4AUOA

Crystal structure of mmp-1(e200a) in complex with a triple-helical collagen peptide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
367
structure length
367
Chain Sequence
FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHALGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/peptide
molecule keywords INTERSTITIAL COLLAGENASE
publication title Structural Insights Into Triple-Helical Collagen Cleavage by Matrix Metalloproteinase 1
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 4auoA02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4auoA01
1JK3A 3RTSA 1RMZA 3I7IA 3KHIA 1JIZA 1RM8A 3HB2P 5B5PA 1OM6A 3OYOA 2O3EA 1SRPA 2JT5A 5L79A 1XFYA 3USNA 1JAPA 2JT6A 4JP4A 4XBHA 3AYKA 1QIAA 2L0RA 1JANA 1MMPA 2MLSA 1HFSA 3LIKA 4A3WA 3G42A 1EB6A 2RJPA 1XFWA 4AUOA 4J4MA 2OXZA 1PWUA 1YOUA 1OM7A 4DF9A 1FBLA 1GENA 4H30A 1OS9A 1K7QA 1KUGA 5I0LA 1KUHA 4DD8A 4IJOA 1HFCA 1HTDA 3LJTA 3KRYA 1D8FA 1BSWA 1QJIA 3RTTA 3ZXHA 1GE6A 4PKSA 5BOTA 1IABA 1IACA 1IAAA 4H82A 1AF0A 3EDHA 1R1IA 1CIZA 2E2DA 1C8TA 2MLRA 1KAPP 2K9CA 1CGFA 5D7WA 1ZS0A 2W12A 5D2BA 2O36A 1PWQA 4I35A 1K7GA 2XS4A 2RJQA 1GKCA 2MQSA 1OM8A 4WZVA 4GR0A 3EDZA 4L6TA 4FU4A 1B8YA 1GE5A 1GKDA 3LE9A 1SMPA 2JSDA 3KWVC 1A85A 2MZHA 3HY9A 3F16A 1JIWP 1IAGA 1PWWA 1A86A 2X7MA 2OVZA 4PKUA 1ITVA 1JAQA 1R54A 1D8MA 2V4BA 4XM6A 3O2XA 4WKEA 2TCLA 1MMBA 1QIBA 3HYGA 2DW0A 3KMEA 4ON1A 1FLSA 1IADA 1OS2A 4G0DA 1J7NA 4H2EA 4L63A 3TS4A 4HMAA 4DPEA 1UMSA 5CUHA 1Y93A 1HY7A 1EUBA 3DWBA 4H49A 2AYKA 1QUAA 1HOVA 1DMTA 2W15A 2YIGA 1XFZA 3DSLA 5B5OA 2OY4A 3B2ZA 5BOYA 3NX7A 5D1TA 3LUMA 2QPJA 5CXAA 2OW9A 4WK7A 4H76A 3HBVP 3LMCA 3C7XA 4ILWD 5H8XA 1BQOA 2E3XA 2USNA 1QJSA 3G5CA 4PKVA 1WNIA 3N2UA 4OEIA 1YCMA 3VI1A 2A8HA 4EFSA 3P24A 1L6JA 3LJZA 3MA2A 2PJTA 1R1HA 3K7LA 4PKRA 2Y6DA 5I4OA 2K2GA 5D3CA 1XFXA 3DL1A 1CGEA 4RT6B 1BUVM 3LKAA 2OW2A 3TSKA 4G9LA 4AIGA 1PEXA 3EDGA 4XM8A 4XCTA 4H3XA 4JQGA 1AYKA 1CQRA 3WV2A 1USNA 2W0DA 2DDFA 3L0TA 3UVCA 1BM6A 4H84A 2N8RA 2XS3A 1I73A 4JPAA 3I7GA 1SLNA 1PWPA 1UTZA 1XURA 1KUIA 3EHXA 3LGPA 1HV5A 3CKIA 1G05A 3F1AA 1XUCA 3AYUA 1XFUA 4FVLA 1ZXVA 2KRJA 2J0TA 1CXVA 3TT4A 3F19A 1R1JA 3LIRA 1JKYA 1Z3JA 4R3VA 4Q1LA 4ZR5A 5I2ZA 3LUNA 1O0QA 1OMJA 3S18A 3LQ0A 1G4KA 4I03A 3B8ZA 3LQBA 3DNGA 5D1UA 4JIJA 3F18A 3EHYA 3HBUP 2JXYA 3ELMA 1KBCA 2Y6CA 1QICA 4GUYA 4GQLA 1K7IA 2EROA 4DV8A 4IUWA 4AYKA 1ZTQA 3AIGA 3N2VA 1KUKA 3VTGA 3WV3A 2SRTA 2I47A 3TVCA 1GE7A 1ZP5A 2MZIA 1I1IP 2D1NA 2OW1A 1C7KA 5I3MA 2X3AA 1ZVXA 3LK8A 1C3IA 1MMQA 4PKTA 1UTTA 1S4BP 1HXNA 1RTGA 1MNCA 1CK7A 4GR8A 2MZEA 1BIWA 4FXQA 3KMCA 2CKIA 2OW0A 3L0VA 4H1QA 1G12A 1GXDA 2X3CA 1GO8P 2JNPA 2W13A 1ATLA 1ASTA 4HX3A 4GR3A 3WV1A 4A7BA 3F17A 2OXWA 3SHIA 4PKQA 966CA 1D7XA 1SATA 3B92A 1BKCA 2DDYA 2D1OA 4L19A 1BQQM 4CTHA 1KUFA 1JAOA 4WF6A 3OHOA 2POJA 4HSDA 1SU3A 2OI0A 3Q2GA 1OO9A 1B3DA 3ZVSA 1QHUA 4XM7A 1ND1A 1FM1A 3HY7A 3V96B 4AXQA 2W14A 4YEHA 5I12A 1JJ9A 3GBOA 1H71P 2X3BA 2WO9A 2WO8A 1D5JA 1Y0VA 1Y8JA 3KEJA 3O64A 1O0TA 3P1VA 2FV5A 3E8RA 3LJGA 5LABA 456CA 5L7FA 3V6NA 1PWVA 2WOAA 2OVXA 3KEKA 1UMTA 2AIGP 1GO7P 4GWMA 1I76A 1XFVA 1YQYA 5JMYA 2ERPA 1R55A 2CLTA 3F15A 2DW1A 1DTHA 1ROSA 3EDIA 2ERQA 1EAKA 3HDBA 3BA0A 1G9KA 3HDAP 1XUDA 3LILA 4FXYP 2DW2A 1CGLA 1BZSA 4GWNA 2Z2DA 2HU6A 1UEAA 3EWJA 2J83A 2OXUA 1JH1A 1BKCI 4GF1A 2JIHA 4PKWA 1BKCE 3DPEA 4QKZA 4LL2A 1BUDA 1IAEA 1AKLA 3Q2HA 3LP9A 2OY2A 5I43A 1CAQA 1ZXCA 3U1RA 3K7NA 4IN9A 4WKIA 3DPFA 5CZMA 1QJJA 1G49A 830CA 5D1SA 1MMRA 1YP1A 2YB9A 4JA1A 3KECA 3ZUKA 2OZRA 1Q3AA 1SLMA 3OHLA 3LEAA 2FV9A 5BPAA
chains in the Genus database with same CATH superfamily
1JK3A 3RTSA 1RMZA 3I7IA 3KHIA 1JIZA 1RM8A 3HB2P 5B5PA 1OM6A 3OYOA 2O3EA 1SRPA 2JT5A 5L79A 1XFYA 3USNA 1JAPA 2JT6A 4JP4A 4XBHA 3AYKA 1QIAA 2L0RA 1JANA 1MMPA 2MLSA 1HFSA 3LIKA 4A3WA 3G42A 1EB6A 2RJPA 1XFWA 4AUOA 4J4MA 2OXZA 1PWUA 1YOUA 1OM7A 4DF9A 1FBLA 1GENA 4H30A 1OS9A 1K7QA 1KUGA 5I0LA 1KUHA 4DD8A 4IJOA 1HFCA 1HTDA 3LJTA 3KRYA 1D8FA 1BSWA 1QJIA 3RTTA 3ZXHA 1GE6A 4PKSA 5BOTA 1IABA 1IACA 1IAAA 4H82A 1AF0A 3EDHA 1R1IA 1CIZA 2E2DA 1C8TA 2MLRA 1KAPP 2K9CA 1CGFA 5D7WA 1ZS0A 2W12A 5D2BA 2O36A 1PWQA 4I35A 1K7GA 2XS4A 2RJQA 1GKCA 2MQSA 1OM8A 4WZVA 4GR0A 3EDZA 4L6TA 4FU4A 1B8YA 1GE5A 1GKDA 3LE9A 1SMPA 2JSDA 3KWVC 1A85A 2MZHA 3HY9A 3F16A 1JIWP 1IAGA 1PWWA 1A86A 2X7MA 2OVZA 4PKUA 1ITVA 1JAQA 1R54A 1D8MA 2V4BA 4XM6A 3O2XA 4WKEA 2TCLA 1MMBA 1QIBA 3HYGA 2DW0A 3KMEA 4ON1A 1FLSA 1IADA 1OS2A 4G0DA 1J7NA 4H2EA 4L63A 3TS4A 4HMAA 4DPEA 1UMSA 5CUHA 1Y93A 1HY7A 1EUBA 3DWBA 4H49A 2AYKA 1QUAA 1HOVA 1DMTA 2W15A 2YIGA 1XFZA 3DSLA 5B5OA 2OY4A 3B2ZA 5BOYA 3NX7A 5D1TA 3LUMA 2QPJA 5CXAA 2OW9A 4WK7A 4H76A 2YUFA 3HBVP 3LMCA 3C7XA 4ILWD 5H8XA 1BQOA 2E3XA 2USNA 1QJSA 3G5CA 4PKVA 1WNIA 3N2UA 4OEIA 1YCMA 3VI1A 2A8HA 4EFSA 3P24A 1L6JA 3LJZA 3MA2A 2PJTA 1R1HA 3K7LA 4PKRA 2Y6DA 5I4OA 2K2GA 5D3CA 1XFXA 3DL1A 1OZ9A 1CGEA 4RT6B 1BUVM 3LKAA 2OW2A 3TSKA 4G9LA 4AIGA 1PEXA 3EDGA 4XM8A 4XCTA 4H3XA 4JQGA 1AYKA 1CQRA 3WV2A 1USNA 2W0DA 2DDFA 3L0TA 3UVCA 4L7AA 4H84A 1BM6A 2N8RA 2XS3A 1I73A 4JPAA 1SLNA 3I7GA 1PWPA 1UTZA 1XURA 1KUIA 3EHXA 3LGPA 1HV5A 3CKIA 1G05A 3F1AA 1XUCA 3AYUA 1XFUA 4FVLA 1ZXVA 2KRJA 2J0TA 1CXVA 3TT4A 3F19A 1R1JA 3LIRA 1JKYA 1Z3JA 4R3VA 4Q1LA 4ZR5A 5I2ZA 3LUNA 1XM5A 1O0QA 1OMJA 3S18A 3LQ0A 1G4KA 4I03A 3B8ZA 3LQBA 3DNGA 5D1UA 4JIJA 3F18A 3EHYA 3HBUP 2JXYA 3ELMA 1KBCA 2Y6CA 1QICA 4GUYA 4GQLA 1K7IA 2EROA 3DTKA 4DV8A 4IUWA 4AYKA 1ZTQA 3AIGA 3N2VA 1KUKA 3VTGA 3WV3A 2SRTA 2I47A 3TVCA 1GE7A 1ZP5A 2MZIA 1I1IP 2D1NA 2OW1A 1C7KA 5I3MA 2X3AA 1ZVXA 3LK8A 1C3IA 1MMQA 4PKTA 1UTTA 1S4BP 3DTEA 1HXNA 1RTGA 1MNCA 1CK7A 4GR8A 2MZEA 1BIWA 4FXQA 3KMCA 2CKIA 2OW0A 3L0VA 4H1QA 1G12A 1GXDA 2X3CA 1GO8P 2JNPA 2W13A 1ATLA 1ASTA 4HX3A 4GR3A 3WV1A 4A7BA 3F17A 2OXWA 3SHIA 4PKQA 966CA 1D7XA 1SATA 3B92A 1BKCA 2DDYA 2D1OA 4L19A 1BQQM 4CTHA 1KUFA 1JAOA 4WF6A 3OHOA 2POJA 4HSDA 1SU3A 2OI0A 3Q2GA 1OO9A 1B3DA 1TVIA 1QHUA 3ZVSA 4XM7A 1ND1A 1FM1A 3HY7A 3V96B 4AXQA 2W14A 4YEHA 5I12A 1JJ9A 3GBOA 1H71P 2X3BA 2WO9A 2WO8A 1D5JA 1Y0VA 1Y8JA 3KEJA 3O64A 1O0TA 3P1VA 2FV5A 3E8RA 3LJGA 5LABA 456CA 5L7FA 3V6NA 1PWVA 2WOAA 2OVXA 3KEKA 1UMTA 2AIGP 1GO7P 4GWMA 1I76A 1XFVA 1YQYA 5JMYA 2ERPA 1R55A 2CLTA 3F15A 2DW1A 1DTHA 1ROSA 3EDIA 2ERQA 1EAKA 3HDBA 3BA0A 1G9KA 3HDAP 1XUDA 3LILA 4FXYP 2DW2A 1CGLA 1BZSA 4GWNA 2Z2DA 2HU6A 1UEAA 3EWJA 2J83A 2OXUA 1JH1A 1BKCI 4GF1A 2JIHA 4PKWA 1BKCE 3DPEA 4QKZA 4LL2A 3DTIA 1BUDA 1IAEA 1AKLA 3Q2HA 3LP9A 2OY2A 1XAXA 5I43A 1CAQA 1ZXCA 3U1RA 3K7NA 4IN9A 4WKIA 3DPFA 5CZMA 1QJJA 1G49A 830CA 5D1SA 1MMRA 1YP1A 2YB9A 4JA1A 3KECA 3ZUKA 2OZRA 1Q3AA 1SLMA 3OHLA 3LEAA 2FV9A 5BPAA
chains in the Genus database with same CATH topology
1JK3A 3RTSA 1RMZA 3I7IA 3KHIA 1JIZA 1RM8A 3HB2P 5B5PA 1OM6A 3OYOA 2O3EA 1SRPA 2JT5A 5L79A 1XFYA 3USNA 1JAPA 2JT6A 4JP4A 4XBHA 3AYKA 1QIAA 2L0RA 1JANA 1MMPA 2MLSA 1HFSA 3LIKA 4A3WA 3G42A 1EB6A 2RJPA 1XFWA 4AUOA 4J4MA 2OXZA 1PWUA 1YOUA 1OM7A 4DF9A 1FBLA 1GENA 4H30A 1OS9A 1K7QA 1KUGA 5I0LA 1KUHA 4DD8A 4IJOA 1HFCA 1HTDA 3LJTA 3KRYA 1D8FA 1BSWA 1QJIA 3RTTA 3ZXHA 1GE6A 4PKSA 5BOTA 1IABA 1IACA 1IAAA 4H82A 1AF0A 3EDHA 1R1IA 1CIZA 2E2DA 1C8TA 2MLRA 1KAPP 2K9CA 1CGFA 5D7WA 1ZS0A 2W12A 5D2BA 2O36A 1PWQA 4I35A 1K7GA 2XS4A 2RJQA 1GKCA 2MQSA 1OM8A 4WZVA 4GR0A 3EDZA 4L6TA 4FU4A 1B8YA 1GE5A 1GKDA 3LE9A 1SMPA 2JSDA 3KWVC 1A85A 2MZHA 3HY9A 3F16A 1JIWP 1IAGA 1PWWA 1A86A 2X7MA 2OVZA 4PKUA 1ITVA 1JAQA 1R54A 1D8MA 2V4BA 4XM6A 3O2XA 4WKEA 2TCLA 1MMBA 1QIBA 3HYGA 2DW0A 3KMEA 4ON1A 1FLSA 1IADA 1OS2A 4G0DA 1J7NA 4H2EA 4L63A 3TS4A 4HMAA 4DPEA 1UMSA 5CUHA 1Y93A 1HY7A 1EUBA 3DWBA 4H49A 2AYKA 1QUAA 1HOVA 1DMTA 2W15A 2YIGA 1XFZA 3DSLA 5B5OA 2OY4A 3B2ZA 5BOYA 3NX7A 5D1TA 3LUMA 2QPJA 5CXAA 2OW9A 4WK7A 4H76A 2YUFA 3HBVP 3LMCA 3C7XA 4ILWD 5H8XA 1BQOA 2E3XA 2USNA 1QJSA 3G5CA 4PKVA 1WNIA 3N2UA 4OEIA 1YCMA 3VI1A 2A8HA 4EFSA 3P24A 1L6JA 3LJZA 3MA2A 2PJTA 1R1HA 3K7LA 4PKRA 2Y6DA 5I4OA 2K2GA 5D3CA 1XFXA 3DL1A 1CGEA 4RT6B 1BUVM 3LKAA 2OW2A 3TSKA 4G9LA 4AIGA 1PEXA 3EDGA 4XM8A 4XCTA 4H3XA 4JQGA 1AYKA 1CQRA 3WV2A 1USNA 2W0DA 2DDFA 3L0TA 3UVCA 4L7AA 4H84A 1BM6A 2N8RA 2XS3A 1I73A 4JPAA 1SLNA 3I7GA 1PWPA 1UTZA 1XURA 1KUIA 3EHXA 3LGPA 1HV5A 3CKIA 1G05A 3F1AA 1XUCA 3AYUA 1XFUA 4FVLA 1ZXVA 2KRJA 2J0TA 1CXVA 3TT4A 3F19A 1R1JA 3LIRA 1JKYA 1Z3JA 4R3VA 4Q1LA 4ZR5A 5I2ZA 3LUNA 1O0QA 1OMJA 3S18A 3LQ0A 1G4KA 4I03A 3B8ZA 3LQBA 3DNGA 5D1UA 4JIJA 3F18A 3EHYA 3HBUP 2JXYA 3ELMA 1KBCA 2Y6CA 1QICA 4GUYA 4GQLA 1K7IA 2EROA 3DTKA 4DV8A 4IUWA 4AYKA 1ZTQA 3AIGA 3N2VA 1KUKA 3VTGA 3WV3A 2SRTA 2I47A 3TVCA 1GE7A 1ZP5A 2MZIA 1I1IP 2D1NA 2OW1A 1C7KA 5I3MA 2X3AA 1ZVXA 3LK8A 1C3IA 1MMQA 4PKTA 1UTTA 1S4BP 3DTEA 1HXNA 1RTGA 1MNCA 1CK7A 4GR8A 2MZEA 1BIWA 4FXQA 3KMCA 2CKIA 2OW0A 3L0VA 4H1QA 1G12A 1GXDA 2X3CA 1GO8P 2JNPA 2W13A 1ATLA 1ASTA 4HX3A 4GR3A 3WV1A 4A7BA 3F17A 2OXWA 3SHIA 4PKQA 966CA 1D7XA 1SATA 3B92A 1BKCA 2DDYA 2D1OA 4L19A 1BQQM 4CTHA 1KUFA 1JAOA 4WF6A 3OHOA 2POJA 4HSDA 1SU3A 2OI0A 3Q2GA 1OO9A 1B3DA 3ZVSA 1QHUA 4XM7A 1ND1A 1FM1A 3HY7A 3V96B 4AXQA 2W14A 4YEHA 5I12A 1JJ9A 3GBOA 1H71P 2X3BA 2WO9A 2WO8A 1D5JA 1Y0VA 1Y8JA 3KEJA 3O64A 1O0TA 3P1VA 2FV5A 3E8RA 3LJGA 5LABA 456CA 5L7FA 3V6NA 1PWVA 2WOAA 2OVXA 3KEKA 1UMTA 2AIGP 1GO7P 4GWMA 1I76A 1XFVA 1YQYA 5JMYA 2ERPA 1R55A 2CLTA 3F15A 2DW1A 1DTHA 1ROSA 3EDIA 2ERQA 1EAKA 3HDBA 3BA0A 1G9KA 3HDAP 1XUDA 3LILA 4FXYP 2DW2A 1CGLA 1BZSA 4GWNA 2Z2DA 2HU6A 1UEAA 3EWJA 2J83A 2OXUA 1JH1A 1BKCI 4GF1A 2JIHA 4PKWA 1BKCE 3DPEA 4QKZA 4LL2A 3DTIA 1BUDA 1IAEA 1AKLA 3Q2HA 3LP9A 2OY2A 5I43A 1CAQA 1ZXCA 3U1RA 3K7NA 4IN9A 4WKIA 3DPFA 5CZMA 1QJJA 1G49A 830CA 5D1SA 1MMRA 1YP1A 2YB9A 4JA1A 3KECA 3ZUKA 2OZRA 1Q3AA 1SLMA 3OHLA 3LEAA 2FV9A 5BPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JK3 A;  3RTS A;  1RMZ A;  3I7I A;  3KHI A;  1JIZ A;  1RM8 A;  3HB2 P;  5B5P A;  1OM6 A;  3OYO A;  2O3E A;  1SRP A;  2JT5 A;  5L79 A;  1XFY A;  3USN A;  1JAP A;  2JT6 A;  4JP4 A;  4XBH A;  3AYK A;  1QIA A;  2L0R A;  1JAN A;  1MMP A;  2MLS A;  1HFS A;  3LIK A;  4A3W A;  3G42 A;  1EB6 A;  2RJP A;  1XFW A;  4AUO A;  4J4M A;  2OXZ A;  1PWU A;  1YOU A;  1OM7 A;  4DF9 A;  1FBL A;  1GEN A;  4H30 A;  1OS9 A;  1K7Q A;  1KUG A;  5I0L A;  1KUH A;  4DD8 A;  4IJO A;  1HFC A;  1HTD A;  3LJT A;  3KRY A;  1D8F A;  1BSW A;  1QJI A;  3RTT A;  3ZXH A;  1GE6 A;  4PKS A;  5BOT A;  1IAB A;  1IAC A;  1IAA A;  4H82 A;  1AF0 A;  3EDH A;  1R1I A;  1CIZ A;  2E2D A;  1C8T A;  2MLR A;  1KAP P;  2K9C A;  1CGF A;  5D7W A;  1ZS0 A;  2W12 A;  5D2B A;  2O36 A;  1PWQ A;  4I35 A;  1K7G A;  2XS4 A;  2RJQ A;  1GKC A;  2MQS A;  1OM8 A;  4WZV A;  4GR0 A;  3EDZ A;  4L6T A;  4FU4 A;  1B8Y A;  1GE5 A;  1GKD A;  3LE9 A;  1SMP A;  2JSD A;  3KWV C;  1A85 A;  2MZH A;  3HY9 A;  3F16 A;  1JIW P;  1IAG A;  1PWW A;  1A86 A;  2X7M A;  2OVZ A;  4PKU A;  1ITV A;  1JAQ A;  1R54 A;  1D8M A;  2V4B A;  4XM6 A;  3O2X A;  4WKE A;  2TCL A;  1MMB A;  1QIB A;  3HYG A;  2DW0 A;  3KME A;  4ON1 A;  1FLS A;  1IAD A;  1OS2 A;  4G0D A;  1J7N A;  4H2E A;  4L63 A;  3TS4 A;  4HMA A;  4DPE A;  1UMS A;  5CUH A;  1Y93 A;  1HY7 A;  1EUB A;  3DWB A;  4H49 A;  2AYK A;  1QUA A;  1HOV A;  1DMT A;  2W15 A;  2YIG A;  1XFZ A;  3DSL A;  5B5O A;  2OY4 A;  3B2Z A;  5BOY A;  3NX7 A;  5D1T A;  3LUM A;  2QPJ A;  5CXA A;  2OW9 A;  4WK7 A;  4H76 A;  3HBV P;  3LMC A;  3C7X A;  4ILW D;  5H8X A;  1BQO A;  2E3X A;  2USN A;  1QJS A;  3G5C A;  4PKV A;  1WNI A;  3N2U A;  4OEI A;  1YCM A;  3VI1 A;  2A8H A;  4EFS A;  3P24 A;  1L6J A;  3LJZ A;  3MA2 A;  2PJT A;  1R1H A;  3K7L A;  4PKR A;  2Y6D A;  5I4O A;  2K2G A;  5D3C A;  1XFX A;  3DL1 A;  1CGE A;  4RT6 B;  1BUV M;  3LKA A;  2OW2 A;  3TSK A;  4G9L A;  4AIG A;  1PEX A;  3EDG A;  4XM8 A;  4XCT A;  4H3X A;  4JQG A;  1AYK A;  1CQR A;  3WV2 A;  1USN A;  2W0D A;  2DDF A;  3L0T A;  3UVC A;  1BM6 A;  4H84 A;  2N8R A;  2XS3 A;  1I73 A;  4JPA A;  3I7G A;  1SLN A;  1PWP A;  1UTZ A;  1XUR A;  1KUI A;  3EHX A;  3LGP A;  1HV5 A;  3CKI A;  1G05 A;  3F1A A;  1XUC A;  3AYU A;  1XFU A;  4FVL A;  1ZXV A;  2KRJ A;  2J0T A;  1CXV A;  3TT4 A;  3F19 A;  1R1J A;  3LIR A;  1JKY A;  1Z3J A;  4R3V A;  4Q1L A;  4ZR5 A;  5I2Z A;  3LUN A;  1O0Q A;  1OMJ A;  3S18 A;  3LQ0 A;  1G4K A;  4I03 A;  3B8Z A;  3LQB A;  3DNG A;  5D1U A;  4JIJ A;  3F18 A;  3EHY A;  3HBU P;  2JXY A;  3ELM A;  1KBC A;  2Y6C A;  1QIC A;  4GUY A;  4GQL A;  1K7I A;  2ERO A;  4DV8 A;  4IUW A;  4AYK A;  1ZTQ A;  3AIG A;  3N2V A;  1KUK A;  3VTG A;  3WV3 A;  2SRT A;  2I47 A;  3TVC A;  1GE7 A;  1ZP5 A;  2MZI A;  1I1I P;  2D1N A;  2OW1 A;  1C7K A;  5I3M A;  2X3A A;  1ZVX A;  3LK8 A;  1C3I A;  1MMQ A;  4PKT A;  1UTT A;  1S4B P;  1HXN A;  1RTG A;  1MNC A;  1CK7 A;  4GR8 A;  2MZE A;  1BIW A;  4FXQ A;  3KMC A;  2CKI A;  2OW0 A;  3L0V A;  4H1Q A;  1G12 A;  1GXD A;  2X3C A;  1GO8 P;  2JNP A;  2W13 A;  1ATL A;  1AST A;  4HX3 A;  4GR3 A;  3WV1 A;  4A7B A;  3F17 A;  2OXW A;  3SHI A;  4PKQ A;  966C A;  1D7X A;  1SAT A;  3B92 A;  1BKC A;  2DDY A;  2D1O A;  4L19 A;  1BQQ M;  4CTH A;  1KUF A;  1JAO A;  4WF6 A;  3OHO A;  2POJ A;  4HSD A;  1SU3 A;  2OI0 A;  3Q2G A;  1OO9 A;  1B3D A;  3ZVS A;  1QHU A;  4XM7 A;  1ND1 A;  1FM1 A;  3HY7 A;  3V96 B;  4AXQ A;  2W14 A;  4YEH A;  5I12 A;  1JJ9 A;  3GBO A;  1H71 P;  2X3B A;  2WO9 A;  2WO8 A;  1D5J A;  1Y0V A;  1Y8J A;  3KEJ A;  3O64 A;  1O0T A;  3P1V A;  2FV5 A;  3E8R A;  3LJG A;  5LAB A;  456C A;  5L7F A;  3V6N A;  1PWV A;  2WOA A;  2OVX A;  3KEK A;  1UMT A;  2AIG P;  1GO7 P;  4GWM A;  1I76 A;  1XFV A;  1YQY A;  5JMY A;  2ERP A;  1R55 A;  2CLT A;  3F15 A;  2DW1 A;  1DTH A;  1ROS A;  3EDI A;  2ERQ A;  1EAK A;  3HDB A;  3BA0 A;  1G9K A;  3HDA P;  1XUD A;  3LIL A;  4FXY P;  2DW2 A;  1CGL A;  1BZS A;  4GWN A;  2Z2D A;  2HU6 A;  1UEA A;  3EWJ A;  2J83 A;  2OXU A;  1JH1 A;  1BKC I;  4GF1 A;  2JIH A;  4PKW A;  1BKC E;  3DPE A;  4QKZ A;  4LL2 A;  1BUD A;  1IAE A;  1AKL A;  3Q2H A;  3LP9 A;  2OY2 A;  5I43 A;  1CAQ A;  1ZXC A;  3U1R A;  3K7N A;  4IN9 A;  4WKI A;  3DPF A;  5CZM A;  1QJJ A;  1G49 A;  830C A;  5D1S A;  1MMR A;  1YP1 A;  2YB9 A;  4JA1 A;  3KEC A;  3ZUK A;  2OZR A;  1Q3A A;  1SLM A;  3OHL A;  3LEA A;  2FV9 A;  5BPA A; 
#chains in the Genus database with same CATH topology
 1JK3 A;  3RTS A;  1RMZ A;  3I7I A;  3KHI A;  1JIZ A;  1RM8 A;  3HB2 P;  5B5P A;  1OM6 A;  3OYO A;  2O3E A;  1SRP A;  2JT5 A;  5L79 A;  1XFY A;  3USN A;  1JAP A;  2JT6 A;  4JP4 A;  4XBH A;  3AYK A;  1QIA A;  2L0R A;  1JAN A;  1MMP A;  2MLS A;  1HFS A;  3LIK A;  4A3W A;  3G42 A;  1EB6 A;  2RJP A;  1XFW A;  4AUO A;  4J4M A;  2OXZ A;  1PWU A;  1YOU A;  1OM7 A;  4DF9 A;  1FBL A;  1GEN A;  4H30 A;  1OS9 A;  1K7Q A;  1KUG A;  5I0L A;  1KUH A;  4DD8 A;  4IJO A;  1HFC A;  1HTD A;  3LJT A;  3KRY A;  1D8F A;  1BSW A;  1QJI A;  3RTT A;  3ZXH A;  1GE6 A;  4PKS A;  5BOT A;  1IAB A;  1IAC A;  1IAA A;  4H82 A;  1AF0 A;  3EDH A;  1R1I A;  1CIZ A;  2E2D A;  1C8T A;  2MLR A;  1KAP P;  2K9C A;  1CGF A;  5D7W A;  1ZS0 A;  2W12 A;  5D2B A;  2O36 A;  1PWQ A;  4I35 A;  1K7G A;  2XS4 A;  2RJQ A;  1GKC A;  2MQS A;  1OM8 A;  4WZV A;  4GR0 A;  3EDZ A;  4L6T A;  4FU4 A;  1B8Y A;  1GE5 A;  1GKD A;  3LE9 A;  1SMP A;  2JSD A;  3KWV C;  1A85 A;  2MZH A;  3HY9 A;  3F16 A;  1JIW P;  1IAG A;  1PWW A;  1A86 A;  2X7M A;  2OVZ A;  4PKU A;  1ITV A;  1JAQ A;  1R54 A;  1D8M A;  2V4B A;  4XM6 A;  3O2X A;  4WKE A;  2TCL A;  1MMB A;  1QIB A;  3HYG A;  2DW0 A;  3KME A;  4ON1 A;  1FLS A;  1IAD A;  1OS2 A;  4G0D A;  1J7N A;  4H2E A;  4L63 A;  3TS4 A;  4HMA A;  4DPE A;  1UMS A;  5CUH A;  1Y93 A;  1HY7 A;  1EUB A;  3DWB A;  4H49 A;  2AYK A;  1QUA A;  1HOV A;  1DMT A;  2W15 A;  2YIG A;  1XFZ A;  3DSL A;  5B5O A;  2OY4 A;  3B2Z A;  5BOY A;  3NX7 A;  5D1T A;  3LUM A;  2QPJ A;  5CXA A;  2OW9 A;  4WK7 A;  4H76 A;  2YUF A;  3HBV P;  3LMC A;  3C7X A;  4ILW D;  5H8X A;  1BQO A;  2E3X A;  2USN A;  1QJS A;  3G5C A;  4PKV A;  1WNI A;  3N2U A;  4OEI A;  1YCM A;  3VI1 A;  2A8H A;  4EFS A;  3P24 A;  1L6J A;  3LJZ A;  3MA2 A;  2PJT A;  1R1H A;  3K7L A;  4PKR A;  2Y6D A;  5I4O A;  2K2G A;  5D3C A;  1XFX A;  3DL1 A;  1OZ9 A;  1CGE A;  4RT6 B;  1BUV M;  3LKA A;  2OW2 A;  3TSK A;  4G9L A;  4AIG A;  1PEX A;  3EDG A;  4XM8 A;  4XCT A;  4H3X A;  4JQG A;  1AYK A;  1CQR A;  3WV2 A;  1USN A;  2W0D A;  2DDF A;  3L0T A;  3UVC A;  4L7A A;  4H84 A;  1BM6 A;  2N8R A;  2XS3 A;  1I73 A;  4JPA A;  1SLN A;  3I7G A;  1PWP A;  1UTZ A;  1XUR A;  1KUI A;  3EHX A;  3LGP A;  1HV5 A;  3CKI A;  1G05 A;  3F1A A;  1XUC A;  3AYU A;  1XFU A;  4FVL A;  1ZXV A;  2KRJ A;  2J0T A;  1CXV A;  3TT4 A;  3F19 A;  1R1J A;  3LIR A;  1JKY A;  1Z3J A;  4R3V A;  4Q1L A;  4ZR5 A;  5I2Z A;  3LUN A;  1XM5 A;  1O0Q A;  1OMJ A;  3S18 A;  3LQ0 A;  1G4K A;  4I03 A;  3B8Z A;  3LQB A;  3DNG A;  5D1U A;  4JIJ A;  3F18 A;  3EHY A;  3HBU P;  2JXY A;  3ELM A;  1KBC A;  2Y6C A;  1QIC A;  4GUY A;  4GQL A;  1K7I A;  2ERO A;  3DTK A;  4DV8 A;  4IUW A;  4AYK A;  1ZTQ A;  3AIG A;  3N2V A;  1KUK A;  3VTG A;  3WV3 A;  2SRT A;  2I47 A;  3TVC A;  1GE7 A;  1ZP5 A;  2MZI A;  1I1I P;  2D1N A;  2OW1 A;  1C7K A;  5I3M A;  2X3A A;  1ZVX A;  3LK8 A;  1C3I A;  1MMQ A;  4PKT A;  1UTT A;  1S4B P;  3DTE A;  1HXN A;  1RTG A;  1MNC A;  1CK7 A;  4GR8 A;  2MZE A;  1BIW A;  4FXQ A;  3KMC A;  2CKI A;  2OW0 A;  3L0V A;  4H1Q A;  1G12 A;  1GXD A;  2X3C A;  1GO8 P;  2JNP A;  2W13 A;  1ATL A;  1AST A;  4HX3 A;  4GR3 A;  3WV1 A;  4A7B A;  3F17 A;  2OXW A;  3SHI A;  4PKQ A;  966C A;  1D7X A;  1SAT A;  3B92 A;  1BKC A;  2DDY A;  2D1O A;  4L19 A;  1BQQ M;  4CTH A;  1KUF A;  1JAO A;  4WF6 A;  3OHO A;  2POJ A;  4HSD A;  1SU3 A;  2OI0 A;  3Q2G A;  1OO9 A;  1B3D A;  1TVI A;  1QHU A;  3ZVS A;  4XM7 A;  1ND1 A;  1FM1 A;  3HY7 A;  3V96 B;  4AXQ A;  2W14 A;  4YEH A;  5I12 A;  1JJ9 A;  3GBO A;  1H71 P;  2X3B A;  2WO9 A;  2WO8 A;  1D5J A;  1Y0V A;  1Y8J A;  3KEJ A;  3O64 A;  1O0T A;  3P1V A;  2FV5 A;  3E8R A;  3LJG A;  5LAB A;  456C A;  5L7F A;  3V6N A;  1PWV A;  2WOA A;  2OVX A;  3KEK A;  1UMT A;  2AIG P;  1GO7 P;  4GWM A;  1I76 A;  1XFV A;  1YQY A;  5JMY A;  2ERP A;  1R55 A;  2CLT A;  3F15 A;  2DW1 A;  1DTH A;  1ROS A;  3EDI A;  2ERQ A;  1EAK A;  3HDB A;  3BA0 A;  1G9K A;  3HDA P;  1XUD A;  3LIL A;  4FXY P;  2DW2 A;  1CGL A;  1BZS A;  4GWN A;  2Z2D A;  2HU6 A;  1UEA A;  3EWJ A;  2J83 A;  2OXU A;  1JH1 A;  1BKC I;  4GF1 A;  2JIH A;  4PKW A;  1BKC E;  3DPE A;  4QKZ A;  4LL2 A;  3DTI A;  1BUD A;  1IAE A;  1AKL A;  3Q2H A;  3LP9 A;  2OY2 A;  1XAX A;  5I43 A;  1CAQ A;  1ZXC A;  3U1R A;  3K7N A;  4IN9 A;  4WKI A;  3DPF A;  5CZM A;  1QJJ A;  1G49 A;  830C A;  5D1S A;  1MMR A;  1YP1 A;  2YB9 A;  4JA1 A;  3KEC A;  3ZUK A;  2OZR A;  1Q3A A;  1SLM A;  3OHL A;  3LEA A;  2FV9 A;  5BPA A; 
#chains in the Genus database with same CATH homology
 1JK3 A;  3RTS A;  1RMZ A;  3I7I A;  3KHI A;  1JIZ A;  1RM8 A;  3HB2 P;  5B5P A;  1OM6 A;  3OYO A;  2O3E A;  1SRP A;  2JT5 A;  5L79 A;  1XFY A;  3USN A;  1JAP A;  2JT6 A;  4JP4 A;  4XBH A;  3AYK A;  1QIA A;  2L0R A;  1JAN A;  1MMP A;  2MLS A;  1HFS A;  3LIK A;  4A3W A;  3G42 A;  1EB6 A;  2RJP A;  1XFW A;  4AUO A;  4J4M A;  2OXZ A;  1PWU A;  1YOU A;  1OM7 A;  4DF9 A;  1FBL A;  1GEN A;  4H30 A;  1OS9 A;  1K7Q A;  1KUG A;  5I0L A;  1KUH A;  4DD8 A;  4IJO A;  1HFC A;  1HTD A;  3LJT A;  3KRY A;  1D8F A;  1BSW A;  1QJI A;  3RTT A;  3ZXH A;  1GE6 A;  4PKS A;  5BOT A;  1IAB A;  1IAC A;  1IAA A;  4H82 A;  1AF0 A;  3EDH A;  1R1I A;  1CIZ A;  2E2D A;  1C8T A;  2MLR A;  1KAP P;  2K9C A;  1CGF A;  5D7W A;  1ZS0 A;  2W12 A;  5D2B A;  2O36 A;  1PWQ A;  4I35 A;  1K7G A;  2XS4 A;  2RJQ A;  1GKC A;  2MQS A;  1OM8 A;  4WZV A;  4GR0 A;  3EDZ A;  4L6T A;  4FU4 A;  1B8Y A;  1GE5 A;  1GKD A;  3LE9 A;  1SMP A;  2JSD A;  3KWV C;  1A85 A;  2MZH A;  3HY9 A;  3F16 A;  1JIW P;  1IAG A;  1PWW A;  1A86 A;  2X7M A;  2OVZ A;  4PKU A;  1ITV A;  1JAQ A;  1R54 A;  1D8M A;  2V4B A;  4XM6 A;  3O2X A;  4WKE A;  2TCL A;  1MMB A;  1QIB A;  3HYG A;  2DW0 A;  3KME A;  4ON1 A;  1FLS A;  1IAD A;  1OS2 A;  4G0D A;  1J7N A;  4H2E A;  4L63 A;  3TS4 A;  4HMA A;  4DPE A;  1UMS A;  5CUH A;  1Y93 A;  1HY7 A;  1EUB A;  3DWB A;  4H49 A;  2AYK A;  1QUA A;  1HOV A;  1DMT A;  2W15 A;  2YIG A;  1XFZ A;  3DSL A;  5B5O A;  2OY4 A;  3B2Z A;  5BOY A;  3NX7 A;  5D1T A;  3LUM A;  2QPJ A;  5CXA A;  2OW9 A;  4WK7 A;  4H76 A;  2YUF A;  3HBV P;  3LMC A;  3C7X A;  4ILW D;  5H8X A;  1BQO A;  2E3X A;  2USN A;  1QJS A;  3G5C A;  4PKV A;  1WNI A;  3N2U A;  4OEI A;  1YCM A;  3VI1 A;  2A8H A;  4EFS A;  3P24 A;  1L6J A;  3LJZ A;  3MA2 A;  2PJT A;  1R1H A;  3K7L A;  4PKR A;  2Y6D A;  5I4O A;  2K2G A;  5D3C A;  1XFX A;  3DL1 A;  1CGE A;  4RT6 B;  1BUV M;  3LKA A;  2OW2 A;  3TSK A;  4G9L A;  4AIG A;  1PEX A;  3EDG A;  4XM8 A;  4XCT A;  4H3X A;  4JQG A;  1AYK A;  1CQR A;  3WV2 A;  1USN A;  2W0D A;  2DDF A;  3L0T A;  3UVC A;  4L7A A;  4H84 A;  1BM6 A;  2N8R A;  2XS3 A;  1I73 A;  4JPA A;  1SLN A;  3I7G A;  1PWP A;  1UTZ A;  1XUR A;  1KUI A;  3EHX A;  3LGP A;  1HV5 A;  3CKI A;  1G05 A;  3F1A A;  1XUC A;  3AYU A;  1XFU A;  4FVL A;  1ZXV A;  2KRJ A;  2J0T A;  1CXV A;  3TT4 A;  3F19 A;  1R1J A;  3LIR A;  1JKY A;  1Z3J A;  4R3V A;  4Q1L A;  4ZR5 A;  5I2Z A;  3LUN A;  1O0Q A;  1OMJ A;  3S18 A;  3LQ0 A;  1G4K A;  4I03 A;  3B8Z A;  3LQB A;  3DNG A;  5D1U A;  4JIJ A;  3F18 A;  3EHY A;  3HBU P;  2JXY A;  3ELM A;  1KBC A;  2Y6C A;  1QIC A;  4GUY A;  4GQL A;  1K7I A;  2ERO A;  3DTK A;  4DV8 A;  4IUW A;  4AYK A;  1ZTQ A;  3AIG A;  3N2V A;  1KUK A;  3VTG A;  3WV3 A;  2SRT A;  2I47 A;  3TVC A;  1GE7 A;  1ZP5 A;  2MZI A;  1I1I P;  2D1N A;  2OW1 A;  1C7K A;  5I3M A;  2X3A A;  1ZVX A;  3LK8 A;  1C3I A;  1MMQ A;  4PKT A;  1UTT A;  1S4B P;  3DTE A;  1HXN A;  1RTG A;  1MNC A;  1CK7 A;  4GR8 A;  2MZE A;  1BIW A;  4FXQ A;  3KMC A;  2CKI A;  2OW0 A;  3L0V A;  4H1Q A;  1G12 A;  1GXD A;  2X3C A;  1GO8 P;  2JNP A;  2W13 A;  1ATL A;  1AST A;  4HX3 A;  4GR3 A;  3WV1 A;  4A7B A;  3F17 A;  2OXW A;  3SHI A;  4PKQ A;  966C A;  1D7X A;  1SAT A;  3B92 A;  1BKC A;  2DDY A;  2D1O A;  4L19 A;  1BQQ M;  4CTH A;  1KUF A;  1JAO A;  4WF6 A;  3OHO A;  2POJ A;  4HSD A;  1SU3 A;  2OI0 A;  3Q2G A;  1OO9 A;  1B3D A;  3ZVS A;  1QHU A;  4XM7 A;  1ND1 A;  1FM1 A;  3HY7 A;  3V96 B;  4AXQ A;  2W14 A;  4YEH A;  5I12 A;  1JJ9 A;  3GBO A;  1H71 P;  2X3B A;  2WO9 A;  2WO8 A;  1D5J A;  1Y0V A;  1Y8J A;  3KEJ A;  3O64 A;  1O0T A;  3P1V A;  2FV5 A;  3E8R A;  3LJG A;  5LAB A;  456C A;  5L7F A;  3V6N A;  1PWV A;  2WOA A;  2OVX A;  3KEK A;  1UMT A;  2AIG P;  1GO7 P;  4GWM A;  1I76 A;  1XFV A;  1YQY A;  5JMY A;  2ERP A;  1R55 A;  2CLT A;  3F15 A;  2DW1 A;  1DTH A;  1ROS A;  3EDI A;  2ERQ A;  1EAK A;  3HDB A;  3BA0 A;  1G9K A;  3HDA P;  1XUD A;  3LIL A;  4FXY P;  2DW2 A;  1CGL A;  1BZS A;  4GWN A;  2Z2D A;  2HU6 A;  1UEA A;  3EWJ A;  2J83 A;  2OXU A;  1JH1 A;  1BKC I;  4GF1 A;  2JIH A;  4PKW A;  1BKC E;  3DPE A;  4QKZ A;  4LL2 A;  3DTI A;  1BUD A;  1IAE A;  1AKL A;  3Q2H A;  3LP9 A;  2OY2 A;  5I43 A;  1CAQ A;  1ZXC A;  3U1R A;  3K7N A;  4IN9 A;  4WKI A;  3DPF A;  5CZM A;  1QJJ A;  1G49 A;  830C A;  5D1S A;  1MMR A;  1YP1 A;  2YB9 A;  4JA1 A;  3KEC A;  3ZUK A;  2OZR A;  1Q3A A;  1SLM A;  3OHL A;  3LEA A;  2FV9 A;  5BPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...