The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
119
|
structure length |
119
|
Chain Sequence |
GHMKFTDQQIGVLAGLAISPEWLKQNIAANQLVYGIVKPSDTVPAGVDDYSYLVAADDQDGTIIFFKAEGQTVIIKYTSQRNTKLKAKALTLSQLKKEFYQTRSQKREVDDYVAGLRTE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Structural genomics, unknown function
|
| molecule keywords |
Uncharacterized protein
|
| publication title |
NMR structure of the hypotheical protein Lreu_0056 from Lactobacillus reuteri
rcsb |
| source organism |
Lactobacillus reuteri dsm 20016
|
| total genus |
27
|
| structure length |
119
|
| sequence length |
119
|
| ec nomenclature | |
| pdb deposition date | 2014-06-18 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Yope Regulator; Chain: A, | Yope Regulator; Chain: A, |
#chains in the Genus database with same CATH superfamily 2MQD A; #chains in the Genus database with same CATH topology 1K6Z A; 1K3S A; 1N5B A; 4G6T A; 4JMF B; 3TU3 A; 1TYQ D; 1K3E A; 4XEI F; 3EPU A; 2P9P F; 3DXK F; 2KC5 A; 2P9L F; 4JD2 D; 3ULE F; 2BSJ A; 1XKP C; 1JYA A; 4GF3 A; 3DWL D; 4GSL C; 2OD0 A; 4H5B A; 1JYO A; 2P9I D; 3UKR F; 2P9N D; 2BHO A; 2P9N F; 4AKX A; 1TTW A; 1U2V D; 1TYQ F; 2P9U D; 3RSE D; 2P9K D; 1L2W A; 2P9S D; 3KXY A; 1K8K D; 4JD2 F; 3UKU D; 1XKP B; 3DXM D; 2LPU A; 2P9I F; 2DYT A; 3DWL F; 3CXJ A; 1U2V F; 2BSH A; 2P9U F; 2BSI A; 3RSE F; 3VX8 B; 1RY9 A; 2P9K F; 2MQD A; 1S28 A; 2P9S F; 1K8K F; 3UKU F; 3DXK D; 4XEI D; 2P9L D; 3DXM F; 2P9P D; 2XGA A; 3VX7 B; 2PLG A; 3ULE D; 4EBR A; 2FM8 A; 3UKR D; #chains in the Genus database with same CATH homology 1K6Z A; 1K3S A; 1N5B A; 4G6T A; 4JMF B; 3TU3 A; 1TYQ D; 1K3E A; 4XEI F; 3EPU A; 2P9P F; 3DXK F; 2KC5 A; 2P9L F; 4JD2 D; 3ULE F; 2BSJ A; 1XKP C; 1JYA A; 4GF3 A; 3DWL D; 4GSL C; 4H5B A; 3UKR F; 1JYO A; 2P9I D; 4AKX A; 2P9N D; 2BHO A; 2P9N F; 1TTW A; 1U2V D; 1TYQ F; 2P9U D; 3RSE D; 2P9K D; 1L2W A; 2P9S D; 3KXY A; 1K8K D; 4JD2 F; 3UKU D; 1XKP B; 3DXM D; 2LPU A; 2P9I F; 2DYT A; 3DWL F; 3CXJ A; 1U2V F; 2BSH A; 2P9U F; 2BSI A; 3RSE F; 3VX8 B; 1RY9 A; 2P9K F; 2MQD A; 1S28 A; 2P9S F; 1K8K F; 3UKU F; 3DXK D; 4XEI D; 2P9L D; 3DXM F; 2P9P D; 2XGA A; 3VX7 B; 2PLG A; 3ULE D; 4EBR A; 2FM8 A; 3UKR D;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
