4AUOA

Crystal structure of mmp-1(e200a) in complex with a triple-helical collagen peptide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
367
structure length
367
Chain Sequence
b'FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHALGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERSTITIAL COLLAGENASE
publication title Structural Insights Into Triple-Helical Collagen Cleavage by Matrix Metalloproteinase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
total genus 81
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00045 Hemopexin Hemopexin
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.110.10.10 Mainly Beta 4 Propeller Hemopexin Hemopexin-like domain 4auoA02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4auoA01
1SLNA 1PWVA 3ZUKA 3DL1A 3USNA 1MNCA 2D1NA 1FM1A 1G49A 5B5OA 1XUCA 2JT6A 4XM7A 3TSKA 1YQYA 1MMPA 3RTTA 3F19A 4JIJA 4DF9A 1MMBA 3EDHA 4H82A 2O36A 3U1RA 3O2XA 4GR8A 4CTHA 4WF6A 1QIAA 4FXYP 4I35A 4Q1LA 1B8YA 5L79A 5I0LA 1GKCA 4GR0A 4H84A 3K7LA 2POJA 1L6JA 1ZP5A 3EDIA 4I03A 1G4KA 3LK8A 3L0TA 1A86A 2YB9A 1BKCA 3P1VA 1QIBA 5JMYA 1OS9A 2X7MA 2SRTA 1XFXA 4L19A 1S4BP 5H8XA 3LP9A 1RTGA 3I7IA 1KBCA 3CKIA 1WNIA 2RJPA 4L6TA 4OEIA 1O0TA 1DMTA 5CZMA 2W14A 2W0DA 2K2GA 1QJIA 3TVCA 1HFSA 1IAAA 830CA 5I12A 3AIGA 1JH1A 2K9CA 3E8RA 5BOYA 4JPAA 1KUFA 2OW9A 3KWVC 3LQ0A 5LABA 1XFWA 1HOVA 4DPEA 1OM6A 3B2ZA 4PKWA 4AUOA 4H30A 1QHUA 2MZIA 3B8ZA 3LKAA 5B5PA 1Z3JA 2AYKA 4PKSA 1GENA 2OW1A 1GKDA 4G0DA 2DW2A 3HBVP 2JNPA 2DDYA 2E2DA 1JK3A 1SU3A 5I4OA 5D1SA 4ILWD 2OZRA 1ATLA 3O64A 1XUDA 1IACA 2I47A 1D7XA 4AIGA 3Q2GA 4PKVA 1D5JA 5D3CA 4FU4A 1YCMA 3F18A 2MLSA 4WZVA 966CA 3LJGA 1SLMA 3ZXHA 1D8MA 3EHYA 1I76A 456CA 2JT5A 3LGPA 1IAEA 3ELMA 4AYKA 2W12A 3TT4A 2Z2DA 3EDZA 3KHIA 1UTTA 4IJOA 1BM6A 4WKEA 2JSDA 1QUAA 1JAPA 3P24A 2Y6DA 4PKUA 2CLTA 5CXAA 1HFCA 4PKQA 1H71P 1JAOA 3EHXA 1FLSA 1Y93A 4H3XA 3GBOA 1JANA 1PWQA 2MLRA 1HTDA 1I73A 1J7NA 4JQGA 3SHIA 2XS3A 3NX7A 1CXVA 3N2VA 4QKZA 2N8RA 1PWWA 1MMRA 4RT6B 3OYOA 2WO9A 4LL2A 1XURA 2KRJA 1Y0VA 2DW0A 1BQQM 5D2BA 1BKCI 2DDFA 4L63A 3HDAP 3WV3A 1A85A 1ROSA 3MA2A 2EROA 5BPAA 1GE7A 2WOAA 1AKLA 3G42A 2JIHA 3DSLA 3HY9A 3LIRA 5D1UA 1C3IA 3LUNA 2OVZA 4DV8A 1O0QA 3KMCA 1Y8JA 2JXYA 2OXUA 3C7XA 1PEXA 1BKCE 1UEAA 1KUGA 1R1HA 3WV2A 4XBHA 3N2UA 3KRYA 3DWBA 1JAQA 2X3BA 3HY7A 1R55A 3HBUP 3HB2P 3V96B 5BOTA 4FVLA 3BA0A 3HYGA 1QJJA 1ASTA 3F15A 4GF1A 1KUIA 2E3XA 2FV9A 5CUHA 2MQSA 1K7GA 2J0TA 2FV5A 1I1IP 3LEAA 1R54A 2O3EA 1GO8P 1HY7A 4PKTA 1JKYA 1IADA 1C7KA 3LJTA 1CK7A 4HX3A 1OM7A 1ITVA 1K7QA 1GE5A 5L7FA 3DPFA 3F16A 1SATA 1KUHA 1OO9A 2HU6A 3AYKA 4GWMA 1EB6A 2MZEA 1ZVXA 1G9KA 2D1OA 1USNA 4A3WA 1FBLA 2CKIA 1YP1A 2WO8A 4H1QA 1KUKA 2OXWA 4JP4A 4J4MA 3F17A 1BQOA 1OMJA 4YEHA 3LILA 1BSWA 3Q2HA 3V6NA 2ERPA 3LIKA 3LUMA 2Y6CA 1DTHA 4R3VA 2OI0A 5I3MA 1IABA 1ZXCA 4HSDA 1G05A 4PKRA 3LQBA 1EAKA 1ZXVA 1UMSA 2DW1A 1G12A 4H2EA 3L0VA 1JIZA 2X3AA 3LE9A 1C8TA 3KECA 1D8FA 3WV1A 3AYUA 1UMTA 3OHLA 1BIWA 1YOUA 1GE6A 2TCLA 1GO7P 1ZTQA 2MZHA 3LMCA 1ZS0A 3VTGA 3G5CA 3I7GA 2AIGP 2X3CA 4GR3A 4XCTA 4A7BA 3TS4A 1EUBA 1CGLA 2OY2A 1KAPP 4XM8A 1CGFA 1BUDA 1CGEA 4DD8A 5I2ZA 4FXQA 4GQLA 2V4BA 4IN9A 4XM6A 2L0RA 2ERQA 3KMEA 3DNGA 4IUWA 1QJSA 1PWUA 1XFVA 5D1TA 2OXZA 3DPEA 1OS2A 1HXNA 4AXQA 4ON1A 3EWJA 2QPJA 3ZVSA 1PWPA 3HDBA 1OM8A 1AF0A 2OW0A 3K7NA 1IAGA 1JJ9A 1K7IA 1MMQA 2J83A 1Q3AA 2W13A 3OHOA 5I43A 3EDGA 4WK7A 2XS4A 1SMPA 1BUVM 2OW2A 1BZSA 1ND1A 5D7WA 1R1JA 4ZR5A 2OY4A 3UVCA 3S18A 3B92A 4H76A 1RM8A 4GWNA 2W15A 4EFSA 4HMAA 1SRPA 2YIGA 2USNA 1CIZA 3KEKA 3RTSA 4GUYA 1HV5A 3VI1A 1B3DA 3KEJA 1JIWP 1XFUA 1QICA 1UTZA 4WKIA 2RJQA 2PJTA 1CQRA 1GXDA 1XFYA 3LJZA 2A8HA 4G9LA 4H49A 1CAQA 1RMZA 1AYKA 1XFZA 1R1IA 2OVXA 3F1AA 4JA1A
chains in the Genus database with same CATH superfamily
1SLNA 1PWVA 3ZUKA 3DL1A 3USNA 1MNCA 2D1NA 1FM1A 1G49A 5B5OA 3DTKA 1XUCA 2JT6A 4XM7A 3TSKA 1YQYA 1MMPA 3RTTA 3F19A 4JIJA 4DF9A 1MMBA 3EDHA 4H82A 2O36A 3U1RA 3O2XA 4GR8A 4CTHA 4WF6A 1QIAA 4FXYP 4I35A 4Q1LA 1B8YA 5L79A 5I0LA 1GKCA 4GR0A 4H84A 3K7LA 2POJA 1L6JA 1ZP5A 3EDIA 4I03A 1G4KA 3LK8A 3L0TA 1A86A 2YB9A 1BKCA 3P1VA 1QIBA 5JMYA 1OS9A 2X7MA 2SRTA 1XFXA 4L19A 1S4BP 5H8XA 3LP9A 1RTGA 3I7IA 1KBCA 3CKIA 1WNIA 2RJPA 4L6TA 4OEIA 1O0TA 1DMTA 5CZMA 2W14A 2W0DA 2K2GA 1QJIA 3TVCA 1HFSA 1IAAA 830CA 5I12A 3AIGA 1JH1A 2K9CA 3E8RA 5BOYA 4JPAA 3DTEA 1KUFA 2OW9A 3KWVC 3LQ0A 5LABA 1XFWA 1HOVA 4DPEA 1OM6A 3B2ZA 4PKWA 4AUOA 4H30A 1QHUA 2MZIA 3B8ZA 3LKAA 5B5PA 1Z3JA 2AYKA 4PKSA 1GENA 2OW1A 1GKDA 4G0DA 2DW2A 3HBVP 2JNPA 2DDYA 2E2DA 1JK3A 1SU3A 5I4OA 5D1SA 4ILWD 2OZRA 1ATLA 3O64A 1XUDA 1IACA 2I47A 1D7XA 4AIGA 3Q2GA 4PKVA 1D5JA 5D3CA 4FU4A 1YCMA 3F18A 2MLSA 4WZVA 966CA 3LJGA 1SLMA 3ZXHA 1D8MA 3EHYA 1I76A 456CA 2JT5A 3LGPA 1IAEA 3ELMA 4AYKA 2W12A 3TT4A 2Z2DA 3EDZA 3KHIA 1UTTA 4IJOA 1BM6A 4WKEA 2JSDA 1QUAA 1JAPA 3P24A 2Y6DA 4PKUA 2CLTA 5CXAA 1HFCA 4PKQA 1H71P 1JAOA 3EHXA 1FLSA 1Y93A 4H3XA 3GBOA 1JANA 1PWQA 2MLRA 1HTDA 1I73A 1J7NA 4JQGA 4L7AA 3SHIA 2XS3A 3NX7A 1CXVA 3N2VA 4QKZA 2N8RA 1PWWA 3DTIA 1MMRA 4RT6B 3OYOA 2WO9A 4LL2A 1XURA 2KRJA 1Y0VA 2YUFA 2DW0A 1BQQM 5D2BA 1BKCI 2DDFA 4L63A 3HDAP 3WV3A 1A85A 1ROSA 3MA2A 2EROA 5BPAA 1GE7A 2WOAA 1AKLA 3G42A 2JIHA 3DSLA 3HY9A 3LIRA 5D1UA 1C3IA 3LUNA 2OVZA 4DV8A 1O0QA 3KMCA 1Y8JA 2JXYA 2OXUA 3C7XA 1PEXA 1BKCE 1UEAA 1KUGA 1R1HA 1TVIA 1OZ9A 3WV2A 4XBHA 3N2UA 3KRYA 3DWBA 1JAQA 2X3BA 3HY7A 1R55A 3HBUP 3HB2P 3V96B 5BOTA 4FVLA 3BA0A 3HYGA 1QJJA 1ASTA 3F15A 4GF1A 1KUIA 2E3XA 2FV9A 5CUHA 2MQSA 1K7GA 2J0TA 2FV5A 1I1IP 3LEAA 1R54A 2O3EA 1GO8P 1HY7A 4PKTA 1JKYA 1IADA 1C7KA 3LJTA 1CK7A 4HX3A 1OM7A 1ITVA 1K7QA 1GE5A 5L7FA 3DPFA 3F16A 1SATA 1KUHA 1OO9A 2HU6A 3AYKA 4GWMA 1EB6A 2MZEA 1ZVXA 1G9KA 2D1OA 1USNA 4A3WA 1FBLA 2CKIA 1YP1A 2WO8A 4H1QA 1KUKA 2OXWA 4JP4A 4J4MA 3F17A 1BQOA 1OMJA 4YEHA 3LILA 1BSWA 3Q2HA 3V6NA 2ERPA 3LIKA 3LUMA 2Y6CA 1DTHA 4R3VA 2OI0A 5I3MA 1IABA 1ZXCA 4HSDA 1G05A 4PKRA 3LQBA 1EAKA 1ZXVA 1UMSA 2DW1A 1G12A 4H2EA 3L0VA 1JIZA 2X3AA 3LE9A 1C8TA 3KECA 1D8FA 3WV1A 3AYUA 1UMTA 3OHLA 1BIWA 1YOUA 1GE6A 2TCLA 1XM5A 1GO7P 1ZTQA 2MZHA 3LMCA 1ZS0A 3VTGA 3G5CA 3I7GA 2AIGP 2X3CA 4GR3A 4XCTA 4A7BA 3TS4A 1EUBA 1CGLA 2OY2A 1KAPP 4XM8A 1CGFA 1BUDA 1CGEA 4DD8A 5I2ZA 4FXQA 4GQLA 2V4BA 4IN9A 4XM6A 2L0RA 2ERQA 3KMEA 3DNGA 4IUWA 1QJSA 1PWUA 1XFVA 5D1TA 2OXZA 3DPEA 1OS2A 1HXNA 4AXQA 4ON1A 3EWJA 2QPJA 3ZVSA 1PWPA 3HDBA 1OM8A 1AF0A 2OW0A 3K7NA 1IAGA 1JJ9A 1K7IA 1MMQA 2J83A 1Q3AA 2W13A 3OHOA 5I43A 3EDGA 4WK7A 2XS4A 1SMPA 1BUVM 2OW2A 1BZSA 1ND1A 5D7WA 1R1JA 4ZR5A 2OY4A 3UVCA 3S18A 3B92A 4H76A 1RM8A 4GWNA 2W15A 4EFSA 4HMAA 1SRPA 2YIGA 2USNA 1CIZA 3KEKA 3RTSA 4GUYA 1HV5A 3VI1A 1B3DA 3KEJA 1JIWP 1XFUA 1QICA 1UTZA 4WKIA 2RJQA 2PJTA 1CQRA 1GXDA 1XFYA 3LJZA 1XAXA 2A8HA 4G9LA 4H49A 1CAQA 1RMZA 1AYKA 1XFZA 1R1IA 2OVXA 3F1AA 4JA1A
chains in the Genus database with same CATH topology
1SLNA 1PWVA 3ZUKA 3DL1A 3USNA 1MNCA 2D1NA 1FM1A 1G49A 5B5OA 3DTKA 1XUCA 2JT6A 4XM7A 3TSKA 1YQYA 1MMPA 3RTTA 3F19A 4JIJA 4DF9A 1MMBA 3EDHA 4H82A 2O36A 3U1RA 3O2XA 4GR8A 4CTHA 4WF6A 1QIAA 4FXYP 4I35A 4Q1LA 1B8YA 5L79A 5I0LA 1GKCA 4GR0A 4H84A 3K7LA 2POJA 1L6JA 1ZP5A 3EDIA 4I03A 1G4KA 3LK8A 3L0TA 1A86A 2YB9A 1BKCA 3P1VA 1QIBA 5JMYA 1OS9A 2X7MA 2SRTA 1XFXA 4L19A 1S4BP 5H8XA 3LP9A 1RTGA 3I7IA 1KBCA 3CKIA 1WNIA 2RJPA 4L6TA 4OEIA 1O0TA 1DMTA 5CZMA 2W14A 2W0DA 2K2GA 1QJIA 3TVCA 1HFSA 1IAAA 830CA 5I12A 3AIGA 1JH1A 2K9CA 3E8RA 5BOYA 4JPAA 3DTEA 1KUFA 2OW9A 3KWVC 3LQ0A 5LABA 1XFWA 1HOVA 4DPEA 1OM6A 3B2ZA 4PKWA 4AUOA 4H30A 1QHUA 2MZIA 3B8ZA 3LKAA 5B5PA 1Z3JA 2AYKA 4PKSA 1GENA 2OW1A 1GKDA 4G0DA 2DW2A 3HBVP 2JNPA 2DDYA 2E2DA 1JK3A 1SU3A 5I4OA 5D1SA 4ILWD 2OZRA 1ATLA 3O64A 1XUDA 1IACA 2I47A 1D7XA 4AIGA 3Q2GA 4PKVA 1D5JA 5D3CA 4FU4A 1YCMA 3F18A 2MLSA 4WZVA 966CA 3LJGA 1SLMA 3ZXHA 1D8MA 3EHYA 1I76A 456CA 2JT5A 3LGPA 1IAEA 3ELMA 4AYKA 2W12A 3TT4A 2Z2DA 3EDZA 3KHIA 1UTTA 4IJOA 1BM6A 4WKEA 2JSDA 1QUAA 1JAPA 3P24A 2Y6DA 4PKUA 2CLTA 5CXAA 1HFCA 4PKQA 1H71P 1JAOA 3EHXA 1FLSA 1Y93A 4H3XA 3GBOA 1JANA 1PWQA 2MLRA 1HTDA 1I73A 1J7NA 4JQGA 4L7AA 3SHIA 2XS3A 3NX7A 1CXVA 3N2VA 4QKZA 2N8RA 1PWWA 3DTIA 1MMRA 4RT6B 3OYOA 2WO9A 4LL2A 1XURA 2KRJA 1Y0VA 2YUFA 2DW0A 1BQQM 5D2BA 1BKCI 2DDFA 4L63A 3HDAP 3WV3A 1A85A 1ROSA 3MA2A 2EROA 5BPAA 1GE7A 2WOAA 1AKLA 3G42A 2JIHA 3DSLA 3HY9A 3LIRA 5D1UA 1C3IA 3LUNA 2OVZA 4DV8A 1O0QA 3KMCA 1Y8JA 2JXYA 2OXUA 3C7XA 1PEXA 1BKCE 1UEAA 1KUGA 1R1HA 3WV2A 4XBHA 3N2UA 3KRYA 3DWBA 1JAQA 2X3BA 3HY7A 1R55A 3HBUP 3HB2P 3V96B 5BOTA 4FVLA 3BA0A 3HYGA 1QJJA 1ASTA 3F15A 4GF1A 1KUIA 2E3XA 2FV9A 5CUHA 2MQSA 1K7GA 2J0TA 2FV5A 1I1IP 3LEAA 1R54A 2O3EA 1GO8P 1HY7A 4PKTA 1JKYA 1IADA 1C7KA 3LJTA 1CK7A 4HX3A 1OM7A 1ITVA 1K7QA 1GE5A 5L7FA 3DPFA 3F16A 1SATA 1KUHA 1OO9A 2HU6A 3AYKA 4GWMA 1EB6A 2MZEA 1ZVXA 1G9KA 2D1OA 1USNA 4A3WA 1FBLA 2CKIA 1YP1A 2WO8A 4H1QA 1KUKA 2OXWA 4JP4A 4J4MA 3F17A 1BQOA 1OMJA 4YEHA 3LILA 1BSWA 3Q2HA 3V6NA 2ERPA 3LIKA 3LUMA 2Y6CA 1DTHA 4R3VA 2OI0A 5I3MA 1IABA 1ZXCA 4HSDA 1G05A 4PKRA 3LQBA 1EAKA 1ZXVA 1UMSA 2DW1A 1G12A 4H2EA 3L0VA 1JIZA 2X3AA 3LE9A 1C8TA 3KECA 1D8FA 3WV1A 3AYUA 1UMTA 3OHLA 1BIWA 1YOUA 1GE6A 2TCLA 1GO7P 1ZTQA 2MZHA 3LMCA 1ZS0A 3VTGA 3G5CA 3I7GA 2AIGP 2X3CA 4GR3A 4XCTA 4A7BA 3TS4A 1EUBA 1CGLA 2OY2A 1KAPP 4XM8A 1CGFA 1BUDA 1CGEA 4DD8A 5I2ZA 4FXQA 4GQLA 2V4BA 4IN9A 4XM6A 2L0RA 2ERQA 3KMEA 3DNGA 4IUWA 1QJSA 1PWUA 1XFVA 5D1TA 2OXZA 3DPEA 1OS2A 1HXNA 4AXQA 4ON1A 3EWJA 2QPJA 3ZVSA 1PWPA 3HDBA 1OM8A 1AF0A 2OW0A 3K7NA 1IAGA 1JJ9A 1K7IA 1MMQA 2J83A 1Q3AA 2W13A 3OHOA 5I43A 3EDGA 4WK7A 2XS4A 1SMPA 1BUVM 2OW2A 1BZSA 1ND1A 5D7WA 1R1JA 4ZR5A 2OY4A 3UVCA 3S18A 3B92A 4H76A 1RM8A 4GWNA 2W15A 4EFSA 4HMAA 1SRPA 2YIGA 2USNA 1CIZA 3KEKA 3RTSA 4GUYA 1HV5A 3VI1A 1B3DA 3KEJA 1JIWP 1XFUA 1QICA 1UTZA 4WKIA 2RJQA 2PJTA 1CQRA 1GXDA 1XFYA 3LJZA 2A8HA 4G9LA 4H49A 1CAQA 1RMZA 1AYKA 1XFZA 1R1IA 2OVXA 3F1AA 4JA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SLN A;  1PWV A;  3ZUK A;  3DL1 A;  3USN A;  1MNC A;  2D1N A;  1FM1 A;  1G49 A;  5B5O A;  1XUC A;  2JT6 A;  4XM7 A;  3TSK A;  1YQY A;  1MMP A;  3RTT A;  3F19 A;  4JIJ A;  4DF9 A;  1MMB A;  3EDH A;  4H82 A;  2O36 A;  3U1R A;  3O2X A;  4GR8 A;  4CTH A;  4WF6 A;  1QIA A;  4FXY P;  4I35 A;  4Q1L A;  1B8Y A;  5L79 A;  5I0L A;  1GKC A;  4GR0 A;  4H84 A;  3K7L A;  2POJ A;  1L6J A;  1ZP5 A;  3EDI A;  4I03 A;  1G4K A;  3LK8 A;  3L0T A;  1A86 A;  2YB9 A;  1BKC A;  3P1V A;  1QIB A;  5JMY A;  1OS9 A;  2X7M A;  2SRT A;  1XFX A;  4L19 A;  1S4B P;  5H8X A;  3LP9 A;  1RTG A;  3I7I A;  1KBC A;  3CKI A;  1WNI A;  2RJP A;  4L6T A;  4OEI A;  1O0T A;  1DMT A;  5CZM A;  2W14 A;  2W0D A;  2K2G A;  1QJI A;  3TVC A;  1HFS A;  1IAA A;  830C A;  5I12 A;  3AIG A;  1JH1 A;  2K9C A;  3E8R A;  5BOY A;  4JPA A;  1KUF A;  2OW9 A;  3KWV C;  3LQ0 A;  5LAB A;  1XFW A;  1HOV A;  4DPE A;  1OM6 A;  3B2Z A;  4PKW A;  4AUO A;  4H30 A;  1QHU A;  2MZI A;  3B8Z A;  3LKA A;  5B5P A;  1Z3J A;  2AYK A;  4PKS A;  1GEN A;  2OW1 A;  1GKD A;  4G0D A;  2DW2 A;  3HBV P;  2JNP A;  2DDY A;  2E2D A;  1JK3 A;  1SU3 A;  5I4O A;  5D1S A;  4ILW D;  2OZR A;  1ATL A;  3O64 A;  1XUD A;  1IAC A;  2I47 A;  1D7X A;  4AIG A;  3Q2G A;  4PKV A;  1D5J A;  5D3C A;  4FU4 A;  1YCM A;  3F18 A;  2MLS A;  4WZV A;  966C A;  3LJG A;  1SLM A;  3ZXH A;  1D8M A;  3EHY A;  1I76 A;  456C A;  2JT5 A;  3LGP A;  1IAE A;  3ELM A;  4AYK A;  2W12 A;  3TT4 A;  2Z2D A;  3EDZ A;  3KHI A;  1UTT A;  4IJO A;  1BM6 A;  4WKE A;  2JSD A;  1QUA A;  1JAP A;  3P24 A;  2Y6D A;  4PKU A;  2CLT A;  5CXA A;  1HFC A;  4PKQ A;  1H71 P;  1JAO A;  3EHX A;  1FLS A;  1Y93 A;  4H3X A;  3GBO A;  1JAN A;  1PWQ A;  2MLR A;  1HTD A;  1I73 A;  1J7N A;  4JQG A;  3SHI A;  2XS3 A;  3NX7 A;  1CXV A;  3N2V A;  4QKZ A;  2N8R A;  1PWW A;  1MMR A;  4RT6 B;  3OYO A;  2WO9 A;  4LL2 A;  1XUR A;  2KRJ A;  1Y0V A;  2DW0 A;  1BQQ M;  5D2B A;  1BKC I;  2DDF A;  4L63 A;  3HDA P;  3WV3 A;  1A85 A;  1ROS A;  3MA2 A;  2ERO A;  5BPA A;  1GE7 A;  2WOA A;  1AKL A;  3G42 A;  2JIH A;  3DSL A;  3HY9 A;  3LIR A;  5D1U A;  1C3I A;  3LUN A;  2OVZ A;  4DV8 A;  1O0Q A;  3KMC A;  1Y8J A;  2JXY A;  2OXU A;  3C7X A;  1PEX A;  1BKC E;  1UEA A;  1KUG A;  1R1H A;  3WV2 A;  4XBH A;  3N2U A;  3KRY A;  3DWB A;  1JAQ A;  2X3B A;  3HY7 A;  1R55 A;  3HBU P;  3HB2 P;  3V96 B;  5BOT A;  4FVL A;  3BA0 A;  3HYG A;  1QJJ A;  1AST A;  3F15 A;  4GF1 A;  1KUI A;  2E3X A;  2FV9 A;  5CUH A;  2MQS A;  1K7G A;  2J0T A;  2FV5 A;  1I1I P;  3LEA A;  1R54 A;  2O3E A;  1GO8 P;  1HY7 A;  4PKT A;  1JKY A;  1IAD A;  1C7K A;  3LJT A;  1CK7 A;  4HX3 A;  1OM7 A;  1ITV A;  1K7Q A;  1GE5 A;  5L7F A;  3DPF A;  3F16 A;  1SAT A;  1KUH A;  1OO9 A;  2HU6 A;  3AYK A;  4GWM A;  1EB6 A;  2MZE A;  1ZVX A;  1G9K A;  2D1O A;  1USN A;  4A3W A;  1FBL A;  2CKI A;  1YP1 A;  2WO8 A;  4H1Q A;  1KUK A;  2OXW A;  4JP4 A;  4J4M A;  3F17 A;  1BQO A;  1OMJ A;  4YEH A;  3LIL A;  1BSW A;  3Q2H A;  3V6N A;  2ERP A;  3LIK A;  3LUM A;  2Y6C A;  1DTH A;  4R3V A;  2OI0 A;  5I3M A;  1IAB A;  1ZXC A;  4HSD A;  1G05 A;  4PKR A;  3LQB A;  1EAK A;  1ZXV A;  1UMS A;  2DW1 A;  1G12 A;  4H2E A;  3L0V A;  1JIZ A;  2X3A A;  3LE9 A;  1C8T A;  3KEC A;  1D8F A;  3WV1 A;  3AYU A;  1UMT A;  3OHL A;  1BIW A;  1YOU A;  1GE6 A;  2TCL A;  1GO7 P;  1ZTQ A;  2MZH A;  3LMC A;  1ZS0 A;  3VTG A;  3G5C A;  3I7G A;  2AIG P;  2X3C A;  4GR3 A;  4XCT A;  4A7B A;  3TS4 A;  1EUB A;  1CGL A;  2OY2 A;  1KAP P;  4XM8 A;  1CGF A;  1BUD A;  1CGE A;  4DD8 A;  5I2Z A;  4FXQ A;  4GQL A;  2V4B A;  4IN9 A;  4XM6 A;  2L0R A;  2ERQ A;  3KME A;  3DNG A;  4IUW A;  1QJS A;  1PWU A;  1XFV A;  5D1T A;  2OXZ A;  3DPE A;  1OS2 A;  1HXN A;  4AXQ A;  4ON1 A;  3EWJ A;  2QPJ A;  3ZVS A;  1PWP A;  3HDB A;  1OM8 A;  1AF0 A;  2OW0 A;  3K7N A;  1IAG A;  1JJ9 A;  1K7I A;  1MMQ A;  2J83 A;  1Q3A A;  2W13 A;  3OHO A;  5I43 A;  3EDG A;  4WK7 A;  2XS4 A;  1SMP A;  1BUV M;  2OW2 A;  1BZS A;  1ND1 A;  5D7W A;  1R1J A;  4ZR5 A;  2OY4 A;  3UVC A;  3S18 A;  3B92 A;  4H76 A;  1RM8 A;  4GWN A;  2W15 A;  4EFS A;  4HMA A;  1SRP A;  2YIG A;  2USN A;  1CIZ A;  3KEK A;  3RTS A;  4GUY A;  1HV5 A;  3VI1 A;  1B3D A;  3KEJ A;  1JIW P;  1XFU A;  1QIC A;  1UTZ A;  4WKI A;  2RJQ A;  2PJT A;  1CQR A;  1GXD A;  1XFY A;  3LJZ A;  2A8H A;  4G9L A;  4H49 A;  1CAQ A;  1RMZ A;  1AYK A;  1XFZ A;  1R1I A;  2OVX A;  3F1A A;  4JA1 A; 
#chains in the Genus database with same CATH topology
 1SLN A;  1PWV A;  3ZUK A;  3DL1 A;  3USN A;  1MNC A;  2D1N A;  1FM1 A;  1G49 A;  5B5O A;  3DTK A;  1XUC A;  2JT6 A;  4XM7 A;  3TSK A;  1YQY A;  1MMP A;  3RTT A;  3F19 A;  4JIJ A;  4DF9 A;  1MMB A;  3EDH A;  4H82 A;  2O36 A;  3U1R A;  3O2X A;  4GR8 A;  4CTH A;  4WF6 A;  1QIA A;  4FXY P;  4I35 A;  4Q1L A;  1B8Y A;  5L79 A;  5I0L A;  1GKC A;  4GR0 A;  4H84 A;  3K7L A;  2POJ A;  1L6J A;  1ZP5 A;  3EDI A;  4I03 A;  1G4K A;  3LK8 A;  3L0T A;  1A86 A;  2YB9 A;  1BKC A;  3P1V A;  1QIB A;  5JMY A;  1OS9 A;  2X7M A;  2SRT A;  1XFX A;  4L19 A;  1S4B P;  5H8X A;  3LP9 A;  1RTG A;  3I7I A;  1KBC A;  3CKI A;  1WNI A;  2RJP A;  4L6T A;  4OEI A;  1O0T A;  1DMT A;  5CZM A;  2W14 A;  2W0D A;  2K2G A;  1QJI A;  3TVC A;  1HFS A;  1IAA A;  830C A;  5I12 A;  3AIG A;  1JH1 A;  2K9C A;  3E8R A;  5BOY A;  4JPA A;  3DTE A;  1KUF A;  2OW9 A;  3KWV C;  3LQ0 A;  5LAB A;  1XFW A;  1HOV A;  4DPE A;  1OM6 A;  3B2Z A;  4PKW A;  4AUO A;  4H30 A;  1QHU A;  2MZI A;  3B8Z A;  3LKA A;  5B5P A;  1Z3J A;  2AYK A;  4PKS A;  1GEN A;  2OW1 A;  1GKD A;  4G0D A;  2DW2 A;  3HBV P;  2JNP A;  2DDY A;  2E2D A;  1JK3 A;  1SU3 A;  5I4O A;  5D1S A;  4ILW D;  2OZR A;  1ATL A;  3O64 A;  1XUD A;  1IAC A;  2I47 A;  1D7X A;  4AIG A;  3Q2G A;  4PKV A;  1D5J A;  5D3C A;  4FU4 A;  1YCM A;  3F18 A;  2MLS A;  4WZV A;  966C A;  3LJG A;  1SLM A;  3ZXH A;  1D8M A;  3EHY A;  1I76 A;  456C A;  2JT5 A;  3LGP A;  1IAE A;  3ELM A;  4AYK A;  2W12 A;  3TT4 A;  2Z2D A;  3EDZ A;  3KHI A;  1UTT A;  4IJO A;  1BM6 A;  4WKE A;  2JSD A;  1QUA A;  1JAP A;  3P24 A;  2Y6D A;  4PKU A;  2CLT A;  5CXA A;  1HFC A;  4PKQ A;  1H71 P;  1JAO A;  3EHX A;  1FLS A;  1Y93 A;  4H3X A;  3GBO A;  1JAN A;  1PWQ A;  2MLR A;  1HTD A;  1I73 A;  1J7N A;  4JQG A;  4L7A A;  3SHI A;  2XS3 A;  3NX7 A;  1CXV A;  3N2V A;  4QKZ A;  2N8R A;  1PWW A;  3DTI A;  1MMR A;  4RT6 B;  3OYO A;  2WO9 A;  4LL2 A;  1XUR A;  2KRJ A;  1Y0V A;  2YUF A;  2DW0 A;  1BQQ M;  5D2B A;  1BKC I;  2DDF A;  4L63 A;  3HDA P;  3WV3 A;  1A85 A;  1ROS A;  3MA2 A;  2ERO A;  5BPA A;  1GE7 A;  2WOA A;  1AKL A;  3G42 A;  2JIH A;  3DSL A;  3HY9 A;  3LIR A;  5D1U A;  1C3I A;  3LUN A;  2OVZ A;  4DV8 A;  1O0Q A;  3KMC A;  1Y8J A;  2JXY A;  2OXU A;  3C7X A;  1PEX A;  1BKC E;  1UEA A;  1KUG A;  1R1H A;  1TVI A;  1OZ9 A;  3WV2 A;  4XBH A;  3N2U A;  3KRY A;  3DWB A;  1JAQ A;  2X3B A;  3HY7 A;  1R55 A;  3HBU P;  3HB2 P;  3V96 B;  5BOT A;  4FVL A;  3BA0 A;  3HYG A;  1QJJ A;  1AST A;  3F15 A;  4GF1 A;  1KUI A;  2E3X A;  2FV9 A;  5CUH A;  2MQS A;  1K7G A;  2J0T A;  2FV5 A;  1I1I P;  3LEA A;  1R54 A;  2O3E A;  1GO8 P;  1HY7 A;  4PKT A;  1JKY A;  1IAD A;  1C7K A;  3LJT A;  1CK7 A;  4HX3 A;  1OM7 A;  1ITV A;  1K7Q A;  1GE5 A;  5L7F A;  3DPF A;  3F16 A;  1SAT A;  1KUH A;  1OO9 A;  2HU6 A;  3AYK A;  4GWM A;  1EB6 A;  2MZE A;  1ZVX A;  1G9K A;  2D1O A;  1USN A;  4A3W A;  1FBL A;  2CKI A;  1YP1 A;  2WO8 A;  4H1Q A;  1KUK A;  2OXW A;  4JP4 A;  4J4M A;  3F17 A;  1BQO A;  1OMJ A;  4YEH A;  3LIL A;  1BSW A;  3Q2H A;  3V6N A;  2ERP A;  3LIK A;  3LUM A;  2Y6C A;  1DTH A;  4R3V A;  2OI0 A;  5I3M A;  1IAB A;  1ZXC A;  4HSD A;  1G05 A;  4PKR A;  3LQB A;  1EAK A;  1ZXV A;  1UMS A;  2DW1 A;  1G12 A;  4H2E A;  3L0V A;  1JIZ A;  2X3A A;  3LE9 A;  1C8T A;  3KEC A;  1D8F A;  3WV1 A;  3AYU A;  1UMT A;  3OHL A;  1BIW A;  1YOU A;  1GE6 A;  2TCL A;  1XM5 A;  1GO7 P;  1ZTQ A;  2MZH A;  3LMC A;  1ZS0 A;  3VTG A;  3G5C A;  3I7G A;  2AIG P;  2X3C A;  4GR3 A;  4XCT A;  4A7B A;  3TS4 A;  1EUB A;  1CGL A;  2OY2 A;  1KAP P;  4XM8 A;  1CGF A;  1BUD A;  1CGE A;  4DD8 A;  5I2Z A;  4FXQ A;  4GQL A;  2V4B A;  4IN9 A;  4XM6 A;  2L0R A;  2ERQ A;  3KME A;  3DNG A;  4IUW A;  1QJS A;  1PWU A;  1XFV A;  5D1T A;  2OXZ A;  3DPE A;  1OS2 A;  1HXN A;  4AXQ A;  4ON1 A;  3EWJ A;  2QPJ A;  3ZVS A;  1PWP A;  3HDB A;  1OM8 A;  1AF0 A;  2OW0 A;  3K7N A;  1IAG A;  1JJ9 A;  1K7I A;  1MMQ A;  2J83 A;  1Q3A A;  2W13 A;  3OHO A;  5I43 A;  3EDG A;  4WK7 A;  2XS4 A;  1SMP A;  1BUV M;  2OW2 A;  1BZS A;  1ND1 A;  5D7W A;  1R1J A;  4ZR5 A;  2OY4 A;  3UVC A;  3S18 A;  3B92 A;  4H76 A;  1RM8 A;  4GWN A;  2W15 A;  4EFS A;  4HMA A;  1SRP A;  2YIG A;  2USN A;  1CIZ A;  3KEK A;  3RTS A;  4GUY A;  1HV5 A;  3VI1 A;  1B3D A;  3KEJ A;  1JIW P;  1XFU A;  1QIC A;  1UTZ A;  4WKI A;  2RJQ A;  2PJT A;  1CQR A;  1GXD A;  1XFY A;  3LJZ A;  1XAX A;  2A8H A;  4G9L A;  4H49 A;  1CAQ A;  1RMZ A;  1AYK A;  1XFZ A;  1R1I A;  2OVX A;  3F1A A;  4JA1 A; 
#chains in the Genus database with same CATH homology
 1SLN A;  1PWV A;  3ZUK A;  3DL1 A;  3USN A;  1MNC A;  2D1N A;  1FM1 A;  1G49 A;  5B5O A;  3DTK A;  1XUC A;  2JT6 A;  4XM7 A;  3TSK A;  1YQY A;  1MMP A;  3RTT A;  3F19 A;  4JIJ A;  4DF9 A;  1MMB A;  3EDH A;  4H82 A;  2O36 A;  3U1R A;  3O2X A;  4GR8 A;  4CTH A;  4WF6 A;  1QIA A;  4FXY P;  4I35 A;  4Q1L A;  1B8Y A;  5L79 A;  5I0L A;  1GKC A;  4GR0 A;  4H84 A;  3K7L A;  2POJ A;  1L6J A;  1ZP5 A;  3EDI A;  4I03 A;  1G4K A;  3LK8 A;  3L0T A;  1A86 A;  2YB9 A;  1BKC A;  3P1V A;  1QIB A;  5JMY A;  1OS9 A;  2X7M A;  2SRT A;  1XFX A;  4L19 A;  1S4B P;  5H8X A;  3LP9 A;  1RTG A;  3I7I A;  1KBC A;  3CKI A;  1WNI A;  2RJP A;  4L6T A;  4OEI A;  1O0T A;  1DMT A;  5CZM A;  2W14 A;  2W0D A;  2K2G A;  1QJI A;  3TVC A;  1HFS A;  1IAA A;  830C A;  5I12 A;  3AIG A;  1JH1 A;  2K9C A;  3E8R A;  5BOY A;  4JPA A;  3DTE A;  1KUF A;  2OW9 A;  3KWV C;  3LQ0 A;  5LAB A;  1XFW A;  1HOV A;  4DPE A;  1OM6 A;  3B2Z A;  4PKW A;  4AUO A;  4H30 A;  1QHU A;  2MZI A;  3B8Z A;  3LKA A;  5B5P A;  1Z3J A;  2AYK A;  4PKS A;  1GEN A;  2OW1 A;  1GKD A;  4G0D A;  2DW2 A;  3HBV P;  2JNP A;  2DDY A;  2E2D A;  1JK3 A;  1SU3 A;  5I4O A;  5D1S A;  4ILW D;  2OZR A;  1ATL A;  3O64 A;  1XUD A;  1IAC A;  2I47 A;  1D7X A;  4AIG A;  3Q2G A;  4PKV A;  1D5J A;  5D3C A;  4FU4 A;  1YCM A;  3F18 A;  2MLS A;  4WZV A;  966C A;  3LJG A;  1SLM A;  3ZXH A;  1D8M A;  3EHY A;  1I76 A;  456C A;  2JT5 A;  3LGP A;  1IAE A;  3ELM A;  4AYK A;  2W12 A;  3TT4 A;  2Z2D A;  3EDZ A;  3KHI A;  1UTT A;  4IJO A;  1BM6 A;  4WKE A;  2JSD A;  1QUA A;  1JAP A;  3P24 A;  2Y6D A;  4PKU A;  2CLT A;  5CXA A;  1HFC A;  4PKQ A;  1H71 P;  1JAO A;  3EHX A;  1FLS A;  1Y93 A;  4H3X A;  3GBO A;  1JAN A;  1PWQ A;  2MLR A;  1HTD A;  1I73 A;  1J7N A;  4JQG A;  4L7A A;  3SHI A;  2XS3 A;  3NX7 A;  1CXV A;  3N2V A;  4QKZ A;  2N8R A;  1PWW A;  3DTI A;  1MMR A;  4RT6 B;  3OYO A;  2WO9 A;  4LL2 A;  1XUR A;  2KRJ A;  1Y0V A;  2YUF A;  2DW0 A;  1BQQ M;  5D2B A;  1BKC I;  2DDF A;  4L63 A;  3HDA P;  3WV3 A;  1A85 A;  1ROS A;  3MA2 A;  2ERO A;  5BPA A;  1GE7 A;  2WOA A;  1AKL A;  3G42 A;  2JIH A;  3DSL A;  3HY9 A;  3LIR A;  5D1U A;  1C3I A;  3LUN A;  2OVZ A;  4DV8 A;  1O0Q A;  3KMC A;  1Y8J A;  2JXY A;  2OXU A;  3C7X A;  1PEX A;  1BKC E;  1UEA A;  1KUG A;  1R1H A;  3WV2 A;  4XBH A;  3N2U A;  3KRY A;  3DWB A;  1JAQ A;  2X3B A;  3HY7 A;  1R55 A;  3HBU P;  3HB2 P;  3V96 B;  5BOT A;  4FVL A;  3BA0 A;  3HYG A;  1QJJ A;  1AST A;  3F15 A;  4GF1 A;  1KUI A;  2E3X A;  2FV9 A;  5CUH A;  2MQS A;  1K7G A;  2J0T A;  2FV5 A;  1I1I P;  3LEA A;  1R54 A;  2O3E A;  1GO8 P;  1HY7 A;  4PKT A;  1JKY A;  1IAD A;  1C7K A;  3LJT A;  1CK7 A;  4HX3 A;  1OM7 A;  1ITV A;  1K7Q A;  1GE5 A;  5L7F A;  3DPF A;  3F16 A;  1SAT A;  1KUH A;  1OO9 A;  2HU6 A;  3AYK A;  4GWM A;  1EB6 A;  2MZE A;  1ZVX A;  1G9K A;  2D1O A;  1USN A;  4A3W A;  1FBL A;  2CKI A;  1YP1 A;  2WO8 A;  4H1Q A;  1KUK A;  2OXW A;  4JP4 A;  4J4M A;  3F17 A;  1BQO A;  1OMJ A;  4YEH A;  3LIL A;  1BSW A;  3Q2H A;  3V6N A;  2ERP A;  3LIK A;  3LUM A;  2Y6C A;  1DTH A;  4R3V A;  2OI0 A;  5I3M A;  1IAB A;  1ZXC A;  4HSD A;  1G05 A;  4PKR A;  3LQB A;  1EAK A;  1ZXV A;  1UMS A;  2DW1 A;  1G12 A;  4H2E A;  3L0V A;  1JIZ A;  2X3A A;  3LE9 A;  1C8T A;  3KEC A;  1D8F A;  3WV1 A;  3AYU A;  1UMT A;  3OHL A;  1BIW A;  1YOU A;  1GE6 A;  2TCL A;  1GO7 P;  1ZTQ A;  2MZH A;  3LMC A;  1ZS0 A;  3VTG A;  3G5C A;  3I7G A;  2AIG P;  2X3C A;  4GR3 A;  4XCT A;  4A7B A;  3TS4 A;  1EUB A;  1CGL A;  2OY2 A;  1KAP P;  4XM8 A;  1CGF A;  1BUD A;  1CGE A;  4DD8 A;  5I2Z A;  4FXQ A;  4GQL A;  2V4B A;  4IN9 A;  4XM6 A;  2L0R A;  2ERQ A;  3KME A;  3DNG A;  4IUW A;  1QJS A;  1PWU A;  1XFV A;  5D1T A;  2OXZ A;  3DPE A;  1OS2 A;  1HXN A;  4AXQ A;  4ON1 A;  3EWJ A;  2QPJ A;  3ZVS A;  1PWP A;  3HDB A;  1OM8 A;  1AF0 A;  2OW0 A;  3K7N A;  1IAG A;  1JJ9 A;  1K7I A;  1MMQ A;  2J83 A;  1Q3A A;  2W13 A;  3OHO A;  5I43 A;  3EDG A;  4WK7 A;  2XS4 A;  1SMP A;  1BUV M;  2OW2 A;  1BZS A;  1ND1 A;  5D7W A;  1R1J A;  4ZR5 A;  2OY4 A;  3UVC A;  3S18 A;  3B92 A;  4H76 A;  1RM8 A;  4GWN A;  2W15 A;  4EFS A;  4HMA A;  1SRP A;  2YIG A;  2USN A;  1CIZ A;  3KEK A;  3RTS A;  4GUY A;  1HV5 A;  3VI1 A;  1B3D A;  3KEJ A;  1JIW P;  1XFU A;  1QIC A;  1UTZ A;  4WKI A;  2RJQ A;  2PJT A;  1CQR A;  1GXD A;  1XFY A;  3LJZ A;  2A8H A;  4G9L A;  4H49 A;  1CAQ A;  1RMZ A;  1AYK A;  1XFZ A;  1R1I A;  2OVX A;  3F1A A;  4JA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...