4AUOA

Crystal structure of mmp-1(e200a) in complex with a triple-helical collagen peptide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
367
structure length
367
Chain Sequence
FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHALGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERSTITIAL COLLAGENASE
publication title Structural Insights Into Triple-Helical Collagen Cleavage by Matrix Metalloproteinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
total genus 81
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 4auoA02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4auoA01
4GR0A 3TS4A 5CXAA 3HY7A 2A8HA 2ERQA 3TT4A 1GE6A 2J0TA 2ERPA 1D5JA 4DF9A 5BOTA 3AYUA 5L79A 1ZXVA 1HXNA 4XCTA 3TVCA 1D8MA 1BQQM 1I73A 1ZXCA 1AF0A 1C3IA 2PJTA 2DW1A 3U1RA 3KWVC 2MZIA 3LKAA 1OM6A 1D8FA 2DDFA 2JIHA 1QJSA 1GE7A 3B8ZA 1UTTA 4PKRA 3G5CA 2MZHA 5D2BA 1SLMA 1XFXA 4IJOA 3LK8A 1PWWA 5I2ZA 1YCMA 1G05A 5I12A 4GR8A 3F17A 830CA 2MLRA 3ZVSA 1DTHA 1JAQA 3LGPA 3OYOA 2OXWA 2DW2A 1G9KA 3NX7A 1J7NA 3LJTA 4L63A 1HV5A 3SHIA 2OW9A 3Q2HA 1BZSA 1JKYA 4JIJA 1DMTA 1KAPP 3KMCA 3V96B 4H76A 4JQGA 4PKUA 1XFUA 1MMRA 3ZUKA 1Y8JA 4HSDA 2K2GA 4HX3A 1ATLA 1SMPA 3LQBA 5BPAA 3EDHA 4JA1A 2JSDA 3RTTA 2OXZA 3BA0A 5D1TA 1PWUA 2OXUA 1QIBA 1XFVA 1OM8A 3P24A 4WZVA 1GKCA 3HDBA 3F15A 3UVCA 4GF1A 4XBHA 1CGLA 2OVZA 3GBOA 3I7IA 5L7FA 2W0DA 5D1UA 1JAOA 2OI0A 1GE5A 4H49A 2OW1A 3ELMA 4FVLA 4H1QA 4AXQA 1JJ9A 3LIKA 3N2UA 1QIAA 1EAKA 2CKIA 3EHYA 3G42A 2QPJA 1KUHA 1ND1A 1BUDA 1IAAA 3B92A 4WF6A 2HU6A 1UTZA 3VTGA 2E2DA 2EROA 3AYKA 4Q1LA 5D7WA 1CIZA 2K9CA 3AIGA 1OS9A 1ZP5A 4WKEA 1QUAA 2WOAA 1K7GA 5LABA 1YQYA 4PKQA 3LMCA 1KBCA 4WKIA 1GKDA 3WV1A 4FU4A 1O0TA 2X3CA 1RM8A 5H8XA 1PEXA 1G49A 1A86A 3LE9A 2I47A 2X3BA 3WV2A 2W13A 1BM6A 4DD8A 2FV9A 1GXDA 2W15A 2FV5A 4G9LA 1GO7P 5I0LA 1IAGA 3KMEA 5CZMA 1R1HA 4H3XA 4WK7A 3ZXHA 1UEAA 4IN9A 3HBVP 2Y6DA 1EUBA 2OY4A 4DV8A 1FLSA 3HYGA 4GR3A 1BUVM 1CAQA 1ZTQA 2OZRA 2W12A 1R1JA 1FBLA 1KUKA 3MA2A 1R1IA 3RTSA 4XM6A 1SRPA 2L0RA 4ILWD 4DPEA 1I1IP 3F18A 1HOVA 5D1SA 4H2EA 2MZEA 1O0QA 3F16A 2D1OA 5JMYA 1QJIA 4PKSA 2MQSA 4RT6B 456CA 1GENA 1JIZA 4G0DA 3DWBA 4GQLA 3LJGA 1CGFA 1UMTA 2TCLA 3EDGA 1UMSA 4GUYA 3DL1A 3V6NA 3N2VA 4A7BA 1YP1A 4H82A 3O64A 1XUDA 1SU3A 2KRJA 1BIWA 1IADA 3LIRA 4IUWA 3B2ZA 2YB9A 4PKWA 1L6JA 4AYKA 4GWMA 5CUHA 4FXQA 3C7XA 1ITVA 1BSWA 1SLNA 4XM7A 966CA 1Y93A 1H71P 1K7QA 3OHLA 1JAPA 1A85A 1I76A 2O36A 1SATA 2XS3A 3EWJA 4I35A 3KECA 1MNCA 4A3WA 3KHIA 1S4BP 3I7GA 1MMQA 1OM7A 3S18A 3LP9A 3K7NA 3DPFA 1OMJA 2RJPA 1KUIA 3HBUP 1JH1A 5I3MA 1YOUA 1G12A 1BQOA 3L0TA 2POJA 1G4KA 4YEHA 3F1AA 2D1NA 1ZVXA 4HMAA 2SRTA 4EFSA 1RTGA 3LEAA 5BOYA 1ASTA 2AYKA 1C8TA 4JPAA 3L0VA 1OS2A 1FM1A 1KUGA 1QHUA 5B5PA 5I4OA 3LQ0A 1AYKA 3LUMA 1BKCA 2XS4A 4FXYP 1HFSA 2RJQA 1PWQA 3EDZA 2DW0A 4CTHA 1CK7A 3KEKA 4XM8A 2W14A 2N8RA 3HDAP 3HY9A 3LUNA 3DSLA 4I03A 2JNPA 1ZS0A 1MMBA 1K7IA 3USNA 3KRYA 1QICA 2OW2A 1JK3A 1JIWP 1BKCI 1C7KA 3EDIA 3O2XA 3TSKA 3DPEA 1R55A 4H30A 2X3AA 4L19A 1MMPA 1IAEA 1CGEA 2Z2DA 1PWVA 1XFYA 4PKVA 1Q3AA 1B3DA 4AIGA 1USNA 2AIGP 2E3XA 5D3CA 1CXVA 2JT5A 1HTDA 1XURA 2YIGA 5B5OA 1HFCA 2WO9A 3CKIA 4GWNA 3OHOA 3E8RA 4H84A 1D7XA 3EHXA 3HB2P 1OO9A 2OVXA 1BKCE 1IACA 2JT6A 1GO8P 1Y0VA 2MLSA 2DDYA 4ON1A 3K7LA 3LILA 2OW0A 5I43A 4J4MA 2X7MA 3P1VA 4LL2A 4JP4A 1KUFA 3Q2GA 1B8YA 1XFZA 1RMZA 4L6TA 1XFWA 2OY2A 1ROSA 2WO8A 1IABA 1JANA 1XUCA 2J83A 2USNA 4AUOA 3KEJA 1HY7A 1AKLA 1EB6A 1PWPA 1CQRA 2O3EA 2CLTA 4R3VA 1R54A 2Y6CA 4QKZA 1QJJA 3VI1A 2JXYA 4OEIA 3DNGA 3WV3A 3LJZA 4PKTA 3F19A 4ZR5A 1WNIA 2V4BA 1Z3JA
chains in the Genus database with same CATH superfamily
4GR0A 3TS4A 5CXAA 3HY7A 2A8HA 2ERQA 3TT4A 1XM5A 1GE6A 2J0TA 2ERPA 1D5JA 4DF9A 5BOTA 3AYUA 2YUFA 5L79A 1ZXVA 1HXNA 4XCTA 3TVCA 1D8MA 1BQQM 1I73A 1ZXCA 1AF0A 1C3IA 2PJTA 2DW1A 3U1RA 3KWVC 2MZIA 3LKAA 1OM6A 1D8FA 2DDFA 2JIHA 1QJSA 1GE7A 3B8ZA 1UTTA 4PKRA 3G5CA 2MZHA 5D2BA 1SLMA 1XFXA 4IJOA 3LK8A 1PWWA 5I2ZA 1YCMA 1G05A 5I12A 4GR8A 3F17A 830CA 2MLRA 3ZVSA 1DTHA 1JAQA 3LGPA 3OYOA 2OXWA 2DW2A 1G9KA 3NX7A 1J7NA 3LJTA 4L63A 1HV5A 3SHIA 2OW9A 3DTIA 3Q2HA 1BZSA 1JKYA 4JIJA 1DMTA 1KAPP 3KMCA 3V96B 4H76A 4JQGA 4PKUA 1XFUA 1MMRA 3ZUKA 1Y8JA 4HSDA 2K2GA 4HX3A 1ATLA 1SMPA 3LQBA 5BPAA 3EDHA 4JA1A 2JSDA 3RTTA 2OXZA 3BA0A 5D1TA 1PWUA 2OXUA 1QIBA 1XFVA 1OM8A 3P24A 4WZVA 1GKCA 3HDBA 3F15A 3UVCA 4GF1A 4XBHA 1CGLA 2OVZA 3GBOA 3I7IA 5L7FA 2W0DA 5D1UA 1JAOA 2OI0A 1GE5A 4H49A 2OW1A 3ELMA 4FVLA 4H1QA 4AXQA 1JJ9A 3LIKA 3N2UA 1QIAA 1EAKA 2CKIA 3EHYA 3G42A 2QPJA 1KUHA 1ND1A 1BUDA 1IAAA 3B92A 4WF6A 2HU6A 1UTZA 3VTGA 2E2DA 2EROA 3AYKA 4Q1LA 5D7WA 1CIZA 2K9CA 3AIGA 1OS9A 1ZP5A 4WKEA 1OZ9A 1QUAA 2WOAA 1K7GA 5LABA 1YQYA 4PKQA 3LMCA 1KBCA 4WKIA 1GKDA 3WV1A 4FU4A 1O0TA 2X3CA 1RM8A 5H8XA 1PEXA 1G49A 1A86A 3LE9A 2I47A 2X3BA 3WV2A 2W13A 1BM6A 4DD8A 2FV9A 1GXDA 2W15A 2FV5A 4G9LA 1GO7P 5I0LA 1IAGA 3KMEA 5CZMA 1R1HA 4H3XA 4WK7A 3ZXHA 1UEAA 4IN9A 3HBVP 2Y6DA 1EUBA 2OY4A 4DV8A 1FLSA 3HYGA 4GR3A 1BUVM 1TVIA 1CAQA 1ZTQA 2OZRA 2W12A 1R1JA 1FBLA 1KUKA 3MA2A 1R1IA 3RTSA 4XM6A 1SRPA 2L0RA 4ILWD 4DPEA 1I1IP 3F18A 1HOVA 5D1SA 4H2EA 2MZEA 1O0QA 3F16A 2D1OA 5JMYA 1QJIA 4PKSA 2MQSA 4RT6B 456CA 1GENA 1JIZA 4G0DA 3DWBA 4GQLA 3LJGA 1CGFA 1UMTA 2TCLA 3EDGA 1UMSA 4GUYA 3DL1A 3V6NA 3N2VA 4A7BA 1YP1A 4H82A 3O64A 1XUDA 1SU3A 2KRJA 1BIWA 1IADA 3LIRA 4IUWA 3B2ZA 2YB9A 4PKWA 1L6JA 4AYKA 4GWMA 5CUHA 4FXQA 3C7XA 1ITVA 1BSWA 1SLNA 4L7AA 4XM7A 966CA 1Y93A 1H71P 1K7QA 3OHLA 1JAPA 1A85A 1I76A 2O36A 1SATA 2XS3A 3EWJA 4I35A 3KECA 1MNCA 4A3WA 3KHIA 1S4BP 3DTEA 3I7GA 1MMQA 1OM7A 3S18A 3LP9A 3K7NA 3DPFA 1OMJA 2RJPA 1KUIA 3HBUP 1JH1A 5I3MA 1YOUA 1G12A 1BQOA 3L0TA 2POJA 1G4KA 4YEHA 3F1AA 2D1NA 1ZVXA 4HMAA 2SRTA 4EFSA 1RTGA 3LEAA 5BOYA 1ASTA 2AYKA 1C8TA 4JPAA 3L0VA 1OS2A 1FM1A 1KUGA 1QHUA 5B5PA 5I4OA 3LQ0A 1AYKA 3LUMA 1BKCA 2XS4A 4FXYP 1HFSA 1XAXA 2RJQA 1PWQA 3EDZA 2DW0A 4CTHA 1CK7A 3KEKA 4XM8A 2W14A 2N8RA 3HDAP 3HY9A 3LUNA 3DSLA 4I03A 2JNPA 1ZS0A 1MMBA 1K7IA 3USNA 3KRYA 1QICA 2OW2A 1JK3A 1JIWP 1BKCI 1C7KA 3EDIA 3O2XA 3TSKA 3DPEA 1R55A 4H30A 2X3AA 4L19A 1MMPA 1IAEA 1CGEA 2Z2DA 1PWVA 1XFYA 4PKVA 1Q3AA 1B3DA 4AIGA 1USNA 2AIGP 2E3XA 5D3CA 1CXVA 2JT5A 1HTDA 1XURA 2YIGA 5B5OA 1HFCA 2WO9A 3CKIA 4GWNA 3OHOA 3E8RA 4H84A 1D7XA 3EHXA 3HB2P 1OO9A 2OVXA 1BKCE 1IACA 2JT6A 1GO8P 1Y0VA 2MLSA 2DDYA 4ON1A 3K7LA 3LILA 2OW0A 5I43A 4J4MA 2X7MA 3P1VA 4LL2A 4JP4A 1KUFA 3Q2GA 1B8YA 1XFZA 1RMZA 4L6TA 1XFWA 2OY2A 1ROSA 2WO8A 1IABA 1JANA 1XUCA 2J83A 2USNA 4AUOA 3KEJA 1HY7A 1AKLA 1EB6A 1PWPA 1CQRA 2O3EA 2CLTA 4R3VA 1R54A 2Y6CA 4QKZA 1QJJA 3VI1A 2JXYA 4OEIA 3DNGA 3WV3A 3LJZA 3DTKA 4PKTA 3F19A 4ZR5A 1WNIA 2V4BA 1Z3JA
chains in the Genus database with same CATH topology
4GR0A 3TS4A 5CXAA 3HY7A 2A8HA 2ERQA 3TT4A 1GE6A 2J0TA 2ERPA 1D5JA 4DF9A 5BOTA 3AYUA 2YUFA 5L79A 1ZXVA 1HXNA 4XCTA 3TVCA 1D8MA 1BQQM 1I73A 1ZXCA 1AF0A 1C3IA 2PJTA 2DW1A 3U1RA 3KWVC 2MZIA 3LKAA 1OM6A 1D8FA 2DDFA 2JIHA 1QJSA 1GE7A 3B8ZA 1UTTA 4PKRA 3G5CA 2MZHA 5D2BA 1SLMA 1XFXA 4IJOA 3LK8A 1PWWA 5I2ZA 1YCMA 1G05A 5I12A 4GR8A 3F17A 830CA 2MLRA 3ZVSA 1DTHA 1JAQA 3LGPA 3OYOA 2OXWA 2DW2A 1G9KA 3NX7A 1J7NA 3LJTA 4L63A 1HV5A 3SHIA 2OW9A 3DTIA 3Q2HA 1BZSA 1JKYA 4JIJA 1DMTA 1KAPP 3KMCA 3V96B 4H76A 4JQGA 4PKUA 1XFUA 1MMRA 3ZUKA 1Y8JA 4HSDA 2K2GA 4HX3A 1ATLA 1SMPA 3LQBA 5BPAA 3EDHA 4JA1A 2JSDA 3RTTA 2OXZA 3BA0A 5D1TA 1PWUA 2OXUA 1QIBA 1XFVA 1OM8A 3P24A 4WZVA 1GKCA 3HDBA 3F15A 3UVCA 4GF1A 4XBHA 1CGLA 2OVZA 3GBOA 3I7IA 5L7FA 2W0DA 5D1UA 1JAOA 2OI0A 1GE5A 4H49A 2OW1A 3ELMA 4FVLA 4H1QA 4AXQA 1JJ9A 3LIKA 3N2UA 1QIAA 1EAKA 2CKIA 3EHYA 3G42A 2QPJA 1KUHA 1ND1A 1BUDA 1IAAA 3B92A 4WF6A 2HU6A 1UTZA 3VTGA 2E2DA 2EROA 3AYKA 4Q1LA 5D7WA 1CIZA 2K9CA 3AIGA 1OS9A 1ZP5A 4WKEA 1QUAA 2WOAA 1K7GA 5LABA 1YQYA 4PKQA 3LMCA 1KBCA 4WKIA 1GKDA 3WV1A 4FU4A 1O0TA 2X3CA 1RM8A 5H8XA 1PEXA 1G49A 1A86A 3LE9A 2I47A 2X3BA 3WV2A 2W13A 1BM6A 4DD8A 2FV9A 1GXDA 2W15A 2FV5A 4G9LA 1GO7P 5I0LA 1IAGA 3KMEA 5CZMA 1R1HA 4H3XA 4WK7A 3ZXHA 1UEAA 4IN9A 3HBVP 2Y6DA 1EUBA 2OY4A 4DV8A 1FLSA 3HYGA 4GR3A 1BUVM 1CAQA 1ZTQA 2OZRA 2W12A 1R1JA 1FBLA 1KUKA 3MA2A 1R1IA 3RTSA 4XM6A 1SRPA 2L0RA 4ILWD 4DPEA 1I1IP 3F18A 1HOVA 5D1SA 4H2EA 2MZEA 1O0QA 3F16A 2D1OA 5JMYA 1QJIA 4PKSA 2MQSA 4RT6B 456CA 1GENA 1JIZA 4G0DA 3DWBA 4GQLA 3LJGA 1CGFA 1UMTA 2TCLA 3EDGA 1UMSA 4GUYA 3DL1A 3V6NA 3N2VA 4A7BA 1YP1A 4H82A 3O64A 1XUDA 1SU3A 2KRJA 1BIWA 1IADA 3LIRA 4IUWA 3B2ZA 2YB9A 4PKWA 1L6JA 4AYKA 4GWMA 5CUHA 4FXQA 3C7XA 1ITVA 1BSWA 1SLNA 4L7AA 4XM7A 966CA 1Y93A 1H71P 1K7QA 3OHLA 1JAPA 1A85A 1I76A 2O36A 1SATA 2XS3A 3EWJA 4I35A 3KECA 1MNCA 4A3WA 3KHIA 1S4BP 3DTEA 3I7GA 1MMQA 1OM7A 3S18A 3LP9A 3K7NA 3DPFA 1OMJA 2RJPA 1KUIA 3HBUP 1JH1A 5I3MA 1YOUA 1G12A 1BQOA 3L0TA 2POJA 1G4KA 4YEHA 3F1AA 2D1NA 1ZVXA 4HMAA 2SRTA 4EFSA 1RTGA 3LEAA 5BOYA 1ASTA 2AYKA 1C8TA 4JPAA 3L0VA 1OS2A 1FM1A 1KUGA 1QHUA 5B5PA 5I4OA 3LQ0A 1AYKA 3LUMA 1BKCA 2XS4A 4FXYP 1HFSA 2RJQA 1PWQA 3EDZA 2DW0A 4CTHA 1CK7A 3KEKA 4XM8A 2W14A 2N8RA 3HDAP 3HY9A 3LUNA 3DSLA 4I03A 2JNPA 1ZS0A 1MMBA 1K7IA 3USNA 3KRYA 1QICA 2OW2A 1JK3A 1JIWP 1BKCI 1C7KA 3EDIA 3O2XA 3TSKA 3DPEA 1R55A 4H30A 2X3AA 4L19A 1MMPA 1IAEA 1CGEA 2Z2DA 1PWVA 1XFYA 4PKVA 1Q3AA 1B3DA 4AIGA 1USNA 2AIGP 2E3XA 5D3CA 1CXVA 2JT5A 1HTDA 1XURA 2YIGA 5B5OA 1HFCA 2WO9A 3CKIA 4GWNA 3OHOA 3E8RA 4H84A 1D7XA 3EHXA 3HB2P 1OO9A 2OVXA 1BKCE 1IACA 2JT6A 1GO8P 1Y0VA 2MLSA 2DDYA 4ON1A 3K7LA 3LILA 2OW0A 5I43A 4J4MA 2X7MA 3P1VA 4LL2A 4JP4A 1KUFA 3Q2GA 1B8YA 1XFZA 1RMZA 4L6TA 1XFWA 2OY2A 1ROSA 2WO8A 1IABA 1JANA 1XUCA 2J83A 2USNA 4AUOA 3KEJA 1HY7A 1AKLA 1EB6A 1PWPA 1CQRA 2O3EA 2CLTA 4R3VA 1R54A 2Y6CA 4QKZA 1QJJA 3VI1A 2JXYA 4OEIA 3DNGA 3WV3A 3LJZA 3DTKA 4PKTA 3F19A 4ZR5A 1WNIA 2V4BA 1Z3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR0 A;  3TS4 A;  5CXA A;  3HY7 A;  2A8H A;  2ERQ A;  3TT4 A;  1GE6 A;  2J0T A;  2ERP A;  1D5J A;  4DF9 A;  5BOT A;  3AYU A;  5L79 A;  1ZXV A;  1HXN A;  4XCT A;  3TVC A;  1D8M A;  1BQQ M;  1I73 A;  1ZXC A;  1AF0 A;  1C3I A;  2PJT A;  2DW1 A;  3U1R A;  3KWV C;  2MZI A;  3LKA A;  1OM6 A;  1D8F A;  2DDF A;  2JIH A;  1QJS A;  1GE7 A;  3B8Z A;  1UTT A;  4PKR A;  3G5C A;  2MZH A;  5D2B A;  1SLM A;  1XFX A;  4IJO A;  3LK8 A;  1PWW A;  5I2Z A;  1YCM A;  1G05 A;  5I12 A;  4GR8 A;  3F17 A;  830C A;  2MLR A;  3ZVS A;  1DTH A;  1JAQ A;  3LGP A;  3OYO A;  2OXW A;  2DW2 A;  1G9K A;  3NX7 A;  1J7N A;  3LJT A;  4L63 A;  1HV5 A;  3SHI A;  2OW9 A;  3Q2H A;  1BZS A;  1JKY A;  4JIJ A;  1DMT A;  1KAP P;  3KMC A;  3V96 B;  4H76 A;  4JQG A;  4PKU A;  1XFU A;  1MMR A;  3ZUK A;  1Y8J A;  4HSD A;  2K2G A;  4HX3 A;  1ATL A;  1SMP A;  3LQB A;  5BPA A;  3EDH A;  4JA1 A;  2JSD A;  3RTT A;  2OXZ A;  3BA0 A;  5D1T A;  1PWU A;  2OXU A;  1QIB A;  1XFV A;  1OM8 A;  3P24 A;  4WZV A;  1GKC A;  3HDB A;  3F15 A;  3UVC A;  4GF1 A;  4XBH A;  1CGL A;  2OVZ A;  3GBO A;  3I7I A;  5L7F A;  2W0D A;  5D1U A;  1JAO A;  2OI0 A;  1GE5 A;  4H49 A;  2OW1 A;  3ELM A;  4FVL A;  4H1Q A;  4AXQ A;  1JJ9 A;  3LIK A;  3N2U A;  1QIA A;  1EAK A;  2CKI A;  3EHY A;  3G42 A;  2QPJ A;  1KUH A;  1ND1 A;  1BUD A;  1IAA A;  3B92 A;  4WF6 A;  2HU6 A;  1UTZ A;  3VTG A;  2E2D A;  2ERO A;  3AYK A;  4Q1L A;  5D7W A;  1CIZ A;  2K9C A;  3AIG A;  1OS9 A;  1ZP5 A;  4WKE A;  1QUA A;  2WOA A;  1K7G A;  5LAB A;  1YQY A;  4PKQ A;  3LMC A;  1KBC A;  4WKI A;  1GKD A;  3WV1 A;  4FU4 A;  1O0T A;  2X3C A;  1RM8 A;  5H8X A;  1PEX A;  1G49 A;  1A86 A;  3LE9 A;  2I47 A;  2X3B A;  3WV2 A;  2W13 A;  1BM6 A;  4DD8 A;  2FV9 A;  1GXD A;  2W15 A;  2FV5 A;  4G9L A;  1GO7 P;  5I0L A;  1IAG A;  3KME A;  5CZM A;  1R1H A;  4H3X A;  4WK7 A;  3ZXH A;  1UEA A;  4IN9 A;  3HBV P;  2Y6D A;  1EUB A;  2OY4 A;  4DV8 A;  1FLS A;  3HYG A;  4GR3 A;  1BUV M;  1CAQ A;  1ZTQ A;  2OZR A;  2W12 A;  1R1J A;  1FBL A;  1KUK A;  3MA2 A;  1R1I A;  3RTS A;  4XM6 A;  1SRP A;  2L0R A;  4ILW D;  4DPE A;  1I1I P;  3F18 A;  1HOV A;  5D1S A;  4H2E A;  2MZE A;  1O0Q A;  3F16 A;  2D1O A;  5JMY A;  1QJI A;  4PKS A;  2MQS A;  4RT6 B;  456C A;  1GEN A;  1JIZ A;  4G0D A;  3DWB A;  4GQL A;  3LJG A;  1CGF A;  1UMT A;  2TCL A;  3EDG A;  1UMS A;  4GUY A;  3DL1 A;  3V6N A;  3N2V A;  4A7B A;  1YP1 A;  4H82 A;  3O64 A;  1XUD A;  1SU3 A;  2KRJ A;  1BIW A;  1IAD A;  3LIR A;  4IUW A;  3B2Z A;  2YB9 A;  4PKW A;  1L6J A;  4AYK A;  4GWM A;  5CUH A;  4FXQ A;  3C7X A;  1ITV A;  1BSW A;  1SLN A;  4XM7 A;  966C A;  1Y93 A;  1H71 P;  1K7Q A;  3OHL A;  1JAP A;  1A85 A;  1I76 A;  2O36 A;  1SAT A;  2XS3 A;  3EWJ A;  4I35 A;  3KEC A;  1MNC A;  4A3W A;  3KHI A;  1S4B P;  3I7G A;  1MMQ A;  1OM7 A;  3S18 A;  3LP9 A;  3K7N A;  3DPF A;  1OMJ A;  2RJP A;  1KUI A;  3HBU P;  1JH1 A;  5I3M A;  1YOU A;  1G12 A;  1BQO A;  3L0T A;  2POJ A;  1G4K A;  4YEH A;  3F1A A;  2D1N A;  1ZVX A;  4HMA A;  2SRT A;  4EFS A;  1RTG A;  3LEA A;  5BOY A;  1AST A;  2AYK A;  1C8T A;  4JPA A;  3L0V A;  1OS2 A;  1FM1 A;  1KUG A;  1QHU A;  5B5P A;  5I4O A;  3LQ0 A;  1AYK A;  3LUM A;  1BKC A;  2XS4 A;  4FXY P;  1HFS A;  2RJQ A;  1PWQ A;  3EDZ A;  2DW0 A;  4CTH A;  1CK7 A;  3KEK A;  4XM8 A;  2W14 A;  2N8R A;  3HDA P;  3HY9 A;  3LUN A;  3DSL A;  4I03 A;  2JNP A;  1ZS0 A;  1MMB A;  1K7I A;  3USN A;  3KRY A;  1QIC A;  2OW2 A;  1JK3 A;  1JIW P;  1BKC I;  1C7K A;  3EDI A;  3O2X A;  3TSK A;  3DPE A;  1R55 A;  4H30 A;  2X3A A;  4L19 A;  1MMP A;  1IAE A;  1CGE A;  2Z2D A;  1PWV A;  1XFY A;  4PKV A;  1Q3A A;  1B3D A;  4AIG A;  1USN A;  2AIG P;  2E3X A;  5D3C A;  1CXV A;  2JT5 A;  1HTD A;  1XUR A;  2YIG A;  5B5O A;  1HFC A;  2WO9 A;  3CKI A;  4GWN A;  3OHO A;  3E8R A;  4H84 A;  1D7X A;  3EHX A;  3HB2 P;  1OO9 A;  2OVX A;  1BKC E;  1IAC A;  2JT6 A;  1GO8 P;  1Y0V A;  2MLS A;  2DDY A;  4ON1 A;  3K7L A;  3LIL A;  2OW0 A;  5I43 A;  4J4M A;  2X7M A;  3P1V A;  4LL2 A;  4JP4 A;  1KUF A;  3Q2G A;  1B8Y A;  1XFZ A;  1RMZ A;  4L6T A;  1XFW A;  2OY2 A;  1ROS A;  2WO8 A;  1IAB A;  1JAN A;  1XUC A;  2J83 A;  2USN A;  4AUO A;  3KEJ A;  1HY7 A;  1AKL A;  1EB6 A;  1PWP A;  1CQR A;  2O3E A;  2CLT A;  4R3V A;  1R54 A;  2Y6C A;  4QKZ A;  1QJJ A;  3VI1 A;  2JXY A;  4OEI A;  3DNG A;  3WV3 A;  3LJZ A;  4PKT A;  3F19 A;  4ZR5 A;  1WNI A;  2V4B A;  1Z3J A; 
#chains in the Genus database with same CATH topology
 4GR0 A;  3TS4 A;  5CXA A;  3HY7 A;  2A8H A;  2ERQ A;  3TT4 A;  1XM5 A;  1GE6 A;  2J0T A;  2ERP A;  1D5J A;  4DF9 A;  5BOT A;  3AYU A;  2YUF A;  5L79 A;  1ZXV A;  1HXN A;  4XCT A;  3TVC A;  1D8M A;  1BQQ M;  1I73 A;  1ZXC A;  1AF0 A;  1C3I A;  2PJT A;  2DW1 A;  3U1R A;  3KWV C;  2MZI A;  3LKA A;  1OM6 A;  1D8F A;  2DDF A;  2JIH A;  1QJS A;  1GE7 A;  3B8Z A;  1UTT A;  4PKR A;  3G5C A;  2MZH A;  5D2B A;  1SLM A;  1XFX A;  4IJO A;  3LK8 A;  1PWW A;  5I2Z A;  1YCM A;  1G05 A;  5I12 A;  4GR8 A;  3F17 A;  830C A;  2MLR A;  3ZVS A;  1DTH A;  1JAQ A;  3LGP A;  3OYO A;  2OXW A;  2DW2 A;  1G9K A;  3NX7 A;  1J7N A;  3LJT A;  4L63 A;  1HV5 A;  3SHI A;  2OW9 A;  3DTI A;  3Q2H A;  1BZS A;  1JKY A;  4JIJ A;  1DMT A;  1KAP P;  3KMC A;  3V96 B;  4H76 A;  4JQG A;  4PKU A;  1XFU A;  1MMR A;  3ZUK A;  1Y8J A;  4HSD A;  2K2G A;  4HX3 A;  1ATL A;  1SMP A;  3LQB A;  5BPA A;  3EDH A;  4JA1 A;  2JSD A;  3RTT A;  2OXZ A;  3BA0 A;  5D1T A;  1PWU A;  2OXU A;  1QIB A;  1XFV A;  1OM8 A;  3P24 A;  4WZV A;  1GKC A;  3HDB A;  3F15 A;  3UVC A;  4GF1 A;  4XBH A;  1CGL A;  2OVZ A;  3GBO A;  3I7I A;  5L7F A;  2W0D A;  5D1U A;  1JAO A;  2OI0 A;  1GE5 A;  4H49 A;  2OW1 A;  3ELM A;  4FVL A;  4H1Q A;  4AXQ A;  1JJ9 A;  3LIK A;  3N2U A;  1QIA A;  1EAK A;  2CKI A;  3EHY A;  3G42 A;  2QPJ A;  1KUH A;  1ND1 A;  1BUD A;  1IAA A;  3B92 A;  4WF6 A;  2HU6 A;  1UTZ A;  3VTG A;  2E2D A;  2ERO A;  3AYK A;  4Q1L A;  5D7W A;  1CIZ A;  2K9C A;  3AIG A;  1OS9 A;  1ZP5 A;  4WKE A;  1OZ9 A;  1QUA A;  2WOA A;  1K7G A;  5LAB A;  1YQY A;  4PKQ A;  3LMC A;  1KBC A;  4WKI A;  1GKD A;  3WV1 A;  4FU4 A;  1O0T A;  2X3C A;  1RM8 A;  5H8X A;  1PEX A;  1G49 A;  1A86 A;  3LE9 A;  2I47 A;  2X3B A;  3WV2 A;  2W13 A;  1BM6 A;  4DD8 A;  2FV9 A;  1GXD A;  2W15 A;  2FV5 A;  4G9L A;  1GO7 P;  5I0L A;  1IAG A;  3KME A;  5CZM A;  1R1H A;  4H3X A;  4WK7 A;  3ZXH A;  1UEA A;  4IN9 A;  3HBV P;  2Y6D A;  1EUB A;  2OY4 A;  4DV8 A;  1FLS A;  3HYG A;  4GR3 A;  1BUV M;  1TVI A;  1CAQ A;  1ZTQ A;  2OZR A;  2W12 A;  1R1J A;  1FBL A;  1KUK A;  3MA2 A;  1R1I A;  3RTS A;  4XM6 A;  1SRP A;  2L0R A;  4ILW D;  4DPE A;  1I1I P;  3F18 A;  1HOV A;  5D1S A;  4H2E A;  2MZE A;  1O0Q A;  3F16 A;  2D1O A;  5JMY A;  1QJI A;  4PKS A;  2MQS A;  4RT6 B;  456C A;  1GEN A;  1JIZ A;  4G0D A;  3DWB A;  4GQL A;  3LJG A;  1CGF A;  1UMT A;  2TCL A;  3EDG A;  1UMS A;  4GUY A;  3DL1 A;  3V6N A;  3N2V A;  4A7B A;  1YP1 A;  4H82 A;  3O64 A;  1XUD A;  1SU3 A;  2KRJ A;  1BIW A;  1IAD A;  3LIR A;  4IUW A;  3B2Z A;  2YB9 A;  4PKW A;  1L6J A;  4AYK A;  4GWM A;  5CUH A;  4FXQ A;  3C7X A;  1ITV A;  1BSW A;  1SLN A;  4L7A A;  4XM7 A;  966C A;  1Y93 A;  1H71 P;  1K7Q A;  3OHL A;  1JAP A;  1A85 A;  1I76 A;  2O36 A;  1SAT A;  2XS3 A;  3EWJ A;  4I35 A;  3KEC A;  1MNC A;  4A3W A;  3KHI A;  1S4B P;  3DTE A;  3I7G A;  1MMQ A;  1OM7 A;  3S18 A;  3LP9 A;  3K7N A;  3DPF A;  1OMJ A;  2RJP A;  1KUI A;  3HBU P;  1JH1 A;  5I3M A;  1YOU A;  1G12 A;  1BQO A;  3L0T A;  2POJ A;  1G4K A;  4YEH A;  3F1A A;  2D1N A;  1ZVX A;  4HMA A;  2SRT A;  4EFS A;  1RTG A;  3LEA A;  5BOY A;  1AST A;  2AYK A;  1C8T A;  4JPA A;  3L0V A;  1OS2 A;  1FM1 A;  1KUG A;  1QHU A;  5B5P A;  5I4O A;  3LQ0 A;  1AYK A;  3LUM A;  1BKC A;  2XS4 A;  4FXY P;  1HFS A;  1XAX A;  2RJQ A;  1PWQ A;  3EDZ A;  2DW0 A;  4CTH A;  1CK7 A;  3KEK A;  4XM8 A;  2W14 A;  2N8R A;  3HDA P;  3HY9 A;  3LUN A;  3DSL A;  4I03 A;  2JNP A;  1ZS0 A;  1MMB A;  1K7I A;  3USN A;  3KRY A;  1QIC A;  2OW2 A;  1JK3 A;  1JIW P;  1BKC I;  1C7K A;  3EDI A;  3O2X A;  3TSK A;  3DPE A;  1R55 A;  4H30 A;  2X3A A;  4L19 A;  1MMP A;  1IAE A;  1CGE A;  2Z2D A;  1PWV A;  1XFY A;  4PKV A;  1Q3A A;  1B3D A;  4AIG A;  1USN A;  2AIG P;  2E3X A;  5D3C A;  1CXV A;  2JT5 A;  1HTD A;  1XUR A;  2YIG A;  5B5O A;  1HFC A;  2WO9 A;  3CKI A;  4GWN A;  3OHO A;  3E8R A;  4H84 A;  1D7X A;  3EHX A;  3HB2 P;  1OO9 A;  2OVX A;  1BKC E;  1IAC A;  2JT6 A;  1GO8 P;  1Y0V A;  2MLS A;  2DDY A;  4ON1 A;  3K7L A;  3LIL A;  2OW0 A;  5I43 A;  4J4M A;  2X7M A;  3P1V A;  4LL2 A;  4JP4 A;  1KUF A;  3Q2G A;  1B8Y A;  1XFZ A;  1RMZ A;  4L6T A;  1XFW A;  2OY2 A;  1ROS A;  2WO8 A;  1IAB A;  1JAN A;  1XUC A;  2J83 A;  2USN A;  4AUO A;  3KEJ A;  1HY7 A;  1AKL A;  1EB6 A;  1PWP A;  1CQR A;  2O3E A;  2CLT A;  4R3V A;  1R54 A;  2Y6C A;  4QKZ A;  1QJJ A;  3VI1 A;  2JXY A;  4OEI A;  3DNG A;  3WV3 A;  3LJZ A;  3DTK A;  4PKT A;  3F19 A;  4ZR5 A;  1WNI A;  2V4B A;  1Z3J A; 
#chains in the Genus database with same CATH homology
 4GR0 A;  3TS4 A;  5CXA A;  3HY7 A;  2A8H A;  2ERQ A;  3TT4 A;  1GE6 A;  2J0T A;  2ERP A;  1D5J A;  4DF9 A;  5BOT A;  3AYU A;  2YUF A;  5L79 A;  1ZXV A;  1HXN A;  4XCT A;  3TVC A;  1D8M A;  1BQQ M;  1I73 A;  1ZXC A;  1AF0 A;  1C3I A;  2PJT A;  2DW1 A;  3U1R A;  3KWV C;  2MZI A;  3LKA A;  1OM6 A;  1D8F A;  2DDF A;  2JIH A;  1QJS A;  1GE7 A;  3B8Z A;  1UTT A;  4PKR A;  3G5C A;  2MZH A;  5D2B A;  1SLM A;  1XFX A;  4IJO A;  3LK8 A;  1PWW A;  5I2Z A;  1YCM A;  1G05 A;  5I12 A;  4GR8 A;  3F17 A;  830C A;  2MLR A;  3ZVS A;  1DTH A;  1JAQ A;  3LGP A;  3OYO A;  2OXW A;  2DW2 A;  1G9K A;  3NX7 A;  1J7N A;  3LJT A;  4L63 A;  1HV5 A;  3SHI A;  2OW9 A;  3DTI A;  3Q2H A;  1BZS A;  1JKY A;  4JIJ A;  1DMT A;  1KAP P;  3KMC A;  3V96 B;  4H76 A;  4JQG A;  4PKU A;  1XFU A;  1MMR A;  3ZUK A;  1Y8J A;  4HSD A;  2K2G A;  4HX3 A;  1ATL A;  1SMP A;  3LQB A;  5BPA A;  3EDH A;  4JA1 A;  2JSD A;  3RTT A;  2OXZ A;  3BA0 A;  5D1T A;  1PWU A;  2OXU A;  1QIB A;  1XFV A;  1OM8 A;  3P24 A;  4WZV A;  1GKC A;  3HDB A;  3F15 A;  3UVC A;  4GF1 A;  4XBH A;  1CGL A;  2OVZ A;  3GBO A;  3I7I A;  5L7F A;  2W0D A;  5D1U A;  1JAO A;  2OI0 A;  1GE5 A;  4H49 A;  2OW1 A;  3ELM A;  4FVL A;  4H1Q A;  4AXQ A;  1JJ9 A;  3LIK A;  3N2U A;  1QIA A;  1EAK A;  2CKI A;  3EHY A;  3G42 A;  2QPJ A;  1KUH A;  1ND1 A;  1BUD A;  1IAA A;  3B92 A;  4WF6 A;  2HU6 A;  1UTZ A;  3VTG A;  2E2D A;  2ERO A;  3AYK A;  4Q1L A;  5D7W A;  1CIZ A;  2K9C A;  3AIG A;  1OS9 A;  1ZP5 A;  4WKE A;  1QUA A;  2WOA A;  1K7G A;  5LAB A;  1YQY A;  4PKQ A;  3LMC A;  1KBC A;  4WKI A;  1GKD A;  3WV1 A;  4FU4 A;  1O0T A;  2X3C A;  1RM8 A;  5H8X A;  1PEX A;  1G49 A;  1A86 A;  3LE9 A;  2I47 A;  2X3B A;  3WV2 A;  2W13 A;  1BM6 A;  4DD8 A;  2FV9 A;  1GXD A;  2W15 A;  2FV5 A;  4G9L A;  1GO7 P;  5I0L A;  1IAG A;  3KME A;  5CZM A;  1R1H A;  4H3X A;  4WK7 A;  3ZXH A;  1UEA A;  4IN9 A;  3HBV P;  2Y6D A;  1EUB A;  2OY4 A;  4DV8 A;  1FLS A;  3HYG A;  4GR3 A;  1BUV M;  1CAQ A;  1ZTQ A;  2OZR A;  2W12 A;  1R1J A;  1FBL A;  1KUK A;  3MA2 A;  1R1I A;  3RTS A;  4XM6 A;  1SRP A;  2L0R A;  4ILW D;  4DPE A;  1I1I P;  3F18 A;  1HOV A;  5D1S A;  4H2E A;  2MZE A;  1O0Q A;  3F16 A;  2D1O A;  5JMY A;  1QJI A;  4PKS A;  2MQS A;  4RT6 B;  456C A;  1GEN A;  1JIZ A;  4G0D A;  3DWB A;  4GQL A;  3LJG A;  1CGF A;  1UMT A;  2TCL A;  3EDG A;  1UMS A;  4GUY A;  3DL1 A;  3V6N A;  3N2V A;  4A7B A;  1YP1 A;  4H82 A;  3O64 A;  1XUD A;  1SU3 A;  2KRJ A;  1BIW A;  1IAD A;  3LIR A;  4IUW A;  3B2Z A;  2YB9 A;  4PKW A;  1L6J A;  4AYK A;  4GWM A;  5CUH A;  4FXQ A;  3C7X A;  1ITV A;  1BSW A;  1SLN A;  4L7A A;  4XM7 A;  966C A;  1Y93 A;  1H71 P;  1K7Q A;  3OHL A;  1JAP A;  1A85 A;  1I76 A;  2O36 A;  1SAT A;  2XS3 A;  3EWJ A;  4I35 A;  3KEC A;  1MNC A;  4A3W A;  3KHI A;  1S4B P;  3DTE A;  3I7G A;  1MMQ A;  1OM7 A;  3S18 A;  3LP9 A;  3K7N A;  3DPF A;  1OMJ A;  2RJP A;  1KUI A;  3HBU P;  1JH1 A;  5I3M A;  1YOU A;  1G12 A;  1BQO A;  3L0T A;  2POJ A;  1G4K A;  4YEH A;  3F1A A;  2D1N A;  1ZVX A;  4HMA A;  2SRT A;  4EFS A;  1RTG A;  3LEA A;  5BOY A;  1AST A;  2AYK A;  1C8T A;  4JPA A;  3L0V A;  1OS2 A;  1FM1 A;  1KUG A;  1QHU A;  5B5P A;  5I4O A;  3LQ0 A;  1AYK A;  3LUM A;  1BKC A;  2XS4 A;  4FXY P;  1HFS A;  2RJQ A;  1PWQ A;  3EDZ A;  2DW0 A;  4CTH A;  1CK7 A;  3KEK A;  4XM8 A;  2W14 A;  2N8R A;  3HDA P;  3HY9 A;  3LUN A;  3DSL A;  4I03 A;  2JNP A;  1ZS0 A;  1MMB A;  1K7I A;  3USN A;  3KRY A;  1QIC A;  2OW2 A;  1JK3 A;  1JIW P;  1BKC I;  1C7K A;  3EDI A;  3O2X A;  3TSK A;  3DPE A;  1R55 A;  4H30 A;  2X3A A;  4L19 A;  1MMP A;  1IAE A;  1CGE A;  2Z2D A;  1PWV A;  1XFY A;  4PKV A;  1Q3A A;  1B3D A;  4AIG A;  1USN A;  2AIG P;  2E3X A;  5D3C A;  1CXV A;  2JT5 A;  1HTD A;  1XUR A;  2YIG A;  5B5O A;  1HFC A;  2WO9 A;  3CKI A;  4GWN A;  3OHO A;  3E8R A;  4H84 A;  1D7X A;  3EHX A;  3HB2 P;  1OO9 A;  2OVX A;  1BKC E;  1IAC A;  2JT6 A;  1GO8 P;  1Y0V A;  2MLS A;  2DDY A;  4ON1 A;  3K7L A;  3LIL A;  2OW0 A;  5I43 A;  4J4M A;  2X7M A;  3P1V A;  4LL2 A;  4JP4 A;  1KUF A;  3Q2G A;  1B8Y A;  1XFZ A;  1RMZ A;  4L6T A;  1XFW A;  2OY2 A;  1ROS A;  2WO8 A;  1IAB A;  1JAN A;  1XUC A;  2J83 A;  2USN A;  4AUO A;  3KEJ A;  1HY7 A;  1AKL A;  1EB6 A;  1PWP A;  1CQR A;  2O3E A;  2CLT A;  4R3V A;  1R54 A;  2Y6C A;  4QKZ A;  1QJJ A;  3VI1 A;  2JXY A;  4OEI A;  3DNG A;  3WV3 A;  3LJZ A;  3DTK A;  4PKT A;  3F19 A;  4ZR5 A;  1WNI A;  2V4B A;  1Z3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...