB6A 1OO9A 1S4BP 4WK7A 3K7NA 1UTZA 4HMAA 1SRPA 5CXAA 3WV2A 1XFZA 5D2BA 1ZVXA 1R54A 3VTGA 3B92A 4XM6A 2MQSA 5I43A 1XFWA 3EWJA 3BA0A 1IAGA 2W12A 2OVZA 5CZMA 4HSDA 3NX7A 1IAEA 4FXQA 4GWMA 1HFSA 3P24A 1SLNA 3KRYA 1EUBA 1JIZA 1HXNA 2K2GA 3V6NA 2DDYA 2A8HA 1C8TA 3RTSA 1USNA 2POJA 3LIRA 3WV1A 2CKIA 3LQBA 2DW1A 2N8RA 1G4KA 4L19A 2I47A 3KEKA 3AYKA 3CKIA 1MMBA 3DWBA 3F17A 1A85A 2L0RA 3DSLA 1J7MA 1SATA 3HB2P 1B8YA 1OS2A 4FU4A 2E2DA 1MMPA 5LABA 1B3DA 1UTTA 2WO8A 1BIWA 3P1VA 1C3IA 3ZUKA 3TS4A 1BZSA 2QPJA 3TVCA 1IAAA 3HBUP 1H71P 1JANA 1HY7A 1GE7A 1D7XA 1GXDA 1D5JA 5B5OA 3Q2HA 1BQOA 4JQGA 1O0QA 1PWVA 2Z2DA 1ND1A 2W14A 5H8XA 1Y8JA 1XFXA 4DD8A 4WF6A 3M7PA 3I7GA 3B8ZA 1QJSA 1WNIA 2D1NA 3TT4A 3LILA 1D8MA 1PWWA 5CUHA 1L6JA 4ON1A 5I3MA 3DPFA 5D7WA 4FXYP
chains in the Genus database with same CATH superfamily
1G9KA 1CGLA 3DNGA 3C7XA 3RTTA 2OW1A 3V96B 3LJTA 1GOIA 3I7IA 2Y2PA 4H49A 3EDZA 3KHIA 4A3WA 3KMEA 1OS9A 4GH9A 1HTDA 2DDFA 4AUOA 1GENA 1GPFA 4PKTA 3L25A 2JNPA 4DF9A 4ILWD 4AIGA 2Y2JA 1AKLA 2BG1A 4IUWA 4RT6B 2OW0A 2W0DA 1JJ9A 4PKRA 1SMPA 2XD5A 1W1YA 1GO7P 2Y6CA 3LE9A 1CGFA 2MZIA 4JIJA 3LUNA 1BM6A 1GKDA 1CXVA 2W15A 3L0VA 2E3XA 1ZTQA 2Y2MA 3K7LA 3F15A 3AIGA 5BOTA 1E8BA 1CQRA 2CLTA 3HSHA 1ASTA 3S18A 1HOVA 1JKYA 2WO9A 1Y93A 4LL2A 1AF0A 1QIBA 4DPEA 2O3EA 1QIAA 1BKCE 1YU2A 3HONA 5I4OA 4L63A 4EFSA 2MZHA 1Q3AA 3DL1A 1I73A 1R55A 3LQ0A 1CAQA 1HV5A 1E6ZA 4XCTA 2OY2A 2YUFA 3SHIA 2JT6A 4IBEA 1YCMA 1UMTA 2Y2KA 4J4MA 2XS4A 4IBFA 4Z2HA 1ITVA 4IBJA 3HY9A 3AYUA 4IJOA 1KUIA 2TCLA 4FVLA 4GR0A 1QJJA 1YOUA 4H1QA 4NY2A 4I35A 1O6IA 2JSDA 4XM7A 4HX3A 3WV3A 4XBHA 2MZEA 2KRJA 5BPAA 1CIZA 3LGPA 3KECA 3F19A 3HY7A 3LUMA 4PKVA 4A7BA 1JK3A 2MLSA 1W1VA 1PWUA 4AYKA 1H0IA 1QO6A 2ERQA 3KS8A 1GKCA 3WD0A 4JP4A 3L0TA 2SRTA 1QICA 4IBDA 3LMCA 2Y6DA 4L7AA 2OXUA 1QHUA 3EDIA 3F1AA 1DMTA 1JAQA 1XM5A 1O0TA 1KBCA 1I76A 3L27A 1Z3JA 3O64A 1GE6A 3KS4A 2OI0A 2YB9A 1H0GA 4HMEA 4H30A 2FV5A 3B2ZA 1SLMA 3MA2A 2DW0A 3WD4A 1CXWA 1G05A 1OGBA 1KUFA 1YU0A 3EDHA 3ZXHA 2JT5A 3GBOA 4G9LA 1TVIA 3HDAP 4CTHA 4G0DA 5I12A 4WKEA 966CA 4XM8A 3O2XA 3ZVSA 4IBIA 5D3CA 4NZ5A 4H82A 4MB5A 1KUHA 1BKCI 1DTHA 3E8RA 1YUEA 3LK8A 1JH1A 1G12A 1FBLA 4IBCA 4GWNA 1K7QA 4AXQA 2ERPA 2Y2NA 2AYKA 1R1IA 1E6PA 1FLSA 1OMJA 1J7NA 1IABA 2MLRA 3EDGA 1SU3A 456CA 5I0LA 3N2VA 3DTEA 4QNLA 1YU3A 4OUIA 3UVCA 1RTGA 4JPAA 4L6TA 5I2ZA 1PDCA 2Y2OA 3HDBA 3U1RA 2JXYA 1ZXCA 5L7FA 3EHXA 4IJEA 2UWXA 2D1OA 2OZRA 1OM6A 3LJZA 1PWPA 1OM7A 4IBKA 3LJGA 2OW9A 2X7MA 1E88A 1OM8A 1ED7A 2OXZA 4GF1A 4H84A 4H3XA 1PWQA 4MB3A 2V4BA 3DTKA 2AIGP 1E6RA 4Q1LA 4NZ1A 3HBVP 1MMQA 4H76A 1XFVA 4NYYA 4Z2LA 2JIHA 2OY4A 1QJIA 1RM8A 4IBBA 4OJ5A 1IADA 3WX7A 2RJPA 3TSKA 4H2EA 4HMCA 3N2UA 1Y0VA 2W13A 2XS3A 4NYUA 1UR9A 3LIKA 3ELMA 1ZS0A 2Y2GA 1XFYA 1YU1A 3KMCA 1YU4A 3EHYA 3LKAA 4LG2A 2HU6A 2DW2A 1KS0A 1C7KA 4JA1A 3F16A 1XUDA 1ATLA 2FN2A 1H8PA 4OJOA 4TX8A 1ZP5A 1KUKA 5JMYA 2USNA 1YQYA 1R1JA 3OHLA 1XAXA 3HYGA 4I03A 1OGGA 3MQLA 1JAOA 3KEJA 5B5PA 1UEAA 3LEAA 3OHOA 1YP1A 3DPEA 1PEXA 3WD1A 1BQQM 1MNCA 2OXWA 1UR8A 4PKQA 2OW2A 4R3VA 4NZ3A 5BOYA 1GE5A 3L2AA 1W1PA 3OYOA 5D1UA 1I1IP 830CA 5D1TA 4ZR5A 2YIGA 3L29A 1UMSA 2WOAA 1K7IA 4PKUA 4IN9A 4GHAA 1RMZA 4GQLA 2J83A 3L28A 1JIWP 2PJTA 3L26A 4WZVA 2J0TA 3F18A 1BUVM 1HFCA 1FM1A 4PKSA 3LP9A 2EROA 2O36A 2OVXA 3VI1A 2RTSA 1D8FA 1IACA 4PKWA 4OJPA 1E6NA 2Y2IA 1ROSA 4DV8A 4WKIA 1EAKA 3G5CA 4GUYA 1MMRA 2X3CA 2K9CA 4YEHA 2RJQA 1W1TA 4GR3A 1BUDA 1XFUA 2FFFB 1CGEA 3KWVC 1KUGA 1JAPA 1QUAA 3WD2A 1K7GA 2V5OA 1A86A 1KAPP 3G42A 1XUCA 5L79A 1GO8P 2Y2QA 4GR8A 1R1HA 1G49A 4QKZA 1CK7A 2FV9A 4OEIA 1BSWA 2X3BA 5D1SA 1BKCA 1ZXVA 3Q2GA 2X3AA 1XURA 1E15A 3USNA 1AYKA 1EB6A 1OO9A 1S4BP 4WK7A 3K7NA 2XD1A 1UTZA 4HMAA 1SRPA 5CXAA 3WV2A 1XFZA 4Z2GA 2JE5A 5D2BA 2IOUA 1ZVXA 1R54A 3VTGA 3B92A 4XM6A 2MQSA 5I43A 1XFWA 3EWJA 3BA0A 1IAGA 4Z2KA 2W12A 2OVZA 2Y2LA 3WD3A 4Z2JA 5CZMA 4HSDA 3NX7A 4MB4A 1IAEA 4FXQA 4HMDA 4GWMA 1HFSA 3P24A 1OZ9A 1SLNA 3KRYA 1EUBA 1JIZA 2Y2HA 1HXNA 2K2GA 3V6NA 2DDYA 2A8HA 1C8TA 3N3FA 1USNA 3RTSA 2POJA 3LIRA 3WV1A 2CKIA 3FKEA 3LQBA 5BPVA 2DW1A 1G4KA 2N8RA 4L19A 2I47A 3KEKA 3AYKA 3CKIA 1MMBA 3DWBA 3F17A 1A85A 4IBGA 2L0RA 3DSLA 1J7MA 1SATA 4Z2IA 3HB2P 1B8YA 1OS2A 4FU4A 2E2DA 1MMPA 5LABA 1B3DA 1UTTA 2WO8A 1BIWA 3P1VA 1C3IA 3ZUKA 3TS4A 1BZSA 2QPJA 3TVCA 1IAAA 3HBUP 1H71P 1JANA 1HY7A 1GE7A 1D7XA 1GXDA 1D5JA 5B5OA 4NZ4A 3Q2HA 4GHLA 1BQOA 4IJFA 4JQGA 1O0QA 1PWVA 2Z2DA 4OJLA 1ND1A 2W14A 5H8XA 1Y8JA 1XFXA 4DD8A 2JCHA 4WF6A 3M7PA 4OJ6A 3I7GA 1QJSA 3B8ZA 3DTIA 1WNIA 2D1NA 3TT4A 2D49A 3LILA 1D8MA 1AIWA 1PWWA 5CUHA 1L6JA 4ON1A 5I3MA 3DPFA 5D7WA 4FXYP
chains in the Genus database with same CATH topology
1G9KA 1CGLA 3DNGA 3C7XA 3RTTA 2OW1A 3V96B 3LJTA 3I7IA 4H49A 3EDZA 3KHIA 4A3WA 3KMEA 1OS9A 1HTDA 2DDFA 4AUOA 1GENA 4PKTA 2JNPA 4DF9A 4ILWD 4AIGA 1AKLA 4IUWA 4RT6B 2OW0A 2W0DA 1JJ9A 4PKRA 1SMPA 1GO7P 2Y6CA 3LE9A 1CGFA 2MZIA 4JIJA 3LUNA 1BM6A 1GKDA 1CXVA 2W15A 3L0VA 2E3XA 1ZTQA 3K7LA 3F15A 3AIGA 5BOTA 1E8BA 1CQRA 2CLTA 1ASTA 1HOVA 3S18A 1JKYA 2WO9A 1Y93A 4LL2A 1AF0A 1QIBA 4DPEA 2O3EA 1QIAA 1BKCE 5I4OA 4L63A 4EFSA 2MZHA 1Q3AA 3DL1A 1I73A 1R55A 3LQ0A 1CAQA 1HV5A 4XCTA 3SHIA 2YUFA 2OY2A 2JT6A 1YCMA 1UMTA 4J4MA 2XS4A 1ITVA 3HY9A 3AYUA 4IJOA 1KUIA 2TCLA 4FVLA 4GR0A 1QJJA 1YOUA 4H1QA 4I35A 2JSDA 4XM7A 3WV3A 4HX3A 4XBHA 2MZEA 2KRJA 5BPAA 1CIZA 3LGPA 3KECA 3F19A 3HY7A 3LUMA 4PKVA 4A7BA 1JK3A 2MLSA 1PWUA 4AYKA 2ERQA 1QO6A 1GKCA 4JP4A 3L0TA 2SRTA 1QICA 3LMCA 2Y6DA 4L7AA 2OXUA 1QHUA 3EDIA 3F1AA 1DMTA 1JAQA 1O0TA 1KBCA 1I76A 1Z3JA 3O64A 1GE6A 2OI0A 2YB9A 4H30A 2FV5A 3B2ZA 1SLMA 3MA2A 2DW0A 1CXWA 1G05A 1KUFA 3EDHA 3ZXHA 2JT5A 3GBOA 4G9LA 4CTHA 3HDAP 4G0DA 5I12A 4WKEA 966CA 4XM8A 3O2XA 3ZVSA 5D3CA 4H82A 1KUHA 1BKCI 1DTHA 3E8RA 3LK8A 1JH1A 1G12A 1FBLA 4GWNA 1K7QA 4AXQA 2ERPA 2AYKA 1R1IA 1FLSA 1OMJA 1J7NA 1IABA 2MLRA 3EDGA 1SU3A 456CA 5I0LA 3N2VA 3DTEA 3UVCA 1RTGA 4JPAA 4L6TA 5I2ZA 1PDCA 3HDBA 3U1RA 2JXYA 1ZXCA 5L7FA 3EHXA 2D1OA 2OZRA 1OM6A 3LJZA 1PWPA 1OM7A 3LJGA 2OW9A 2X7MA 1E88A 1OM8A 2OXZA 4GF1A 4H84A 4H3XA 1PWQA 2V4BA 3DTKA 2AIGP 4Q1LA 3HBVP 1MMQA 4H76A 1XFVA 2JIHA 2OY4A 1QJIA 1RM8A 1IADA 2RJPA 3TSKA 4H2EA 3N2UA 1Y0VA 2W13A 2XS3A 3LIKA 3ELMA 1ZS0A 1XFYA 3KMCA 3EHYA 3LKAA 2HU6A 2DW2A 1KS0A 1C7KA 4JA1A 3F16A 1XUDA 1ATLA 2FN2A 1H8PA 1ZP5A 5JMYA 1KUKA 2USNA 1R1JA 1YQYA 3OHLA 3HYGA 4I03A 3MQLA 1JAOA 3KEJA 5B5PA 1UEAA 3LEAA 3OHOA 1YP1A 3DPEA 1PEXA 1BQQM 1MNCA 2OXWA 4PKQA 2OW2A 4R3VA 5BOYA 1GE5A 3OYOA 5D1UA 1I1IP 830CA 5D1TA 4ZR5A 2YIGA 1UMSA 2WOAA 1K7IA 4PKUA 4IN9A 1RMZA 4GQLA 2J83A 1JIWP 2PJTA 4WZVA 2J0TA 3F18A 1BUVM 1HFCA 1FM1A 4PKSA 3LP9A 2EROA 2O36A 2OVXA 3VI1A 1D8FA 1IACA 4PKWA 1ROSA 4DV8A 4WKIA 1EAKA 3G5CA 4GUYA 1MMRA 2X3CA 2K9CA 4YEHA 2RJQA 4GR3A 1BUDA 1XFUA 1CGEA 3KWVC 1KUGA 1JAPA 1QUAA 1K7GA 2V5OA 1A86A 1KAPP 3G42A 1XUCA 5L79A 1GO8P 4GR8A 1R1HA 1G49A 4QKZA 1CK7A 2FV9A 4OEIA 1BSWA 2X3BA 5D1SA 1BKCA 1ZXVA 3Q2GA 2X3AA 1XURA 3USNA 1AYKA 1EB6A 1OO9A 1S4BP 4WK7A 3K7NA 1UTZA 4HMAA 1SRPA 5CXAA 3WV2A 1XFZA 5D2BA 1ZVXA 1R54A 3VTGA 3B92A 4XM6A 2MQSA 5I43A 1XFWA 3EWJA 3BA0A 1IAGA 2W12A 2OVZA 5CZMA 4HSDA 3NX7A 1IAEA 4FXQA 4GWMA 1HFSA 3P24A 1SLNA 3KRYA 1EUBA 1JIZA 1HXNA 2K2GA 3V6NA 2DDYA 2A8HA 1C8TA 3RTSA 1USNA 2POJA 3LIRA 3WV1A 2CKIA 3LQBA 2DW1A 2N8RA 1G4KA 4L19A 2I47A 3KEKA 3AYKA 3CKIA 1MMBA 3DWBA 3F17A 1A85A 2L0RA 3DSLA 1J7MA 1SATA 3HB2P 1B8YA 1OS2A 4FU4A 2E2DA 1MMPA 5LABA 1B3DA 1UTTA 2WO8A 1BIWA 3P1VA 1C3IA 3ZUKA 3TS4A 1BZSA 2QPJA 3TVCA 1IAAA 3HBUP 1H71P 1JANA 1HY7A 1GE7A 1D7XA 1GXDA 1D5JA 5B5OA 3Q2HA 1BQOA 4JQGA 1O0QA 1PWVA 2Z2DA 1ND1A 2W14A 5H8XA 1Y8JA 1XFXA 4DD8A 4WF6A 3M7PA 3I7GA 3B8ZA 3DTIA 1QJSA 1WNIA 2D1NA 3TT4A 3LILA 1D8MA 1PWWA 5CUHA 1L6JA 4ON1A 5I3MA 3DPFA 5D7WA 4FXYP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G9K A;  1CGL A;  3DNG A;  3C7X A;  3RTT A;  2OW1 A;  3V96 B;  3LJT A;  3I7I A;  4H49 A;  3EDZ A;  3KHI A;  4A3W A;  3KME A;  1OS9 A;  1HTD A;  2DDF A;  4AUO A;  1GEN A;  4PKT A;  2JNP A;  4DF9 A;  4ILW D;  4AIG A;  1AKL A;  4IUW A;  4RT6 B;  2OW0 A;  2W0D A;  1JJ9 A;  4PKR A;  1SMP A;  1GO7 P;  2Y6C A;  3LE9 A;  1CGF A;  2MZI A;  4JIJ A;  3LUN A;  1BM6 A;  1GKD A;  1CXV A;  2W15 A;  3L0V A;  2E3X A;  1ZTQ A;  3K7L A;  3F15 A;  3AIG A;  5BOT A;  1E8B A;  1CQR A;  2CLT A;  1AST A;  1HOV A;  3S18 A;  1JKY A;  2WO9 A;  1Y93 A;  4LL2 A;  1AF0 A;  1QIB A;  4DPE A;  2O3E A;  1QIA A;  1BKC E;  5I4O A;  4L63 A;  4EFS A;  2MZH A;  1Q3A A;  3DL1 A;  1I73 A;  1R55 A;  3LQ0 A;  1CAQ A;  1HV5 A;  4XCT A;  3SHI A;  2OY2 A;  2JT6 A;  1YCM A;  1UMT A;  4J4M A;  2XS4 A;  1ITV A;  3HY9 A;  3AYU A;  4IJO A;  1KUI A;  2TCL A;  4FVL A;  4GR0 A;  1QJJ A;  1YOU A;  4H1Q A;  4I35 A;  2JSD A;  4XM7 A;  3WV3 A;  4HX3 A;  4XBH A;  2MZE A;  2KRJ A;  5BPA A;  1CIZ A;  3LGP A;  3KEC A;  3F19 A;  3HY7 A;  3LUM A;  4PKV A;  4A7B A;  1JK3 A;  2MLS A;  1PWU A;  4AYK A;  2ERQ A;  1QO6 A;  1GKC A;  4JP4 A;  3L0T A;  2SRT A;  1QIC A;  3LMC A;  2Y6D A;  2OXU A;  1QHU A;  3EDI A;  3F1A A;  1DMT A;  1JAQ A;  1O0T A;  1KBC A;  1I76 A;  1Z3J A;  3O64 A;  1GE6 A;  2OI0 A;  2YB9 A;  4H30 A;  2FV5 A;  3B2Z A;  1SLM A;  3MA2 A;  2DW0 A;  1CXW A;  1G05 A;  1KUF A;  3EDH A;  3ZXH A;  2JT5 A;  3GBO A;  4G9L A;  4CTH A;  3HDA P;  4G0D A;  5I12 A;  4WKE A;  966C A;  4XM8 A;  3O2X A;  3ZVS A;  5D3C A;  4H82 A;  1KUH A;  1BKC I;  1DTH A;  3E8R A;  3LK8 A;  1JH1 A;  1G12 A;  1FBL A;  4GWN A;  1K7Q A;  4AXQ A;  2ERP A;  2AYK A;  1R1I A;  1FLS A;  1OMJ A;  1J7N A;  1IAB A;  2MLR A;  3EDG A;  1SU3 A;  456C A;  5I0L A;  3N2V A;  3UVC A;  1RTG A;  4JPA A;  4L6T A;  5I2Z A;  1PDC A;  3HDB A;  3U1R A;  2JXY A;  1ZXC A;  5L7F A;  3EHX A;  2D1O A;  2OZR A;  1OM6 A;  3LJZ A;  1PWP A;  1OM7 A;  3LJG A;  2OW9 A;  2X7M A;  1E88 A;  1OM8 A;  2OXZ A;  4GF1 A;  4H84 A;  4H3X A;  1PWQ A;  2V4B A;  2AIG P;  4Q1L A;  3HBV P;  1MMQ A;  4H76 A;  1XFV A;  2JIH A;  2OY4 A;  1QJI A;  1RM8 A;  1IAD A;  2RJP A;  3TSK A;  4H2E A;  3N2U A;  1Y0V A;  2W13 A;  2XS3 A;  3LIK A;  3ELM A;  1ZS0 A;  1XFY A;  3KMC A;  3EHY A;  3LKA A;  2HU6 A;  2DW2 A;  1KS0 A;  1C7K A;  4JA1 A;  3F16 A;  1XUD A;  1ATL A;  2FN2 A;  1H8P A;  1ZP5 A;  5JMY A;  1KUK A;  2USN A;  1R1J A;  1YQY A;  3OHL A;  3HYG A;  4I03 A;  3MQL A;  1JAO A;  3KEJ A;  5B5P A;  1UEA A;  3LEA A;  3OHO A;  1YP1 A;  3DPE A;  1PEX A;  1BQQ M;  1MNC A;  2OXW A;  4PKQ A;  2OW2 A;  4R3V A;  5BOY A;  1GE5 A;  3OYO A;  5D1U A;  1I1I P;  830C A;  5D1T A;  4ZR5 A;  2YIG A;  1UMS A;  2WOA A;  1K7I A;  4PKU A;  4IN9 A;  1RMZ A;  4GQL A;  2J83 A;  1JIW P;  2PJT A;  4WZV A;  2J0T A;  3F18 A;  1BUV M;  1HFC A;  1FM1 A;  4PKS A;  3LP9 A;  2ERO A;  2O36 A;  2OVX A;  3VI1 A;  1D8F A;  1IAC A;  4PKW A;  1ROS A;  4DV8 A;  4WKI A;  1EAK A;  3G5C A;  4GUY A;  1MMR A;  2X3C A;  2K9C A;  4YEH A;  2RJQ A;  4GR3 A;  1BUD A;  1XFU A;  1CGE A;  3KWV C;  1KUG A;  1JAP A;  1QUA A;  1K7G A;  2V5O A;  1A86 A;  1KAP P;  3G42 A;  1XUC A;  5L79 A;  1GO8 P;  4GR8 A;  1R1H A;  1G49 A;  4QKZ A;  1CK7 A;  2FV9 A;  4OEI A;  1BSW A;  2X3B A;  5D1S A;  1BKC A;  1ZXV A;  3Q2G A;  2X3A A;  1XUR A;  3USN A;  1AYK A;  1EB6 A;  1OO9 A;  1S4B P;  4WK7 A;  3K7N A;  1UTZ A;  4HMA A;  1SRP A;  5CXA A;  3WV2 A;  1XFZ A;  5D2B A;  1ZVX A;  1R54 A;  3VTG A;  3B92 A;  4XM6 A;  2MQS A;  5I43 A;  1XFW A;  3EWJ A;  3BA0 A;  1IAG A;  2W12 A;  2OVZ A;  5CZM A;  4HSD A;  3NX7 A;  1IAE A;  4FXQ A;  4GWM A;  1HFS A;  3P24 A;  1SLN A;  3KRY A;  1EUB A;  1JIZ A;  1HXN A;  2K2G A;  3V6N A;  2DDY A;  2A8H A;  1C8T A;  3RTS A;  1USN A;  2POJ A;  3LIR A;  3WV1 A;  2CKI A;  3LQB A;  2DW1 A;  2N8R A;  1G4K A;  4L19 A;  2I47 A;  3KEK A;  3AYK A;  3CKI A;  1MMB A;  3DWB A;  3F17 A;  1A85 A;  2L0R A;  3DSL A;  1J7M A;  1SAT A;  3HB2 P;  1B8Y A;  1OS2 A;  4FU4 A;  2E2D A;  1MMP A;  5LAB A;  1B3D A;  1UTT A;  2WO8 A;  1BIW A;  3P1V A;  1C3I A;  3ZUK A;  3TS4 A;  1BZS A;  2QPJ A;  3TVC A;  1IAA A;  3HBU P;  1H71 P;  1JAN A;  1HY7 A;  1GE7 A;  1D7X A;  1GXD A;  1D5J A;  5B5O A;  3Q2H A;  1BQO A;  4JQG A;  1O0Q A;  1PWV A;  2Z2D A;  1ND1 A;  2W14 A;  5H8X A;  1Y8J A;  1XFX A;  4DD8 A;  4WF6 A;  3M7P A;  3I7G A;  3B8Z A;  1QJS A;  1WNI A;  2D1N A;  3TT4 A;  3LIL A;  1D8M A;  1PWW A;  5CUH A;  1L6J A;  4ON1 A;  5I3M A;  3DPF A;  5D7W A;  4FXY P; 
#chains in the Genus database with same CATH topology
 1G9K A;  1CGL A;  3DNG A;  3C7X A;  3RTT A;  2OW1 A;  3V96 B;  3LJT A;  1GOI A;  3I7I A;  2Y2P A;  4H49 A;  3EDZ A;  3KHI A;  4A3W A;  3KME A;  1OS9 A;  4GH9 A;  1HTD A;  2DDF A;  4AUO A;  1GEN A;  1GPF A;  4PKT A;  3L25 A;  2JNP A;  4DF9 A;  4ILW D;  4AIG A;  2Y2J A;  1AKL A;  2BG1 A;  4IUW A;  4RT6 B;  2OW0 A;  2W0D A;  1JJ9 A;  4PKR A;  1SMP A;  2XD5 A;  1W1Y A;  1GO7 P;  2Y6C A;  3LE9 A;  1CGF A;  2MZI A;  4JIJ A;  3LUN A;  1BM6 A;  1GKD A;  1CXV A;  2W15 A;  3L0V A;  2E3X A;  1ZTQ A;  2Y2M A;  3K7L A;  3F15 A;  3AIG A;  5BOT A;  1E8B A;  1CQR A;  2CLT A;  3HSH A;  1AST A;  3S18 A;  1HOV A;  1JKY A;  2WO9 A;  1Y93 A;  4LL2 A;  1AF0 A;  1QIB A;  4DPE A;  2O3E A;  1QIA A;  1BKC E;  1YU2 A;  3HON A;  5I4O A;  4L63 A;  4EFS A;  2MZH A;  1Q3A A;  3DL1 A;  1I73 A;  1R55 A;  3LQ0 A;  1CAQ A;  1HV5 A;  1E6Z A;  4XCT A;  2OY2 A;  2YUF A;  3SHI A;  2JT6 A;  4IBE A;  1YCM A;  1UMT A;  2Y2K A;  4J4M A;  2XS4 A;  4IBF A;  4Z2H A;  1ITV A;  4IBJ A;  3HY9 A;  3AYU A;  4IJO A;  1KUI A;  2TCL A;  4FVL A;  4GR0 A;  1QJJ A;  1YOU A;  4H1Q A;  4NY2 A;  4I35 A;  1O6I A;  2JSD A;  4XM7 A;  4HX3 A;  3WV3 A;  4XBH A;  2MZE A;  2KRJ A;  5BPA A;  1CIZ A;  3LGP A;  3KEC A;  3F19 A;  3HY7 A;  3LUM A;  4PKV A;  4A7B A;  1JK3 A;  2MLS A;  1W1V A;  1PWU A;  4AYK A;  1H0I A;  1QO6 A;  2ERQ A;  3KS8 A;  1GKC A;  3WD0 A;  4JP4 A;  3L0T A;  2SRT A;  1QIC A;  4IBD A;  3LMC A;  2Y6D A;  4L7A A;  2OXU A;  1QHU A;  3EDI A;  3F1A A;  1DMT A;  1JAQ A;  1XM5 A;  1O0T A;  1KBC A;  1I76 A;  3L27 A;  1Z3J A;  3O64 A;  1GE6 A;  3KS4 A;  2OI0 A;  2YB9 A;  1H0G A;  4HME A;  4H30 A;  2FV5 A;  3B2Z A;  1SLM A;  3MA2 A;  2DW0 A;  3WD4 A;  1CXW A;  1G05 A;  1OGB A;  1KUF A;  1YU0 A;  3EDH A;  3ZXH A;  2JT5 A;  3GBO A;  4G9L A;  1TVI A;  3HDA P;  4CTH A;  4G0D A;  5I12 A;  4WKE A;  966C A;  4XM8 A;  3O2X A;  3ZVS A;  4IBI A;  5D3C A;  4NZ5 A;  4H82 A;  4MB5 A;  1KUH A;  1BKC I;  1DTH A;  3E8R A;  1YUE A;  3LK8 A;  1JH1 A;  1G12 A;  1FBL A;  4IBC A;  4GWN A;  1K7Q A;  4AXQ A;  2ERP A;  2Y2N A;  2AYK A;  1R1I A;  1E6P A;  1FLS A;  1OMJ A;  1J7N A;  1IAB A;  2MLR A;  3EDG A;  1SU3 A;  456C A;  5I0L A;  3N2V A;  3DTE A;  4QNL A;  1YU3 A;  4OUI A;  3UVC A;  1RTG A;  4JPA A;  4L6T A;  5I2Z A;  1PDC A;  2Y2O A;  3HDB A;  3U1R A;  2JXY A;  1ZXC A;  5L7F A;  3EHX A;  4IJE A;  2UWX A;  2D1O A;  2OZR A;  1OM6 A;  3LJZ A;  1PWP A;  1OM7 A;  4IBK A;  3LJG A;  2OW9 A;  2X7M A;  1E88 A;  1OM8 A;  1ED7 A;  2OXZ A;  4GF1 A;  4H84 A;  4H3X A;  1PWQ A;  4MB3 A;  2V4B A;  3DTK A;  2AIG P;  1E6R A;  4Q1L A;  4NZ1 A;  3HBV P;  1MMQ A;  4H76 A;  1XFV A;  4NYY A;  4Z2L A;  2JIH A;  2OY4 A;  1QJI A;  1RM8 A;  4IBB A;  4OJ5 A;  1IAD A;  3WX7 A;  2RJP A;  3TSK A;  4H2E A;  4HMC A;  3N2U A;  1Y0V A;  2W13 A;  2XS3 A;  4NYU A;  1UR9 A;  3LIK A;  3ELM A;  1ZS0 A;  2Y2G A;  1XFY A;  1YU1 A;  3KMC A;  1YU4 A;  3EHY A;  3LKA A;  4LG2 A;  2HU6 A;  2DW2 A;  1KS0 A;  1C7K A;  4JA1 A;  3F16 A;  1XUD A;  1ATL A;  2FN2 A;  1H8P A;  4OJO A;  4TX8 A;  1ZP5 A;  1KUK A;  5JMY A;  2USN A;  1YQY A;  1R1J A;  3OHL A;  1XAX A;  3HYG A;  4I03 A;  1OGG A;  3MQL A;  1JAO A;  3KEJ A;  5B5P A;  1UEA A;  3LEA A;  3OHO A;  1YP1 A;  3DPE A;  1PEX A;  3WD1 A;  1BQQ M;  1MNC A;  2OXW A;  1UR8 A;  4PKQ A;  2OW2 A;  4R3V A;  4NZ3 A;  5BOY A;  1GE5 A;  3L2A A;  1W1P A;  3OYO A;  5D1U A;  1I1I P;  830C A;  5D1T A;  4ZR5 A;  2YIG A;  3L29 A;  1UMS A;  2WOA A;  1K7I A;  4PKU A;  4IN9 A;  4GHA A;  1RMZ A;  4GQL A;  2J83 A;  3L28 A;  1JIW P;  2PJT A;  3L26 A;  4WZV A;  2J0T A;  3F18 A;  1BUV M;  1HFC A;  1FM1 A;  4PKS A;  3LP9 A;  2ERO A;  2O36 A;  2OVX A;  3VI1 A;  2RTS A;  1D8F A;  1IAC A;  4PKW A;  4OJP A;  1E6N A;  2Y2I A;  1ROS A;  4DV8 A;  4WKI A;  1EAK A;  3G5C A;  4GUY A;  1MMR A;  2X3C A;  2K9C A;  4YEH A;  2RJQ A;  1W1T A;  4GR3 A;  1BUD A;  1XFU A;  2FFF B;  1CGE A;  3KWV C;  1KUG A;  1JAP A;  1QUA A;  3WD2 A;  1K7G A;  2V5O A;  1A86 A;  1KAP P;  3G42 A;  1XUC A;  5L79 A;  1GO8 P;  2Y2Q A;  4GR8 A;  1R1H A;  1G49 A;  4QKZ A;  1CK7 A;  2FV9 A;  4OEI A;  1BSW A;  2X3B A;  5D1S A;  1BKC A;  1ZXV A;  3Q2G A;  2X3A A;  1XUR A;  1E15 A;  3USN A;  1AYK A;  1EB6 A;  1OO9 A;  1S4B P;  4WK7 A;  3K7N A;  2XD1 A;  1UTZ A;  4HMA A;  1SRP A;  5CXA A;  3WV2 A;  1XFZ A;  4Z2G A;  2JE5 A;  5D2B A;  2IOU A;  1ZVX A;  1R54 A;  3VTG A;  3B92 A;  4XM6 A;  2MQS A;  5I43 A;  1XFW A;  3EWJ A;  3BA0 A;  1IAG A;  4Z2K A;  2W12 A;  2OVZ A;  2Y2L A;  3WD3 A;  4Z2J A;  5CZM A;  4HSD A;  3NX7 A;  4MB4 A;  1IAE A;  4FXQ A;  4HMD A;  4GWM A;  1HFS A;  3P24 A;  1OZ9 A;  1SLN A;  3KRY A;  1EUB A;  1JIZ A;  2Y2H A;  1HXN A;  2K2G A;  3V6N A;  2DDY A;  2A8H A;  1C8T A;  3N3F A;  1USN A;  3RTS A;  2POJ A;  3LIR A;  3WV1 A;  2CKI A;  3FKE A;  3LQB A;  5BPV A;  2DW1 A;  1G4K A;  2N8R A;  4L19 A;  2I47 A;  3KEK A;  3AYK A;  3CKI A;  1MMB A;  3DWB A;  3F17 A;  1A85 A;  4IBG A;  2L0R A;  3DSL A;  1J7M A;  1SAT A;  4Z2I A;  3HB2 P;  1B8Y A;  1OS2 A;  4FU4 A;  2E2D A;  1MMP A;  5LAB A;  1B3D A;  1UTT A;  2WO8 A;  1BIW A;  3P1V A;  1C3I A;  3ZUK A;  3TS4 A;  1BZS A;  2QPJ A;  3TVC A;  1IAA A;  3HBU P;  1H71 P;  1JAN A;  1HY7 A;  1GE7 A;  1D7X A;  1GXD A;  1D5J A;  5B5O A;  4NZ4 A;  3Q2H A;  4GHL A;  1BQO A;  4IJF A;  4JQG A;  1O0Q A;  1PWV A;  2Z2D A;  4OJL A;  1ND1 A;  2W14 A;  5H8X A;  1Y8J A;  1XFX A;  4DD8 A;  2JCH A;  4WF6 A;  3M7P A;  4OJ6 A;  3I7G A;  1QJS A;  3B8Z A;  3DTI A;  1WNI A;  2D1N A;  3TT4 A;  2D49 A;  3LIL A;  1D8M A;  1AIW A;  1PWW A;  5CUH A;  1L6J A;  4ON1 A;  5I3M A;  3DPF A;  5D7W A;  4FXY P; 
#chains in the Genus database with same CATH homology
 1G9K A;  1CGL A;  3DNG A;  3C7X A;  3RTT A;  2OW1 A;  3V96 B;  3LJT A;  3I7I A;  4H49 A;  3EDZ A;  3KHI A;  4A3W A;  3KME A;  1OS9 A;  1HTD A;  2DDF A;  4AUO A;  1GEN A;  4PKT A;  2JNP A;  4DF9 A;  4ILW D;  4AIG A;  1AKL A;  4IUW A;  4RT6 B;  2OW0 A;  2W0D A;  1JJ9 A;  4PKR A;  1SMP A;  1GO7 P;  2Y6C A;  3LE9 A;  1CGF A;  2MZI A;  4JIJ A;  3LUN A;  1BM6 A;  1GKD A;  1CXV A;  2W15 A;  3L0V A;  2E3X A;  1ZTQ A;  3K7L A;  3F15 A;  3AIG A;  5BOT A;  1E8B A;  1CQR A;  2CLT A;  1AST A;  1HOV A;  3S18 A;  1JKY A;  2WO9 A;  1Y93 A;  4LL2 A;  1AF0 A;  1QIB A;  4DPE A;  2O3E A;  1QIA A;  1BKC E;  5I4O A;  4L63 A;  4EFS A;  2MZH A;  1Q3A A;  3DL1 A;  1I73 A;  1R55 A;  3LQ0 A;  1CAQ A;  1HV5 A;  4XCT A;  3SHI A;  2YUF A;  2OY2 A;  2JT6 A;  1YCM A;  1UMT A;  4J4M A;  2XS4 A;  1ITV A;  3HY9 A;  3AYU A;  4IJO A;  1KUI A;  2TCL A;  4FVL A;  4GR0 A;  1QJJ A;  1YOU A;  4H1Q A;  4I35 A;  2JSD A;  4XM7 A;  3WV3 A;  4HX3 A;  4XBH A;  2MZE A;  2KRJ A;  5BPA A;  1CIZ A;  3LGP A;  3KEC A;  3F19 A;  3HY7 A;  3LUM A;  4PKV A;  4A7B A;  1JK3 A;  2MLS A;  1PWU A;  4AYK A;  2ERQ A;  1QO6 A;  1GKC A;  4JP4 A;  3L0T A;  2SRT A;  1QIC A;  3LMC A;  2Y6D A;  4L7A A;  2OXU A;  1QHU A;  3EDI A;  3F1A A;  1DMT A;  1JAQ A;  1O0T A;  1KBC A;  1I76 A;  1Z3J A;  3O64 A;  1GE6 A;  2OI0 A;  2YB9 A;  4H30 A;  2FV5 A;  3B2Z A;  1SLM A;  3MA2 A;  2DW0 A;  1CXW A;  1G05 A;  1KUF A;  3EDH A;  3ZXH A;  2JT5 A;  3GBO A;  4G9L A;  4CTH A;  3HDA P;  4G0D A;  5I12 A;  4WKE A;  966C A;  4XM8 A;  3O2X A;  3ZVS A;  5D3C A;  4H82 A;  1KUH A;  1BKC I;  1DTH A;  3E8R A;  3LK8 A;  1JH1 A;  1G12 A;  1FBL A;  4GWN A;  1K7Q A;  4AXQ A;  2ERP A;  2AYK A;  1R1I A;  1FLS A;  1OMJ A;  1J7N A;  1IAB A;  2MLR A;  3EDG A;  1SU3 A;  456C A;  5I0L A;  3N2V A;  3DTE A;  3UVC A;  1RTG A;  4JPA A;  4L6T A;  5I2Z A;  1PDC A;  3HDB A;  3U1R A;  2JXY A;  1ZXC A;  5L7F A;  3EHX A;  2D1O A;  2OZR A;  1OM6 A;  3LJZ A;  1PWP A;  1OM7 A;  3LJG A;  2OW9 A;  2X7M A;  1E88 A;  1OM8 A;  2OXZ A;  4GF1 A;  4H84 A;  4H3X A;  1PWQ A;  2V4B A;  3DTK A;  2AIG P;  4Q1L A;  3HBV P;  1MMQ A;  4H76 A;  1XFV A;  2JIH A;  2OY4 A;  1QJI A;  1RM8 A;  1IAD A;  2RJP A;  3TSK A;  4H2E A;  3N2U A;  1Y0V A;  2W13 A;  2XS3 A;  3LIK A;  3ELM A;  1ZS0 A;  1XFY A;  3KMC A;  3EHY A;  3LKA A;  2HU6 A;  2DW2 A;  1KS0 A;  1C7K A;  4JA1 A;  3F16 A;  1XUD A;  1ATL A;  2FN2 A;  1H8P A;  1ZP5 A;  5JMY A;  1KUK A;  2USN A;  1R1J A;  1YQY A;  3OHL A;  3HYG A;  4I03 A;  3MQL A;  1JAO A;  3KEJ A;  5B5P A;  1UEA A;  3LEA A;  3OHO A;  1YP1 A;  3DPE A;  1PEX A;  1BQQ M;  1MNC A;  2OXW A;  4PKQ A;  2OW2 A;  4R3V A;  5BOY A;  1GE5 A;  3OYO A;  5D1U A;  1I1I P;  830C A;  5D1T A;  4ZR5 A;  2YIG A;  1UMS A;  2WOA A;  1K7I A;  4PKU A;  4IN9 A;  1RMZ A;  4GQL A;  2J83 A;  1JIW P;  2PJT A;  4WZV A;  2J0T A;  3F18 A;  1BUV M;  1HFC A;  1FM1 A;  4PKS A;  3LP9 A;  2ERO A;  2O36 A;  2OVX A;  3VI1 A;  1D8F A;  1IAC A;  4PKW A;  1ROS A;  4DV8 A;  4WKI A;  1EAK A;  3G5C A;  4GUY A;  1MMR A;  2X3C A;  2K9C A;  4YEH A;  2RJQ A;  4GR3 A;  1BUD A;  1XFU A;  1CGE A;  3KWV C;  1KUG A;  1JAP A;  1QUA A;  1K7G A;  2V5O A;  1A86 A;  1KAP P;  3G42 A;  1XUC A;  5L79 A;  1GO8 P;  4GR8 A;  1R1H A;  1G49 A;  4QKZ A;  1CK7 A;  2FV9 A;  4OEI A;  1BSW A;  2X3B A;  5D1S A;  1BKC A;  1ZXV A;  3Q2G A;  2X3A A;  1XUR A;  3USN A;  1AYK A;  1EB6 A;  1OO9 A;  1S4B P;  4WK7 A;  3K7N A;  1UTZ A;  4HMA A;  1SRP A;  5CXA A;  3WV2 A;  1XFZ A;  5D2B A;  1ZVX A;  1R54 A;  3VTG A;  3B92 A;  4XM6 A;  2MQS A;  5I43 A;  1XFW A;  3EWJ A;  3BA0 A;  1IAG A;  2W12 A;  2OVZ A;  5CZM A;  4HSD A;  3NX7 A;  1IAE A;  4FXQ A;  4GWM A;  1HFS A;  3P24 A;  1SLN A;  3KRY A;  1EUB A;  1JIZ A;  1HXN A;  2K2G A;  3V6N A;  2DDY A;  2A8H A;  1C8T A;  3RTS A;  1USN A;  2POJ A;  3LIR A;  3WV1 A;  2CKI A;  3LQB A;  2DW1 A;  2N8R A;  1G4K A;  4L19 A;  2I47 A;  3KEK A;  3AYK A;  3CKI A;  1MMB A;  3DWB A;  3F17 A;  1A85 A;  2L0R A;  3DSL A;  1J7M A;  1SAT A;  3HB2 P;  1B8Y A;  1OS2 A;  4FU4 A;  2E2D A;  1MMP A;  5LAB A;  1B3D A;  1UTT A;  2WO8 A;  1BIW A;  3P1V A;  1C3I A;  3ZUK A;  3TS4 A;  1BZS A;  2QPJ A;  3TVC A;  1IAA A;  3HBU P;  1H71 P;  1JAN A;  1HY7 A;  1GE7 A;  1D7X A;  1GXD A;  1D5J A;  5B5O A;  3Q2H A;  1BQO A;  4JQG A;  1O0Q A;  1PWV A;  2Z2D A;  1ND1 A;  2W14 A;  5H8X A;  1Y8J A;  1XFX A;  4DD8 A;  4WF6 A;  3M7P A;  3I7G A;  3B8Z A;  3DTI A;  1QJS A;  1WNI A;  2D1N A;  3TT4 A;  3LIL A;  1D8M A;  1PWW A;  5CUH A;  1L6J A;  4ON1 A;  5I3M A;  3DPF A;  5D7W A;  4FXY P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...