1K3EA

Type iii secretion chaperone cest
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
141
Chain Sequence
MSSRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLKIEEISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords CesT
publication title Structural and biochemical characterization of the type III secretion chaperones CesT and SigE.
pubmed doi rcsb
source organism Escherichia coli o157:h7
total genus 35
structure length 141
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05932 CesT Tir chaperone protein (CesT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.390 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k3eA01
3.30.1460.10 Alpha Beta 2-Layer Sandwich Yope Regulator; Chain: A, Yope Regulator; Chain: A, 1k3eA02
2FM8A 1JYAA 4GF3A 4AKXA 1RY9A 2BSIA 3KXYA 2BSHA 2XGAA 1JYOA 1K3SA 3EPUA 1S28A 1XKPC 1K6ZA 3CXJA 1TTWA 4JMFB 1N5BA 1K3EA 2BHOA 3TU3A 2PLGA 4G6TA 2BSJA 1XKPB 1L2WA
chains in the Genus database with same CATH superfamily
3EFFK 1S72V 3SJQC 2E5LO 5JVDA 1GH6A 1YVWA 2H8PC 1R1BA 3OEHG 1SQBH 5D5QA 3E8HA 3ZN0A 5JCOA 3JARB 4O4IA 3ZJZA 3OT7A 4JAUA 3UO3A 4MVUA 1N34B 5JVDB 4B3SB 2LW1A 2P9NF 2Y0PA 4QE7A 4X88A 2WLNA 2V4DA 3SYQA 3WG7B 1M4UA 3BHPA 3SJBC 4NVPA 5IYCO 1GN3A 4U3FH 4DYLA 2ZE7A 2WLIB 4IL6Z 4Q20A 2IJKA 4MTFA 1Y66A 5L3GA 5KUMA 2E76B 3SPCA 4DV3O 3MD0A 4DV6B 4RO2A 1VQ8V 1QU7A 4O2BA 4LF8O 1JYAA 3CS5A 5EYPA 1RY9A 2DQ0A 2ILMA 2UXDO 1FKAO 5GTHZ 1XMQB 3K9SA 2EIKC 3AG3C 1JX9A 5L3EA 1W2BU 3CJHA 1YCIA 1NH2B 5B3SB 1BL8A 2FMLA 1SZTA 4O2BB 5DEDA 1SA0B 2CGOA 5EYPB 4N23A 3CCQV 5L3DA 4B3MB 3ZHSA 4MTOA 3B77A 4LCUC 4AKXA 4JI1B 1K5SA 2G38A 1IVSA 3DXKF 5KA5A 4LFAO 2CTPA 2CUGA 3A2FA 3TCUA 5HFLA 3SR2C 3MHHC 2ZM6O 1N0NA 2D2CB 5H6QA 5IYZB 4YIOA 3AEIA 3CCUV 3JAWA 3RYIA 5KA6A 1SETA 4GX1A 1XNQB 1ZLZA 4FLUA 4J9YB 4B3RB 4LF6O 4GX0A 2P9ND 3CMAV 5GW7A 1JFFA 4GKKB 3HKDA 4LFBB 3DXRA 1SQGA 2HJFC 2F23A 3CCLV 1P84F 4B08A 3RYIB 1K8KF 4UCVA 4QGPA 1OCRC 2DMXA 1XNRB 4LF5B 2BTOA 4GZRB 2ZE6A 3H1IH 3CYOA 1GAXA 2PYLA 5FNVA 4JI8B 1Z2GA 4MVQA 1JFFB 4TT3G 3HKDB 5LHHA 2DWEC 3SYAA 1FXKA 1F7YA 3L70H 1NTMH 4X1YA 5B1OA 1W59A 4C7UA 2AHZA 2JIZG 4YHHO 4I9WA 3UM7A 4X62O 1VQOV 3C90A 2EJRA 5BXZA 4AI8A 4JI4O 4WFHA 3ZMSA 1FXKB 4F6RA 4FM1A 2JRIA 1XREA 2BOBC 1HNXB 4JD2F 3OEEG 4RAIA 3LNMB 3JSNA 4FFKA 1HDJA 3DXKD 4XDKA 5K1PA 4NXMO 3O9OA 4JI2O 4I4TA 3RN4A 3K06A 2R9AA 1PL4A 5CBFA 4LWSA 1M1KW 4F6RB 2EIKB 4DUYO 1M57C 2HR3A 4U3JA 2M7WA 1CP9A 2AHYA 4GKJB 2Q69A 1AB3A 3FB6C 4UCRA 4JGSA 2YIBA 2UXBB 1LNQA 4I0XA 4I4TB 4R50A 1YITV 3J7AU 3RYHA 1AR5A 2EULA 3T1HB 4U3JB 2Z5UA 1SRYA 4J9ZB 2ZXWB 5IYDO 1S0VA 5KHKA 3I55V 1K8KD 5LHIA 1B04A 1K92A 2K1EA 3OR7C 5B1AB 5IJ0A 1AI7A 3NR7A 4FFBA 1Y74A 2Q7GA 3SPGA 4I50B 2DYSC 2YS8A 5LXTA 1D5AA 2W6IG 1O9GA 1WJZA 3HKCA 1FPOA 4ZIBA 3K3WA 2X6BA 3W7UA 4JASA 5B1BB 3ZEDA 1OCRB 5KX5A 4FFBB 2VQEB 1I0HA 4GF3A 5CBHA 3IFXA 2A3QA 4A5UB 4LF7B 3CHXA 3OMNB 2P9KD 3HKCB 3E8BA 4J11A 2D3OW 1VEWA 3CX5F 2P9SD 2QA4V 1Q6HA 4AHCA 2JS5A 5KLVH 1NI8A 1F51A 2QSAA 2K9PA 1FYJA 2RJZA 4JYAB 1IBMO 4FK5C 1KYOF 5EIBD 2OCHA 4X65B 4L87A 4DR4B 5JJJB 1P4RA 2XGAA 4DV1B 3CPWU 1K8AW 4BAYA 2Y69C 1N5BA 5EC2C 1K34A 1YXBA 1NQTA 2DJVA 3OMIB 5CA1B 1M57B 1EM1A 3RW0A 1XL6A 2ARHA 3OM3B 3CCEV 4BIUA 3QNEA 3GWKC 3JYCA 4UV8A 4WCEV 3K04A 2PF4E 2Z3YA 3LDEA 3VOUA 4CS2A 2GBOA 4CBCA 3TK1A 2JGDA 3CSXA 2P90A 5LP6C 2ZCEA 4UXNA 3HB3B 2A0LA 3FX7A 3KCYA 3IJ4A 1NKDA 2BTQA 1P49A 3ASNC 4D7SA 5H6RA 3AG4B 4LF9O 5J2TA 2MK3A 4DV4O 1HNWO 2P4VA 3K9AA 5LBQA 2UUAB 3BRCA 2QGNA 4H0LB 4K35A 5IJ9A 2DYSB 2P9LF 2JDIG 2HP8A 4HZ3A 3UT5A 3ZX6A 1A32A 1TYQD 3BABA 1E79G 4MW8A 5J2TB 1EN5A 4LR3A 3NXSA 1M93A 3ABKC 4JYBA 5HFMA 4DR7O 3UQ8A 1YF2A 5CA0A 2GUZA 1CPYA 3H1JH 4EB6A 1I94B 4ZI7B 2WLLA 1OCCC 3UT5B 1MSWD 4UB6Z 3F7VC 2GHYA 4LBEC 1O9HA 2JEUA 4GYCB 3CCJV 5CA0B 2GUZB 3WFVA 1AILA 1OCOB 2F4VO 4CS4A 2UUBO 2KG7A 2WLLB 2YEVA 4XDJA 1JOYA 1WB7A 3ZHTA 2N74A 3IAYA 2B1IA 4UV9A 2VQFB 4MVOA 1TTWA 3OTOB 5FPRA 2B5UA 5DN6G 3VQWA 2Y69B 1VQ4V 1ZWIC 2LJ2A 4DR2B 1K7DA 1L2WA 4WFFA 4GT1A 1XDCA 3LSQA 2P9ID 2Q67A 1U96A 4PDRA 4B7EA 2O57A 4UVCA 2EIJB 2EZOA 3EPUA 3RFRA 1GN6A 1IBKO 5L3FA 3OFNG 2H94A 3N2GA 3K5OA 4OGQB 3FAVA 3TXQA 4GUNA 2QM8A 4BWAA 5FL7G 1PL0A 3QG5A 3BPZA 2YI9A 4CC5A 3AG1C 2QM4A 3X2QB 2R70A 3W7SA 4E4EA 2IJIA 3JAKA 1URFA 3JAMN 3E83A 2X6CA 2WLJA 2X6AA 4JTCB 5CB4A 4O2AA 3OTFA 3CD6V 3JAKB 4R7CA 1Q8IA 3T1YB 4LP8A 4GCZA 2A79B 3J80N 4PA3A 1R3JC 2A7WA 1OCCB 1TUEB 3JSLA 2B1GA 3H1KH 4JTAB 1DGSA 2WAMA 1S28A 1R3LC 1DF4A 1MABG 1CXZB 4X64O 4WFEA 2PI5A 1Q7YW 2BHOA 4FMTA 3K79A 1FJGB 3QO8A 2M6YA 3S3XA 1RM1C 4HBNA 1JPXA 1VF6A 4UCSA 2P22C 3G6EV 1H2MA 1K9MW 4DR6O 2ZM6B 2LQTA 2V7QG 3I5DA 3ULED 4MS2A 1H38A 5GTIZ 2P4KA 1F4MA 1S5LZ 5J2UA 1HP8A 1JQ0A 2XAQA 4LF6B 1D5NA 2LPUA 3SYOA 1N0JA 2ZE8A 4DR3O 4K3AA 1H2SB 2Z0AA 4J80A 2DYRC 3U0ZA 5DECA 1ZX3A 3CCRV 2OTLV 1GRJA 3AG1B 4WFBV 3LUTB 1AJPA 4LNUA 2QE7G 3L75H 1K3EA 3HPLC 4MVZA 1NR7A 4HYOA 4LFCB 2WA3A 3G6BA 3K08A 2RDCA 4H44B 2OCCB 1Z5VA 4JYCA 4JI3O 3WU2Z 3DTUB 3OE7G 2EBOA 4X89A 4LNUB 2CAZC 4X62B 1M5IA 2ITDC 2E3CA 2QWRB 4TOIA 2HEPA 5BR8O 3VQYA 3B2EE 4JI4B 3UCSC 1XQ8A 2WLIA 4PA6A 3ASOC 3B09A 1KECA 3J81N 4J7JA 1KKCA 4JI2B 3OGCC 2P9UF 5BMVB 2JGUA 1Q90D 3D3IA 4QJFB 3QTCA 1HNZO 4O4HA 1NBMG 4JMFB 1SZXA 2IBZH 1XKPB 1V54C 4J7KA 4JZGA 2F1MA 1SA0A 1S77D 4YIPA 2IH1C 3D36C 2LO1A 1YTFB 2WPDG 3KKYA 4O4HB 3FD9A 3RSED 4X66O 2DQ3A 1J5EO 3AK1A 2ZKOA 4ZOLA 1NH2D 5ITZA 4H13B 3DWLD 3BEHA 2QDOA 1N36O 4DUZB 4PD4F 4LH7A 3T4ZA 5KMGA 1V55C 4X1IA 5IYZA 4LC1A 3ICXA 4FVMA 4XDLA 2XASA 4FLYA 4ZOLB 1MOFA 3ZHUA 5H9CA 4P9PA 1QQCA 2DYRB 1JMKC 2EZPA 5ITZB 4GX5A 1NS1A 2IM9A 2CH7A 4P9OA 2HG5C 3CRRA 5KMGB 1WP8A 4X1IB 1M9NA 5BZBA 3L72H 1HR0B 4TV9A 3VBBA 1BE3H 1SQPH 4OX9O 4PELA 1IBLO 1BSMA 2WA4A 1FXVA 1L0LH 3DC5A 4X9QA 4CH3A 4G2KA 1VQ5V 5IWAO 2CH7B 5LMNO 2P9UD 3W7TA 2JJ2G 3ETEA 4TV9B 1ORQC 4TV8B 4D6TH 5C8YB 2B9ZA 1PM9A 1VP7A 2ZE5A 4B7KA 3ZHQA 1IBMB 2BSJA 5L3BA 3DSQA 1R3KC 3LNNA 3C3SA 5LGNA 1FXHA 2JVDA 2ZR3A 1H2NA 4IIJA 3P30A 4JAVA 1K3SA 1SKVA 5AG2A 1XUQA 1MMMA 4Z1MG 2ZNJA 4PDLA 2UXXA 4MW3A 1MZEA 4P30A 1ENVA 1EN4A 3P3NA 4DV0O 2CDYA 4JI5B 1I5YA 1VQKV 4LF4O 4IIJB 1VARA 2P9KF 1V54B 1XILA 2XAHA 2P9SF 3E8FA 2HVJC 3E86A 4UCOA 2QWOB 2Y0IA 2W0XA 1KMIZ 3RT3C 1L8DA 1OJHA 2H3OA 1N8RW 5BY1A 3ABTA 2GTSA 3AG3B 2ZR2A 3QF7A 1HWYA 4NXNO 2QWNB 2UU9O 4LF9B 4QE9A 1HNWB 4DV4B 4B3SO 1YZBA 2PUSA 1XMOO 5KAIZ 3C3TA 1V55B 4FLZA 2HVKC 3OR6C 3ABUA 2W0FC 5D5PA 3DXMF 1PP9H 4F4LA 2Q73A 4I50A 4JI0B 1H2KA 1PNMA 3WB0A 3ZMTA 4YY3B 4DR7B 3OUSA 3Q4HA 2YIBD 1KQSU 2UUCO 3ML0A 3OGIB 3ABLC 1JJ2U 1FD9A 2A06H 2RCVA 3F5TA 2NNUA 2BSHA 3A0BZ 4DRXA 2LFRA 4JTDB 2LFSA 5LGUA 4DR1O 3RBZA 1MG1A 1SQFA 3Q4HB 3AG7A 2XUMA 2F4VB 1I08A 2UUBB 2QTOA 2E74B 5IT9N 1P7GA 4G27B 5DM6V 4DRXB 1E1RG 2OD0A 1QVFU 1F4NA 1KP3A 1QNMA 1KD1W 2YIDA 3O65A 1OV9A 1FS0G 3STZC 5KHJA 1DF5A 2JK5C 1X4TA 1Y67A 2ADPA 2JJ1G 4K8XA 1TYQF 1S3JA 2WWWA 1WPXA 2JEXA 2GSMB 4KL1A 3CC2V 3ETDA 3A0RA 1N33B 1ZUQA 1BGYH 2LP7A 1AR1B 4NKGB 1G6UA 4B3RO 4H5BA 3IC7A 5CA1A 1JYOA 4W4LA 3VQXA 2R9IA 4LFBO 3N2KA 5LMUB 1BZKA 1Y6XA 3SGIA 4NR1A 3DXMD 1WA8A 1WNSA 4JI6O 4RWUA 3EXAA 5IY5C 4K0KB 2FB5A 2EINC 1KC8W 3N2KB 3B8MA 3E8GA 1SQQH 4BIZA 1M90W 2QM7A 5H5NA 1VQMV 1WA8B 2YXYA 3F7YC 4FLTA 1R6NA 1N32B 1I7FA 2L35A 4TWKA 2P9IF 2ZQMA 1US6A 2PYJA 3THOA 4AILC 2ETNA 4BR6A 4UVBA 1I5XA 1VF5B 4NB5A 4U7NA 1HNXO 5LA6B 1G8MA 4K8ZA 3ABLB 5LL6Y 1H8HG 4FLWA 1ZL8A 2UXCO 3GVMA 4ZI7A 1K73W 3JD0A 4JYYA 4O4LB 4W4KA 2YUAA 3SPHA 1B6QA 2DOSA 4WBNB 2VWKA 2UXBO 3FFQA 2HKOA 1ZL8B 3IGAC 3TGUH 2E75B 4X64B 2VWJA 1AJNA 3B8NA 5LGTA 1TAEA 2WLHA 1LUVA 5F2VO 3CWBH 3KG2A 1XEQA 3SYCA 3G67A 4DR6B 3AG2C 4GX2A 3S3WA 2GV9A 5FLXN 1WPBA 2DWDC 3APQA 1Y76B 2PZSA 2RMKB 3MDSA 4BIOA 2OWOA 5LOVA 4JI7O 3UKMA 5JQGA 1B06A 3QO5A 3G80A 1VIBA 1SS3A 5KHHA 3A0HZ 1W0KG 4TQDA 3P32A 1WAZA 5LOVB 3JD3A 1VMGA 3A8TA 5JQGB 4TSFG 2LW7A 5LP6A 1OHHG 1AP6A 5IY5B 3CMEV 2XAGA 1QVGU 3DC6A 1VQ6V 3CC7V 2E5LB 4JI3B 2YXLA 4O4JA 5LP6B 1Q6UA 3TETA 4JYAO 1IX9A 3FYIB 3ULEF 4DO2A 4DR4O 1E1QG 3CXCU 3JATB 1XHXA 3ASNB 1OCZC 2LGQA 1S76D 2GDSA 2IH3C 2AZ2A 1XHZA 2F66C 4X20B 2ZIOA 4O4JB 3ABMC 4P2ZA 4DXWA 1UJWB 3K5NA 4NTYA 4PJ0Z 1QLNA 3VX7B 2C2AA 3AK2A 4EFEA 1VQNV 2CGNA 2BSIA 2P06A 2QTSA 3FB8C 5E1AC 3P3PA 1HNZB 4HNAA 1PPJH 3CRAA 4ZBMA 2XNDG 3ABKB 2Q8VA 4DV3B 1IDSA 4JZ2A 3FB5C 4CH4A 3RWRD 2PLGA 3JD1A 1G1XB 4LF8B 4AQYO 4QIWF 4UVAA 1NVPB 3FB7C 1RSOB 3HKEA 2UXDB 4D7TA 4HNAB 1QR8A 1RFYA 4WFAV 4DV5O 1KKDA 2ZIMA 4N21A 1J5EB 3T1CA 3AG2B 3CCSV 3CRCA 4DW1A 3JALA 2P5OA 1N4CA 4FM2A 1N36B 4FLVA 2YICA 3HKEB 1IXMA 2RN9A 1FFXB 4JAAA 5JCOC 2EX3A 2HHHO 4GLXA 2UXNA 3F5WC 3K0GA 2CTRA 3T2MA 4LFAB 3KXYA 2ATKC 1QCEA 3JALB 1D2DA 2NN4A 1QBZA 3RGBA 4H37A 5H2FZ 3ETQA 2OT5A 2P7TC 4FPPA 4L8JA 2Q7HA 1I94O 1GK9A 4OX9B 4Z2WA 1IBLB 3ZRWA 1GO3F 3MHSC 5TISZ 3ZHVA 3MAQA 2KSDA 1TGOA 1MA1A 3EHBB 4FZ1A 5IWAB 3FYEB 3L73H 3RSEF 5LMNB 1RPOA 3OUFA 1CEZA 1JJOA 3W7XA 4LH6A 2Q7EA 3ZRWB 1XOUA 2AW9A 3DWLF 3D8CA 2F95B 1R3IC 4ZHQB 1S5HC 2DE0X 3SPIA 1OCZB 1HW7A 3WB2A 3QVNA 2XOKG 3AK3A 1KU9A 2OYQA 3BA9A 3ABMB 1NJIW 1BCCH 3BVOA 2FTKA 4YJ3A 2BE3A 3GB7C 4IHJB 1H8EG 4YHHB 2QJ1A 3PN1A 5EK0A 5BMVA 2QEXV 1K97A 4LF4B 4J42A 3ZCCA 4IYHA 2P9PD 2Q0OC 4YJ3B 3M8AA 1DLBA 2NR5A 2DYTA 3M99B 2PTMA 4NXMB 1RPRA 1AI5A 3JASB 2OTJV 1GKFA 1Z5WA 4DUYB 3DGEA 2P67A 5JH7A 4NXNB 3SPJA 1K4DC 3ETGA 5B1NA 4KHPO 4KXRA 1JVMA 2UU9B 4PDMA 2BOCC 2IU3A 1YJ9V 1XMOB 1KBHA 2YC0A 4EFBA 4GSLC 1OZ0A 3D3QA 4TUYA 1GN2A 1RM1B 4O4IB 1W0JG 5JH7B 4CH6A 3U10A 1YTFD 1SERA 1H2LA 4CS3A 1FXKC 3T1YO 2UUCB 2GTAA 4MT8A 4ZKIA 1K33A 5IE9A 4DV7O 4TUYB 2EJ7A 4Z1VA 4CC6A 3G71V 5A9GA 3K59A 2DN9A 4DR1B 1FAFA 1YEWA 2NLJC 1RP3B 4U7OA 1PV0A 2OIEA 3CXJA 1PD3A 5CN0A 4CH5A 4DW0A 4PHZA 4JV5O 3TXSA 2Y48A 1Q6IA 2R9RB 2XHBA 1AI4A 2ADQB 3ZS8C 1KUQA 2ZT9B 2FYUH 4TV8A 5C8YA 4I5SA 1FJGO 3IC9A 4QPJA 2Q9LA 3CJHB 4PV1B 3OW2U 2ZXWC 4PA7A 4DK1A 2DW4A 4PA9A 4I7ZB 2AGAA 1AR4A 4B3TO 4YJ2A 1UFIA 1YIJV 4MVMA 5B1AC 1DK1A 2VS0A 4DK0A 4YXWG 2XAFA 1X59A 2XAJA 2MQDA 1JA8A 4DV2O 2ODMA 3ASOB 1L0NH 1NZ6A 4F6EA 1GM8A 2IJJA 4YJ2B 3ZMZA 4DR5O 3K03A 5CMUA 5B1BC 3JAWB 4J10A 3U11A 3E22A 5A2QN 4JI6B 1PNKA 3D36A 1GM7A 2QWQB 3ZHRA 3ZRXA 3KZIZ 4OPHA 3ZN1A 3CB2A 4LFCO 3DXRB 3CEIA 3K5MA 2AXTZ 4XEIF 2WLMA 3SJCC 1SC5B 3E22B 4J7ZA 1WN7A 1K4CC 3JCUZ 1GM9A 3T4DA 5FNVB 5EIBC 2IW5A 2WSSG 2L6LA 3H1HH 1EZJA 4X1YB 1EFRG 1N34O 2FL4A 2RQ6A 1GMGA 2Q4PA 1QLEC 4IGGA 4CZZA 3JD4A 1BS3A 4EKWA 1AVMA 2ZDIC 3CRMA 4UUJC 2YSUB 2CTWA 2UXCB 1U97A 5KUKA 4PA4A 2Y4TA 4E2LA 1Q43A 4X1KA 1TVKA 1KB9F 4BW9A 4J41A 1WLEA 3KCXA 3RVZA 3ZMVA 4R8CA 4DV6O 5GONA 2Q68A 2VRZA 4LWSB 1V9PA 5EZYA 4RQEA 3CRQA 4X1KB 2XT9A 5CBGA 1TVKB 2JS3A 5JJEB 1XMQO 4MTGA 3W7WA 3H1LH 3AG4C 1KP2A 4I0XB 5GONB 2RNBA 2QR4A 3RYHB 4NTXA 5LHGA 5EZYB 4DUZO 4B3MO 4JI7B 3SYPA 4JI1O 4XBFA 3CC4V 4WFGA 1BQZA 2PY5A 4RQFA 2F43G 1ZTEA 1MNGA 2MW2B 4XEID 3L71H 2PI4A 4EEQA 3FKSG 5L3CA 5IJ0B 4I9QA 4PDVA 1FFTB 4OPAA 1QHTA 1Y74B 3K57A 1HR0O 4RUFA 3G4SV 1BHBA 1R6TA 1XNQO 1VQ7V 5LXTB 2A9HA 1P7BA 2HFEC 2QKCA 4MSWC 1AROP 1IBKB 4JD2D 4I55A 2EILC 1ROPA 1S5JA 2HJDA 4GKKO 5CA3A 3CXHF 5KX5B 4EBRA 1OCOC 3LDDA 1NT2B 1XNRO 4LF5O 2BSKA 2ZDIA 3QO7A 4I55B 2BCCH 4JPRA 1MZFA 4JI8O 5B5EZ 3HKBA 3LSUA 1QLEB 1YJNV 1G4YB 1VF7A 5LA6A 4H33A 2BSKB 2W6JG 1WP7A 2Y4UA 3TJTA 2KKWA 1UPGA 3E2EA 2EIJC 1EZVH 4JI5O 1LR1A 1Q5OA 3BFRA 3HKBB 3JD2A 1Q3EA 2Q0AA 1ZSPA 3ZMUA 3VX8B 4O4LA 3RYFA 4QNHB 4WBNA 4AQYB 1B3QA 1JR9A 3M7MX 3LSSA 4NYKA 3RYCA 4FM0A 3B40A 4MVRA 2KB1A 3K0DA 1VQLV 4DV5B 1SESA 1R6KA 3GWOA 1J95A 3RVYA 3UO2A 1AP5A 1NU1H 3X2QC 3RYFB 1DTOA 4GKJO 4ASUG 2JGDB 5FPOA 2ZINA 5EC1C 3RYCB 4IT5A 1IZ3A 4HAMA 2EIMC 2F93B 1Y76A 3T1HO 4PI0A 2QKSA 2V1DA 2HHHB 2BTQB 4UCTA 2X0LA 4JI0O 4TQFA 4YY3O 1AI6A 2ITCC 1U2VF 2KQXA 3L74H 1Q82W 4KP4A 2N04A 3ZRSA 1JCHA 5IDJA 1SQXH 5IJ9B 5JWPA 4FIPC 4FZ0A 3CP1A 5C93A 1AJQA 1YI2V 3CE2A 1VQPV 2EILB 1GN4A 2OIGA 3UKUF 1YHQV 1K5QA 4DR3B 1L1FA 1Q81W 2PGGA 1PKXA 4KFMA 5J9PC 1MSDA 4EB6B 1BHAA 2Q6AA 2VQEO 2AZ0A 1Y4MA 4OXSA 2KC5A 4ICGA 4LF7O 5KAFZ 2CK3G 3ZRVA 4BW5A 1K6ZA 1M56C 2EINB 4MVSA 1YSCA 3JATA 3E89A 2KG7B 4G28B 3ZBHA 3BA8A 2YEVB 1QR9A 2HLDG 4X20A 1N33O 2YIAA 4X65O 5BR8B 4WF9V 1VF6C 4DV1O 3JCZA 3OD4A 3UKRF 5KHGA 2IJHA 2YDEA 3H9VA 4X8AA 3I56V 3VQVA 2FKXA 5LMUO 2P9LD 1GTOA 2CE4A 3STLC 3H01A 2IU0A 1TA8A 4Q6GA 1WB8A 1COWG 1RSOA 4K0KO 2R72A 3N2GB 5IYBO 1R73A 1U2VD 4UB8Z 1YDXA 3FAVB 4KHPB 1NTKH 1YJWV 2OCCC 1Q86W 2EIMB 3OMAB 3ZIAG 1F23A 2FM8A 3R65A 1N32O 3UKUD 2QKAA 1NVPD 1FFXA 2XTAA 3APOA 3N27A 4X66B 1XI1A 4DV7B 2P9PF 2UUAO 2WLKA 5CB4B 4O2AB 3K58A 2P6JA 4R6ZA 4FLXA 1TUBA 4NTWA 3WG7C 1ZAUA 3E35A 1XL4A 3B4SA 3SDLA 5E79Z 5B66Z 5EBLC 1LUWA 4JV5B 1XKPC 2YXHA 3EVKA 1SF9A 1TUBB 5K1XA 1BMFG 4QPKA 5KHIA 1M56B 1T5EA 3LDCA 3UKRD 1BQ0A 3L9DA 4ZHQA 4JF3A 3OAAG 3HR0A 2Q5ZA 5JJNB 4PI2A 4IYIA 5B3SC 1BT8A 3CCMV 3BAAA 3PJSK 4B3TB 1IXBA 1EBOA 5EBWC 2LGWA 2N05A 2X7RB 1NTZH 4ABMA 3K5LA 4FJCC 3CCVV 4UFZA 4IHJA 4G6TA 5LYJA 2VQFO 3BCCH 1XBLA 1H2GA 3OTOO 4DV2B 1IURA 5EBMC 3SJAC 4KUMA 1PNLA 4MTXA 4DR2O 2CTQA 4RUEA 4DR5B 3BY6A 1THZA 1SQVH 1NR1A 5J2UB 5LYJB 2QWPB 2YI8A 4DV0B 1EN6A 1VQ9V 3WB1A 3JASA 2ZNIA 3TU3A 4UCUA 3R66A 2ZD9A 3JARA
chains in the Genus database with same CATH topology
3ZN1A 3EFFK 1S72V 3SJQC 5IY5C 5FL7G 2EINC 1PL0A 1KC8W 2H8PC 3AG1C 4XEIF 2WLMA 3OEHG 3B8MA 3E8GA 4BIZA 1M90W 3X2QB 1K4CC 3E8HA 3ZN0A 3W7SA 1GM9A 2QM7A 3T4DA 2IJIA 2IW5A 2WSSG 3ZJZA 1VQMV 4JAUA 4MVUA 3F7YC 1R6NA 3E83A 4TWKA 2P9NF 2P9IF 2ZQMA 1EZJA 2X6CA 1EFRG 2WLJA 2X6AA 4JTCB 4QE7A 4X88A 2WLNA 1GMGA 1I5XA 1QLEC 4UVBA 3SYQA 3WG7B 4CZZA 4U7NA 3JD4A 1G8MA 4EKWA 5IYCO 3ABLB 2ZDIC 3CD6V 4UUJC 1H8HG 2YSUB 4R7CA 2WLIB 5KUKA 4LP8A 4PA4A 4GCZA 2A79B 4E2LA 4Q20A 2IJKA 4PA3A 4MTFA 1R3JC 1Y66A 5L3GA 5KUMA 1OCCB 3SPCA 1K73W 3MD0A 3JD0A 1WLEA 4RO2A 1VQ8V 3RVZA 1TUEB 3ZMVA 1JYAA 4R8CA 2B1GA 1RY9A 2DQ0A 3SPHA 4JTAB 2Q68A 1B6QA 2WAMA 2HKOA 3IGAC 4RQEA 1AJNA 3B8NA 1S28A 1R3LC 2EIKC 3AG3C 1JX9A 5L3EA 5LGTA 5CBGA 1W2BU 1NH2B 1DF4A 1MABG 2WLHA 5B3SB 1BL8A 4WFEA 2PI5A 1Q7YW 1SZTA 4MTGA 4FMTA 3W7WA 2BHOA 3K79A 3KG2A 4N23A 3AG4C 3QO8A 1KP2A 5L3DA 3SYCA 3CCQV 1RM1C 4MTOA 1JPXA 3B77A 5LHGA 4LCUC 4AKXA 1K5SA 3DXKF 3AG2C 4GX2A 3G6EV 2DWDC 5KA5A 1K9MW 3SYPA 4XBFA 3CC4V 3TCUA 5HFLA 4WFGA 2V7QG 3MHHC 3UKMA 3ULED 4RQFA 2F43G 4MS2A 4XEID 3QO5A 1H38A 2PI4A 5H6QA 3FKSG 5L3CA 1F4MA 1JQ0A 3AEIA 3CCUV 5KA6A 1SETA 2XAQA 4GX1A 4PDVA 1FFTB 1W0KG 2LPUA 3SYOA 3P32A 4J9YB 4RUFA 3G4SV 1BHBA 1VQ7V 3JD3A 2DYRC 2A9HA 1P7BA 4GX0A 2HFEC 3CMAV 2P9ND 4MSWC 1AROP 3CCRV 5GW7A 4TSFG 2OTLV 4JD2D 1OHHG 5IY5B 3CMEV 2EILC 1ROPA 2HJFC 3CCLV 3AG1B 4WFBV 3LUTB 2XAGA 5CA3A 1AJPA 1OCRC 1QVGU 2QE7G 1K8KF 4EBRA 1OCOC 1K3EA 3HPLC 3LDDA 3CYOA 4MVZA 1NR7A 1VQ6V 4HYOA 3CC7V 2ZDIA 3K08A 4MVQA 4TT3G 2OCCB 3QO7A 3TETA 4JYCA 5LHHA 4JPRA 2DWEC 3SYAA 1FXKA 3DTUB 3OE7G 2EBOA 3FYIB 4X89A 3ULEF 5B1OA 4DO2A 1E1QG 3CXCU 2AHZA 3ASNB 1OCZC 1QLEB 2ITDC 1YJNV 1S76D 1G4YB 2JIZG 2IH3C 4I9WA 3UM7A 4H33A 1VQOV 2W6JG 2EJRA 3ABMC 2WLIA 4P2ZA 4PA6A 3ASOC 4WFHA 3ZMSA 4DXWA 1FXKB 1UJWB 3E2EA 2EIJC 1KECA 1QLNA 3VX7B 2BOBC 2C2AA 3JD2A 1VQNV 2BSIA 4JD2F 3OEEG 4RAIA 3LNMB 3FB8C 5E1AC 3OGCC 2P9UF 3ZMUA 3DXKD 4XDKA 3VX8B 4ZBMA 4QNHB 2XNDG 3ABKB 3D3IA 3K06A 5CBFA 4QJFB 3LSSA 1M1KW 1NBMG 3FB5C 4JMFB 2EIKB 1M57C 2HR3A 2PLGA 3JD1A 1XKPB 1V54C 2M7WA 4MVRA 1CP9A 2KB1A 3K0DA 4QIWF 2AHYA 4UVAA 1VQLV 1NVPB 1SESA 2Q69A 3FB7C 1R6KA 3FB6C 3GWOA 1J95A 4JGSA 3RVYA 1QR8A 3X2QC 4WFAV 1LNQA 1DTOA 1S77D 1KKDA 2IH1C 4R50A 4N21A 4ASUG 1YITV 1YTFB 2WPDG 3T1CA 3AG2B 5EC1C 3CCSV 3RSED 2DQ3A 4HAMA 2EIMC 2Z5UA 1SRYA 4J9ZB 2ZXWB 2QKSA 1NH2D 5IYDO 2V1DA 1S0VA 1IXMA 3DWLD 3I55V 2X0LA 3BEHA 1K8KD 5LHIA 2K1EA 1K92A 3OR7C 3T4ZA 1V55C 1AI6A 2UXNA 3F5WC 3K0GA 2ITCC 5B1AB 4LC1A 3T2MA 1U2VF 1AI7A 3KXYA 1Q82W 4KP4A 2ATKC 1QCEA 1JCHA 3ZRSA 5IDJA 3SPGA 4XDLA 1QBZA 2XASA 4H37A 1MOFA 2DYSC 4FIPC 5H9CA 3CP1A 4P9PA 2DYRB 2EZPA 2OT5A 2P7TC 4FPPA 4GX5A 5C93A 2W6IG 1AJQA 1YI2V 1GK9A 4P9OA 2HG5C 1VQPV 2EILB 1M9NA 3UKUF 3ZRWA 5BZBA 1GO3F 3K3WA 2X6BA 3MHSC 3W7UA 1YHQV 4JASA 1K5QA 5B1BB 3VBBA 1L1FA 1OCRB 4KFMA 1PKXA 1Q81W 4PELA 5J9PC 4GF3A 3EHBB 5CBHA 3IFXA 1FXVA 3FYEB 1BHAA 2Q6AA 3RSEF 1Y4MA 1RPOA 3OMNB 4G2KA 2P9KD 4OXSA 3OUFA 1VQ5V 1CEZA 2KC5A 3E8BA 3W7XA 2CK3G 3ZRVA 4BW5A 2D3OW 2QA4V 3ZRWB 1K6ZA 2P9SD 1M56C 2P9UD 2EINB 3DWLF 3W7TA 2JJ2G 3ETEA 1ORQC 4MVSA 1R3IC 1YSCA 1S5HC 2BSJA 3SPIA 1OCZB 5L3BA 1F51A 3E89A 4G28B 1R3KC 2XOKG 2YEVB 1QR9A 2HLDG 5LGNA 4FK5C 3ABMB 1NJIW 4L87A 1FXHA 1P4RA 2ZR3A 2FTKA 2XGAA 3P30A 3GB7C 4JAVA 1H8EG 1K3SA 3CPWU 1K8AW 4BAYA 4WF9V 4Z1MG 2Y69C 5EK0A 4PDLA 2UXXA 3JCZA 4MW3A 2QEXV 4P30A 3UKRF 1ENVA 1N5BA 1K97A 2IJHA 5EC2C 4X8AA 3I56V 3ZCCA 1I5YA 2P9PD 2P9LD 1GTOA 1VQKV 1K34A 1NQTA 3STLC 3H01A 1DLBA 3OMIB 1M57B 2DYTA 2P9KF 3M99B 2IU0A 1V54B 3RW0A 1XL6A 3OM3B 3CCEV 4BIUA 3QNEA 2XAHA 3JYCA 2P9SF 3E8FA 1COWG 1AI5A 1RPRA 2HVJC 4UV8A 3K04A 3E86A 4WCEV 2Z3YA 2OTJV 5IYBO 1R73A 3LDEA 3VOUA 1GKFA 1U2VD 4CBCA 3TK1A 3DGEA 1YJWV 2P67A 2P90A 3SPJA 1K4DC 1N8RW 3ETGA 4UXNA 5B1NA 2OCCC 3HB3B 1JVMA 3ABTA 2A0LA 1Q86W 3AG3B 4PDMA 2EIMB 3OMAB 2ZR2A 1HWYA 3ZIAG 2BOCC 2IU3A 1F23A 2FM8A 3R65A 1YJ9V 1NKDA 4QE9A 4GSLC 1OZ0A 3UKUD 1NVPD 3ASNC 5H6RA 3AG4B 1RM1B 1V55B 2MK3A 1W0JG 2HVKC 3K9AA 5LBQA 1YTFD 3OR6C 3ABUA 1SERA 2W0FC 3DXMF 1FXKC 4F4LA 2DYSB 2P9PF 2P9LF 2JDIG 1PNMA 2WLKA 4MT8A 4ZKIA 4HZ3A 1K33A 3ZMTA 2P6JA 4R6ZA 3OUSA 1TYQD 1KQSU 3WG7C 3G71V 1E79G 4MW8A 3ML0A 3ABLC 1JJ2U 3NXSA 3ABKC 4JYBA 3E35A 5HFMA 1XL4A 2NNUA 2BSHA 1CPYA 2LFRA 2NLJC 4JTDB 5EBLC 2LFSA 4U7OA 1XKPC 2WLLA 5LGUA 1OCCC 3CXJA 1MSWD 1PD3A 5CN0A 1BMFG 1MG1A 3RBZA 4QPKA 3F7VC 2Y48A 2GHYA 2R9RB 4LBEC 1AI4A 1M56B 2JEUA 2QTOA 3CCJV 4G27B 5DM6V 3LDCA 4I5SA 3UKRD 3WFVA 1E1RG 1OCOB 1QVFU 1F4NA 4JF3A 3OAAG 4QPJA 1KP3A 2WLLB 1KD1W 2YEVA 3OW2U 4XDJA 2ZXWC 5B3SC 1JOYA 3CCMV 4PA7A 3PJSK 1FS0G 2DW4A 1EBOA 5EBWC 3STZC 2B1IA 2X7RB 4PA9A 4UV9A 1DF5A 2JK5C 4FJCC 4MVOA 1TTWA 3CCVV 1YIJV 4MVMA 2B5UA 2JJ1G 5B1AC 1TYQF 1S3JA 5DN6G 4G6TA 4YXWG 2WWWA 2Y69B 1VQ4V 2XAFA 1H2GA 1WPXA 2JEXA 2GSMB 1ZWIC 3CC2V 3ETDA 1K7DA 5EBMC 1L2WA 3A0RA 2XAJA 4WFFA 4KUMA 2LP7A 2MQDA 1AR1B 4GT1A 1PNLA 4MTXA 3LSQA 2P9ID 4RUEA 3ASOB 2Q67A 3BY6A 4PDRA 1GM8A 2IJJA 4H5BA 4UVCA 3IC7A 2EIJB 2EZOA 1JYOA 3EPUA 1THZA 3ZMZA 1NR1A 2R9IA 3K03A 5CMUA 5B1BC 5L3FA 3OFNG 1VQ9V 2H94A 3TU3A 2ZD9A 1PNKA 2QM8A 1GM7A 3D36A 3DXMD 3ZRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FM8 A;  1JYA A;  4GF3 A;  4AKX A;  1RY9 A;  2BSI A;  3KXY A;  2BSH A;  2XGA A;  1JYO A;  1K3S A;  3EPU A;  1S28 A;  1XKP C;  1K6Z A;  3CXJ A;  1TTW A;  4JMF B;  1N5B A;  1K3E A;  2BHO A;  3TU3 A;  2PLG A;  4G6T A;  2BSJ A;  1XKP B;  1L2W A; 
#chains in the Genus database with same CATH topology
 3EFF K;  1S72 V;  3SJQ C;  2E5L O;  5JVD A;  1GH6 A;  1YVW A;  2H8P C;  1R1B A;  3OEH G;  1SQB H;  5D5Q A;  3E8H A;  3ZN0 A;  5JCO A;  3JAR B;  4O4I A;  3ZJZ A;  3OT7 A;  4JAU A;  3UO3 A;  4MVU A;  1N34 B;  5JVD B;  4B3S B;  2LW1 A;  2P9N F;  2Y0P A;  4QE7 A;  4X88 A;  2WLN A;  2V4D A;  3SYQ A;  3WG7 B;  1M4U A;  3BHP A;  3SJB C;  4NVP A;  5IYC O;  1GN3 A;  4U3F H;  4DYL A;  2ZE7 A;  2WLI B;  4IL6 Z;  4Q20 A;  2IJK A;  4MTF A;  1Y66 A;  5L3G A;  5KUM A;  2E76 B;  3SPC A;  4DV3 O;  3MD0 A;  4DV6 B;  4RO2 A;  1VQ8 V;  1QU7 A;  4O2B A;  4LF8 O;  1JYA A;  3CS5 A;  5EYP A;  1RY9 A;  2DQ0 A;  2ILM A;  2UXD O;  1FKA O;  5GTH Z;  1XMQ B;  3K9S A;  2EIK C;  3AG3 C;  1JX9 A;  5L3E A;  1W2B U;  3CJH A;  1YCI A;  1NH2 B;  5B3S B;  1BL8 A;  2FML A;  1SZT A;  4O2B B;  5DED A;  1SA0 B;  2CGO A;  5EYP B;  4N23 A;  3CCQ V;  5L3D A;  4B3M B;  3ZHS A;  4MTO A;  3B77 A;  4LCU C;  4AKX A;  4JI1 B;  1K5S A;  2G38 A;  1IVS A;  3DXK F;  5KA5 A;  4LFA O;  2CTP A;  2CUG A;  3A2F A;  3TCU A;  5HFL A;  3SR2 C;  3MHH C;  2ZM6 O;  1N0N A;  2D2C B;  5H6Q A;  5IYZ B;  4YIO A;  3AEI A;  3CCU V;  3JAW A;  3RYI A;  5KA6 A;  1SET A;  4GX1 A;  1XNQ B;  1ZLZ A;  4FLU A;  4J9Y B;  4B3R B;  4LF6 O;  4GX0 A;  2P9N D;  3CMA V;  5GW7 A;  1JFF A;  4GKK B;  3HKD A;  4LFB B;  3DXR A;  1SQG A;  2HJF C;  2F23 A;  3CCL V;  1P84 F;  4B08 A;  3RYI B;  1K8K F;  4UCV A;  4QGP A;  1OCR C;  2DMX A;  1XNR B;  4LF5 B;  2BTO A;  4GZR B;  2ZE6 A;  3H1I H;  3CYO A;  1GAX A;  2PYL A;  5FNV A;  4JI8 B;  1Z2G A;  4MVQ A;  1JFF B;  4TT3 G;  3HKD B;  5LHH A;  2DWE C;  3SYA A;  1FXK A;  1F7Y A;  3L70 H;  1NTM H;  4X1Y A;  5B1O A;  1W59 A;  4C7U A;  2AHZ A;  2JIZ G;  4YHH O;  4I9W A;  3UM7 A;  4X62 O;  1VQO V;  3C90 A;  2EJR A;  5BXZ A;  4AI8 A;  4JI4 O;  4WFH A;  3ZMS A;  1FXK B;  4F6R A;  4FM1 A;  2JRI A;  1XRE A;  2BOB C;  1HNX B;  4JD2 F;  3OEE G;  4RAI A;  3LNM B;  3JSN A;  4FFK A;  1HDJ A;  3DXK D;  4XDK A;  5K1P A;  4NXM O;  3O9O A;  4JI2 O;  4I4T A;  3RN4 A;  3K06 A;  2R9A A;  1PL4 A;  5CBF A;  4LWS A;  1M1K W;  4F6R B;  2EIK B;  4DUY O;  1M57 C;  2HR3 A;  4U3J A;  2M7W A;  1CP9 A;  2AHY A;  4GKJ B;  2Q69 A;  1AB3 A;  3FB6 C;  4UCR A;  4JGS A;  2YIB A;  2UXB B;  1LNQ A;  4I0X A;  4I4T B;  4R50 A;  1YIT V;  3J7A U;  3RYH A;  1AR5 A;  2EUL A;  3T1H B;  4U3J B;  2Z5U A;  1SRY A;  4J9Z B;  2ZXW B;  5IYD O;  1S0V A;  5KHK A;  3I55 V;  1K8K D;  5LHI A;  1B04 A;  1K92 A;  2K1E A;  3OR7 C;  5B1A B;  5IJ0 A;  1AI7 A;  3NR7 A;  4FFB A;  1Y74 A;  2Q7G A;  3SPG A;  4I50 B;  2DYS C;  2YS8 A;  5LXT A;  1D5A A;  2W6I G;  1O9G A;  1WJZ A;  3HKC A;  1FPO A;  4ZIB A;  3K3W A;  2X6B A;  3W7U A;  4JAS A;  5B1B B;  3ZED A;  1OCR B;  5KX5 A;  4FFB B;  2VQE B;  1I0H A;  4GF3 A;  5CBH A;  3IFX A;  2A3Q A;  4A5U B;  4LF7 B;  3CHX A;  3OMN B;  2P9K D;  3HKC B;  3E8B A;  4J11 A;  2D3O W;  1VEW A;  3CX5 F;  2P9S D;  2QA4 V;  1Q6H A;  4AHC A;  2JS5 A;  5KLV H;  1NI8 A;  1F51 A;  2QSA A;  2K9P A;  1FYJ A;  2RJZ A;  4JYA B;  1IBM O;  4FK5 C;  1KYO F;  5EIB D;  2OCH A;  4X65 B;  4L87 A;  4DR4 B;  5JJJ B;  1P4R A;  2XGA A;  4DV1 B;  3CPW U;  1K8A W;  4BAY A;  2Y69 C;  1N5B A;  5EC2 C;  1K34 A;  1YXB A;  1NQT A;  2DJV A;  3OMI B;  5CA1 B;  1M57 B;  1EM1 A;  3RW0 A;  1XL6 A;  2ARH A;  3OM3 B;  3CCE V;  4BIU A;  3QNE A;  3GWK C;  3JYC A;  4UV8 A;  4WCE V;  3K04 A;  2PF4 E;  2Z3Y A;  3LDE A;  3VOU A;  4CS2 A;  2GBO A;  4CBC A;  3TK1 A;  2JGD A;  3CSX A;  2P90 A;  5LP6 C;  2ZCE A;  4UXN A;  3HB3 B;  2A0L A;  3FX7 A;  3KCY A;  3IJ4 A;  1NKD A;  2BTQ A;  1P49 A;  3ASN C;  4D7S A;  5H6R A;  3AG4 B;  4LF9 O;  5J2T A;  2MK3 A;  4DV4 O;  1HNW O;  2P4V A;  3K9A A;  5LBQ A;  2UUA B;  3BRC A;  2QGN A;  4H0L B;  4K35 A;  5IJ9 A;  2DYS B;  2P9L F;  2JDI G;  2HP8 A;  4HZ3 A;  3UT5 A;  3ZX6 A;  1A32 A;  1TYQ D;  3BAB A;  1E79 G;  4MW8 A;  5J2T B;  1EN5 A;  4LR3 A;  3NXS A;  1M93 A;  3ABK C;  4JYB A;  5HFM A;  4DR7 O;  3UQ8 A;  1YF2 A;  5CA0 A;  2GUZ A;  1CPY A;  3H1J H;  4EB6 A;  1I94 B;  4ZI7 B;  2WLL A;  1OCC C;  3UT5 B;  1MSW D;  4UB6 Z;  3F7V C;  2GHY A;  4LBE C;  1O9H A;  2JEU A;  4GYC B;  3CCJ V;  5CA0 B;  2GUZ B;  3WFV A;  1AIL A;  1OCO B;  2F4V O;  4CS4 A;  2UUB O;  2KG7 A;  2WLL B;  2YEV A;  4XDJ A;  1JOY A;  1WB7 A;  3ZHT A;  2N74 A;  3IAY A;  2B1I A;  4UV9 A;  2VQF B;  4MVO A;  1TTW A;  3OTO B;  5FPR A;  2B5U A;  5DN6 G;  3VQW A;  2Y69 B;  1VQ4 V;  1ZWI C;  2LJ2 A;  4DR2 B;  1K7D A;  1L2W A;  4WFF A;  4GT1 A;  1XDC A;  3LSQ A;  2P9I D;  2Q67 A;  1U96 A;  4PDR A;  4B7E A;  2O57 A;  4UVC A;  2EIJ B;  2EZO A;  3EPU A;  3RFR A;  1GN6 A;  1IBK O;  5L3F A;  3OFN G;  2H94 A;  3N2G A;  3K5O A;  4OGQ B;  3FAV A;  3TXQ A;  4GUN A;  2QM8 A;  4BWA A;  5FL7 G;  1PL0 A;  3QG5 A;  3BPZ A;  2YI9 A;  4CC5 A;  3AG1 C;  2QM4 A;  3X2Q B;  2R70 A;  3W7S A;  4E4E A;  2IJI A;  3JAK A;  1URF A;  3JAM N;  3E83 A;  2X6C A;  2WLJ A;  2X6A A;  4JTC B;  5CB4 A;  4O2A A;  3OTF A;  3CD6 V;  3JAK B;  4R7C A;  1Q8I A;  3T1Y B;  4LP8 A;  4GCZ A;  2A79 B;  3J80 N;  4PA3 A;  1R3J C;  2A7W A;  1OCC B;  1TUE B;  3JSL A;  2B1G A;  3H1K H;  4JTA B;  1DGS A;  2WAM A;  1S28 A;  1R3L C;  1DF4 A;  1MAB G;  1CXZ B;  4X64 O;  4WFE A;  2PI5 A;  1Q7Y W;  2BHO A;  4FMT A;  3K79 A;  1FJG B;  3QO8 A;  2M6Y A;  3S3X A;  1RM1 C;  4HBN A;  1JPX A;  1VF6 A;  4UCS A;  2P22 C;  3G6E V;  1H2M A;  1K9M W;  4DR6 O;  2ZM6 B;  2LQT A;  2V7Q G;  3I5D A;  3ULE D;  4MS2 A;  1H38 A;  5GTI Z;  2P4K A;  1F4M A;  1S5L Z;  5J2U A;  1HP8 A;  1JQ0 A;  2XAQ A;  4LF6 B;  1D5N A;  2LPU A;  3SYO A;  1N0J A;  2ZE8 A;  4DR3 O;  4K3A A;  1H2S B;  2Z0A A;  4J80 A;  2DYR C;  3U0Z A;  5DEC A;  1ZX3 A;  3CCR V;  2OTL V;  1GRJ A;  3AG1 B;  4WFB V;  3LUT B;  1AJP A;  4LNU A;  2QE7 G;  3L75 H;  1K3E A;  3HPL C;  4MVZ A;  1NR7 A;  4HYO A;  4LFC B;  2WA3 A;  3G6B A;  3K08 A;  2RDC A;  4H44 B;  2OCC B;  1Z5V A;  4JYC A;  4JI3 O;  3WU2 Z;  3DTU B;  3OE7 G;  2EBO A;  4X89 A;  4LNU B;  2CAZ C;  4X62 B;  1M5I A;  2ITD C;  2E3C A;  2QWR B;  4TOI A;  2HEP A;  5BR8 O;  3VQY A;  3B2E E;  4JI4 B;  3UCS C;  1XQ8 A;  2WLI A;  4PA6 A;  3ASO C;  3B09 A;  1KEC A;  3J81 N;  4J7J A;  1KKC A;  4JI2 B;  3OGC C;  2P9U F;  5BMV B;  2JGU A;  1Q90 D;  3D3I A;  4QJF B;  3QTC A;  1HNZ O;  4O4H A;  1NBM G;  4JMF B;  1SZX A;  2IBZ H;  1XKP B;  1V54 C;  4J7K A;  4JZG A;  2F1M A;  1SA0 A;  1S77 D;  4YIP A;  2IH1 C;  3D36 C;  2LO1 A;  1YTF B;  2WPD G;  3KKY A;  4O4H B;  3FD9 A;  3RSE D;  4X66 O;  2DQ3 A;  1J5E O;  3AK1 A;  2ZKO A;  4ZOL A;  1NH2 D;  5ITZ A;  4H13 B;  3DWL D;  3BEH A;  2QDO A;  1N36 O;  4DUZ B;  4PD4 F;  4LH7 A;  3T4Z A;  5KMG A;  1V55 C;  4X1I A;  5IYZ A;  4LC1 A;  3ICX A;  4FVM A;  4XDL A;  2XAS A;  4FLY A;  4ZOL B;  1MOF A;  3ZHU A;  5H9C A;  4P9P A;  1QQC A;  2DYR B;  1JMK C;  2EZP A;  5ITZ B;  4GX5 A;  1NS1 A;  2IM9 A;  2CH7 A;  4P9O A;  2HG5 C;  3CRR A;  5KMG B;  1WP8 A;  4X1I B;  1M9N A;  5BZB A;  3L72 H;  1HR0 B;  4TV9 A;  3VBB A;  1BE3 H;  1SQP H;  4OX9 O;  4PEL A;  1IBL O;  1BSM A;  2WA4 A;  1FXV A;  1L0L H;  3DC5 A;  4X9Q A;  4CH3 A;  4G2K A;  1VQ5 V;  5IWA O;  2CH7 B;  5LMN O;  2P9U D;  3W7T A;  2JJ2 G;  3ETE A;  4TV9 B;  1ORQ C;  4TV8 B;  4D6T H;  5C8Y B;  2B9Z A;  1PM9 A;  1VP7 A;  2ZE5 A;  4B7K A;  3ZHQ A;  1IBM B;  2BSJ A;  5L3B A;  3DSQ A;  1R3K C;  3LNN A;  3C3S A;  5LGN A;  1FXH A;  2JVD A;  2ZR3 A;  1H2N A;  4IIJ A;  3P30 A;  4JAV A;  1K3S A;  1SKV A;  5AG2 A;  1XUQ A;  1MMM A;  4Z1M G;  2ZNJ A;  4PDL A;  2UXX A;  4MW3 A;  1MZE A;  4P30 A;  1ENV A;  1EN4 A;  3P3N A;  4DV0 O;  2CDY A;  4JI5 B;  1I5Y A;  1VQK V;  4LF4 O;  4IIJ B;  1VAR A;  2P9K F;  1V54 B;  1XIL A;  2XAH A;  2P9S F;  3E8F A;  2HVJ C;  3E86 A;  4UCO A;  2QWO B;  2Y0I A;  2W0X A;  1KMI Z;  3RT3 C;  1L8D A;  1OJH A;  2H3O A;  1N8R W;  5BY1 A;  3ABT A;  2GTS A;  3AG3 B;  2ZR2 A;  3QF7 A;  1HWY A;  4NXN O;  2QWN B;  2UU9 O;  4LF9 B;  4QE9 A;  1HNW B;  4DV4 B;  4B3S O;  1YZB A;  2PUS A;  1XMO O;  5KAI Z;  3C3T A;  1V55 B;  4FLZ A;  2HVK C;  3OR6 C;  3ABU A;  2W0F C;  5D5P A;  3DXM F;  1PP9 H;  4F4L A;  2Q73 A;  4I50 A;  4JI0 B;  1H2K A;  1PNM A;  3WB0 A;  3ZMT A;  4YY3 B;  4DR7 B;  3OUS A;  3Q4H A;  2YIB D;  1KQS U;  2UUC O;  3ML0 A;  3OGI B;  3ABL C;  1JJ2 U;  1FD9 A;  2A06 H;  2RCV A;  3F5T A;  2NNU A;  2BSH A;  3A0B Z;  4DRX A;  2LFR A;  4JTD B;  2LFS A;  5LGU A;  4DR1 O;  3RBZ A;  1MG1 A;  1SQF A;  3Q4H B;  3AG7 A;  2XUM A;  2F4V B;  1I08 A;  2UUB B;  2QTO A;  2E74 B;  5IT9 N;  1P7G A;  4G27 B;  5DM6 V;  4DRX B;  1E1R G;  2OD0 A;  1QVF U;  1F4N A;  1KP3 A;  1QNM A;  1KD1 W;  2YID A;  3O65 A;  1OV9 A;  1FS0 G;  3STZ C;  5KHJ A;  1DF5 A;  2JK5 C;  1X4T A;  1Y67 A;  2ADP A;  2JJ1 G;  4K8X A;  1TYQ F;  1S3J A;  2WWW A;  1WPX A;  2JEX A;  2GSM B;  4KL1 A;  3CC2 V;  3ETD A;  3A0R A;  1N33 B;  1ZUQ A;  1BGY H;  2LP7 A;  1AR1 B;  4NKG B;  1G6U A;  4B3R O;  4H5B A;  3IC7 A;  5CA1 A;  1JYO A;  4W4L A;  3VQX A;  2R9I A;  4LFB O;  3N2K A;  5LMU B;  1BZK A;  1Y6X A;  3SGI A;  4NR1 A;  3DXM D;  1WA8 A;  1WNS A;  4JI6 O;  4RWU A;  3EXA A;  5IY5 C;  4K0K B;  2FB5 A;  2EIN C;  1KC8 W;  3N2K B;  3B8M A;  3E8G A;  1SQQ H;  4BIZ A;  1M90 W;  2QM7 A;  5H5N A;  1VQM V;  1WA8 B;  2YXY A;  3F7Y C;  4FLT A;  1R6N A;  1N32 B;  1I7F A;  2L35 A;  4TWK A;  2P9I F;  2ZQM A;  1US6 A;  2PYJ A;  3THO A;  4AIL C;  2ETN A;  4BR6 A;  4UVB A;  1I5X A;  1VF5 B;  4NB5 A;  4U7N A;  1HNX O;  5LA6 B;  1G8M A;  4K8Z A;  3ABL B;  5LL6 Y;  1H8H G;  4FLW A;  1ZL8 A;  2UXC O;  3GVM A;  4ZI7 A;  1K73 W;  3JD0 A;  4JYY A;  4O4L B;  4W4K A;  2YUA A;  3SPH A;  1B6Q A;  2DOS A;  4WBN B;  2VWK A;  2UXB O;  3FFQ A;  2HKO A;  1ZL8 B;  3IGA C;  3TGU H;  2E75 B;  4X64 B;  2VWJ A;  1AJN A;  3B8N A;  5LGT A;  1TAE A;  2WLH A;  1LUV A;  5F2V O;  3CWB H;  3KG2 A;  1XEQ A;  3SYC A;  3G67 A;  4DR6 B;  3AG2 C;  4GX2 A;  3S3W A;  2GV9 A;  5FLX N;  1WPB A;  2DWD C;  3APQ A;  1Y76 B;  2PZS A;  2RMK B;  3MDS A;  4BIO A;  2OWO A;  5LOV A;  4JI7 O;  3UKM A;  5JQG A;  1B06 A;  3QO5 A;  3G80 A;  1VIB A;  1SS3 A;  5KHH A;  3A0H Z;  1W0K G;  4TQD A;  3P32 A;  1WAZ A;  5LOV B;  3JD3 A;  1VMG A;  3A8T A;  5JQG B;  4TSF G;  2LW7 A;  5LP6 A;  1OHH G;  1AP6 A;  5IY5 B;  3CME V;  2XAG A;  1QVG U;  3DC6 A;  1VQ6 V;  3CC7 V;  2E5L B;  4JI3 B;  2YXL A;  4O4J A;  5LP6 B;  1Q6U A;  3TET A;  4JYA O;  1IX9 A;  3FYI B;  3ULE F;  4DO2 A;  4DR4 O;  1E1Q G;  3CXC U;  3JAT B;  1XHX A;  3ASN B;  1OCZ C;  2LGQ A;  1S76 D;  2GDS A;  2IH3 C;  2AZ2 A;  1XHZ A;  2F66 C;  4X20 B;  2ZIO A;  4O4J B;  3ABM C;  4P2Z A;  4DXW A;  1UJW B;  3K5N A;  4NTY A;  4PJ0 Z;  1QLN A;  3VX7 B;  2C2A A;  3AK2 A;  4EFE A;  1VQN V;  2CGN A;  2BSI A;  2P06 A;  2QTS A;  3FB8 C;  5E1A C;  3P3P A;  1HNZ B;  4HNA A;  1PPJ H;  3CRA A;  4ZBM A;  2XND G;  3ABK B;  2Q8V A;  4DV3 B;  1IDS A;  4JZ2 A;  3FB5 C;  4CH4 A;  3RWR D;  2PLG A;  3JD1 A;  1G1X B;  4LF8 B;  4AQY O;  4QIW F;  4UVA A;  1NVP B;  3FB7 C;  1RSO B;  3HKE A;  2UXD B;  4D7T A;  4HNA B;  1QR8 A;  1RFY A;  4WFA V;  4DV5 O;  1KKD A;  2ZIM A;  4N21 A;  1J5E B;  3T1C A;  3AG2 B;  3CCS V;  3CRC A;  4DW1 A;  3JAL A;  2P5O A;  1N4C A;  4FM2 A;  1N36 B;  4FLV A;  2YIC A;  3HKE B;  1IXM A;  2RN9 A;  1FFX B;  4JAA A;  5JCO C;  2EX3 A;  2HHH O;  4GLX A;  2UXN A;  3F5W C;  3K0G A;  2CTR A;  3T2M A;  4LFA B;  3KXY A;  2ATK C;  1QCE A;  3JAL B;  1D2D A;  2NN4 A;  1QBZ A;  3RGB A;  4H37 A;  5H2F Z;  3ETQ A;  2OT5 A;  2P7T C;  4FPP A;  4L8J A;  2Q7H A;  1I94 O;  1GK9 A;  4OX9 B;  4Z2W A;  1IBL B;  3ZRW A;  1GO3 F;  3MHS C;  5TIS Z;  3ZHV A;  3MAQ A;  2KSD A;  1TGO A;  1MA1 A;  3EHB B;  4FZ1 A;  5IWA B;  3FYE B;  3L73 H;  3RSE F;  5LMN B;  1RPO A;  3OUF A;  1CEZ A;  1JJO A;  3W7X A;  4LH6 A;  2Q7E A;  3ZRW B;  1XOU A;  2AW9 A;  3DWL F;  3D8C A;  2F95 B;  1R3I C;  4ZHQ B;  1S5H C;  2DE0 X;  3SPI A;  1OCZ B;  1HW7 A;  3WB2 A;  3QVN A;  2XOK G;  3AK3 A;  1KU9 A;  2OYQ A;  3BA9 A;  3ABM B;  1NJI W;  1BCC H;  3BVO A;  2FTK A;  4YJ3 A;  2BE3 A;  3GB7 C;  4IHJ B;  1H8E G;  4YHH B;  2QJ1 A;  3PN1 A;  5EK0 A;  5BMV A;  2QEX V;  1K97 A;  4LF4 B;  4J42 A;  3ZCC A;  4IYH A;  2P9P D;  2Q0O C;  4YJ3 B;  3M8A A;  1DLB A;  2NR5 A;  2DYT A;  3M99 B;  2PTM A;  4NXM B;  1RPR A;  1AI5 A;  3JAS B;  2OTJ V;  1GKF A;  1Z5W A;  4DUY B;  3DGE A;  2P67 A;  5JH7 A;  4NXN B;  3SPJ A;  1K4D C;  3ETG A;  5B1N A;  4KHP O;  4KXR A;  1JVM A;  2UU9 B;  4PDM A;  2BOC C;  2IU3 A;  1YJ9 V;  1XMO B;  1KBH A;  2YC0 A;  4EFB A;  4GSL C;  1OZ0 A;  3D3Q A;  4TUY A;  1GN2 A;  1RM1 B;  4O4I B;  1W0J G;  5JH7 B;  4CH6 A;  3U10 A;  1YTF D;  1SER A;  1H2L A;  4CS3 A;  1FXK C;  3T1Y O;  2UUC B;  2GTA A;  4MT8 A;  4ZKI A;  1K33 A;  5IE9 A;  4DV7 O;  4TUY B;  2EJ7 A;  4Z1V A;  4CC6 A;  3G71 V;  5A9G A;  3K59 A;  2DN9 A;  4DR1 B;  1FAF A;  1YEW A;  2NLJ C;  1RP3 B;  4U7O A;  1PV0 A;  2OIE A;  3CXJ A;  1PD3 A;  5CN0 A;  4CH5 A;  4DW0 A;  4PHZ A;  4JV5 O;  3TXS A;  2Y48 A;  1Q6I A;  2R9R B;  2XHB A;  1AI4 A;  2ADQ B;  3ZS8 C;  1KUQ A;  2ZT9 B;  2FYU H;  4TV8 A;  5C8Y A;  4I5S A;  1FJG O;  3IC9 A;  4QPJ A;  2Q9L A;  3CJH B;  4PV1 B;  3OW2 U;  2ZXW C;  4PA7 A;  4DK1 A;  2DW4 A;  4PA9 A;  4I7Z B;  2AGA A;  1AR4 A;  4B3T O;  4YJ2 A;  1UFI A;  1YIJ V;  4MVM A;  5B1A C;  1DK1 A;  2VS0 A;  4DK0 A;  4YXW G;  2XAF A;  1X59 A;  2XAJ A;  2MQD A;  1JA8 A;  4DV2 O;  2ODM A;  3ASO B;  1L0N H;  1NZ6 A;  4F6E A;  1GM8 A;  2IJJ A;  4YJ2 B;  3ZMZ A;  4DR5 O;  3K03 A;  5CMU A;  5B1B C;  3JAW B;  4J10 A;  3U11 A;  3E22 A;  5A2Q N;  4JI6 B;  1PNK A;  3D36 A;  1GM7 A;  2QWQ B;  3ZHR A;  3ZRX A;  3KZI Z;  4OPH A;  3ZN1 A;  3CB2 A;  4LFC O;  3DXR B;  3CEI A;  3K5M A;  2AXT Z;  4XEI F;  2WLM A;  3SJC C;  1SC5 B;  3E22 B;  4J7Z A;  1WN7 A;  1K4C C;  3JCU Z;  1GM9 A;  3T4D A;  5FNV B;  5EIB C;  2IW5 A;  2WSS G;  2L6L A;  3H1H H;  1EZJ A;  4X1Y B;  1EFR G;  1N34 O;  2FL4 A;  2RQ6 A;  1GMG A;  2Q4P A;  1QLE C;  4IGG A;  4CZZ A;  3JD4 A;  1BS3 A;  4EKW A;  1AVM A;  2ZDI C;  3CRM A;  4UUJ C;  2YSU B;  2CTW A;  2UXC B;  1U97 A;  5KUK A;  4PA4 A;  2Y4T A;  4E2L A;  1Q43 A;  4X1K A;  1TVK A;  1KB9 F;  4BW9 A;  4J41 A;  1WLE A;  3KCX A;  3RVZ A;  3ZMV A;  4R8C A;  4DV6 O;  5GON A;  2Q68 A;  2VRZ A;  4LWS B;  1V9P A;  5EZY A;  4RQE A;  3CRQ A;  4X1K B;  2XT9 A;  5CBG A;  1TVK B;  2JS3 A;  5JJE B;  1XMQ O;  4MTG A;  3W7W A;  3H1L H;  3AG4 C;  1KP2 A;  4I0X B;  5GON B;  2RNB A;  2QR4 A;  3RYH B;  4NTX A;  5LHG A;  5EZY B;  4DUZ O;  4B3M O;  4JI7 B;  3SYP A;  4JI1 O;  4XBF A;  3CC4 V;  4WFG A;  1BQZ A;  2PY5 A;  4RQF A;  2F43 G;  1ZTE A;  1MNG A;  2MW2 B;  4XEI D;  3L71 H;  2PI4 A;  4EEQ A;  3FKS G;  5L3C A;  5IJ0 B;  4I9Q A;  4PDV A;  1FFT B;  4OPA A;  1QHT A;  1Y74 B;  3K57 A;  1HR0 O;  4RUF A;  3G4S V;  1BHB A;  1R6T A;  1XNQ O;  1VQ7 V;  5LXT B;  2A9H A;  1P7B A;  2HFE C;  2QKC A;  4MSW C;  1ARO P;  1IBK B;  4JD2 D;  4I55 A;  2EIL C;  1ROP A;  1S5J A;  2HJD A;  4GKK O;  5CA3 A;  3CXH F;  5KX5 B;  4EBR A;  1OCO C;  3LDD A;  1NT2 B;  1XNR O;  4LF5 O;  2BSK A;  2ZDI A;  3QO7 A;  4I55 B;  2BCC H;  4JPR A;  1MZF A;  4JI8 O;  5B5E Z;  3HKB A;  3LSU A;  1QLE B;  1YJN V;  1G4Y B;  1VF7 A;  5LA6 A;  4H33 A;  2BSK B;  2W6J G;  1WP7 A;  2Y4U A;  3TJT A;  2KKW A;  1UPG A;  3E2E A;  2EIJ C;  1EZV H;  4JI5 O;  1LR1 A;  1Q5O A;  3BFR A;  3HKB B;  3JD2 A;  1Q3E A;  2Q0A A;  1ZSP A;  3ZMU A;  3VX8 B;  4O4L A;  3RYF A;  4QNH B;  4WBN A;  4AQY B;  1B3Q A;  1JR9 A;  3M7M X;  3LSS A;  4NYK A;  3RYC A;  4FM0 A;  3B40 A;  4MVR A;  2KB1 A;  3K0D A;  1VQL V;  4DV5 B;  1SES A;  1R6K A;  3GWO A;  1J95 A;  3RVY A;  3UO2 A;  1AP5 A;  1NU1 H;  3X2Q C;  3RYF B;  1DTO A;  4GKJ O;  4ASU G;  2JGD B;  5FPO A;  2ZIN A;  5EC1 C;  3RYC B;  4IT5 A;  1IZ3 A;  4HAM A;  2EIM C;  2F93 B;  1Y76 A;  3T1H O;  4PI0 A;  2QKS A;  2V1D A;  2HHH B;  2BTQ B;  4UCT A;  2X0L A;  4JI0 O;  4TQF A;  4YY3 O;  1AI6 A;  2ITC C;  1U2V F;  2KQX A;  3L74 H;  1Q82 W;  4KP4 A;  2N04 A;  3ZRS A;  1JCH A;  5IDJ A;  1SQX H;  5IJ9 B;  5JWP A;  4FIP C;  4FZ0 A;  3CP1 A;  5C93 A;  1AJQ A;  1YI2 V;  3CE2 A;  1VQP V;  2EIL B;  1GN4 A;  2OIG A;  3UKU F;  1YHQ V;  1K5Q A;  4DR3 B;  1L1F A;  1Q81 W;  2PGG A;  1PKX A;  4KFM A;  5J9P C;  1MSD A;  4EB6 B;  1BHA A;  2Q6A A;  2VQE O;  2AZ0 A;  1Y4M A;  4OXS A;  2KC5 A;  4ICG A;  4LF7 O;  5KAF Z;  2CK3 G;  3ZRV A;  4BW5 A;  1K6Z A;  1M56 C;  2EIN B;  4MVS A;  1YSC A;  3JAT A;  3E89 A;  2KG7 B;  4G28 B;  3ZBH A;  3BA8 A;  2YEV B;  1QR9 A;  2HLD G;  4X20 A;  1N33 O;  2YIA A;  4X65 O;  5BR8 B;  4WF9 V;  1VF6 C;  4DV1 O;  3JCZ A;  3OD4 A;  3UKR F;  5KHG A;  2IJH A;  2YDE A;  3H9V A;  4X8A A;  3I56 V;  3VQV A;  2FKX A;  5LMU O;  2P9L D;  1GTO A;  2CE4 A;  3STL C;  3H01 A;  2IU0 A;  1TA8 A;  4Q6G A;  1WB8 A;  1COW G;  1RSO A;  4K0K O;  2R72 A;  3N2G B;  5IYB O;  1R73 A;  1U2V D;  4UB8 Z;  1YDX A;  3FAV B;  4KHP B;  1NTK H;  1YJW V;  2OCC C;  1Q86 W;  2EIM B;  3OMA B;  3ZIA G;  1F23 A;  2FM8 A;  3R65 A;  1N32 O;  3UKU D;  2QKA A;  1NVP D;  1FFX A;  2XTA A;  3APO A;  3N27 A;  4X66 B;  1XI1 A;  4DV7 B;  2P9P F;  2UUA O;  2WLK A;  5CB4 B;  4O2A B;  3K58 A;  2P6J A;  4R6Z A;  4FLX A;  1TUB A;  4NTW A;  3WG7 C;  1ZAU A;  3E35 A;  1XL4 A;  3B4S A;  3SDL A;  5E79 Z;  5B66 Z;  5EBL C;  1LUW A;  4JV5 B;  1XKP C;  2YXH A;  3EVK A;  1SF9 A;  1TUB B;  5K1X A;  1BMF G;  4QPK A;  5KHI A;  1M56 B;  1T5E A;  3LDC A;  3UKR D;  1BQ0 A;  3L9D A;  4ZHQ A;  4JF3 A;  3OAA G;  3HR0 A;  2Q5Z A;  5JJN B;  4PI2 A;  4IYI A;  5B3S C;  1BT8 A;  3CCM V;  3BAA A;  3PJS K;  4B3T B;  1IXB A;  1EBO A;  5EBW C;  2LGW A;  2N05 A;  2X7R B;  1NTZ H;  4ABM A;  3K5L A;  4FJC C;  3CCV V;  4UFZ A;  4IHJ A;  4G6T A;  5LYJ A;  2VQF O;  3BCC H;  1XBL A;  1H2G A;  3OTO O;  4DV2 B;  1IUR A;  5EBM C;  3SJA C;  4KUM A;  1PNL A;  4MTX A;  4DR2 O;  2CTQ A;  4RUE A;  4DR5 B;  3BY6 A;  1THZ A;  1SQV H;  1NR1 A;  5J2U B;  5LYJ B;  2QWP B;  2YI8 A;  4DV0 B;  1EN6 A;  1VQ9 V;  3WB1 A;  3JAS A;  2ZNI A;  3TU3 A;  4UCU A;  3R66 A;  2ZD9 A;  3JAR A; 
#chains in the Genus database with same CATH homology
 3ZN1 A;  3EFF K;  1S72 V;  3SJQ C;  5IY5 C;  5FL7 G;  2EIN C;  1PL0 A;  1KC8 W;  2H8P C;  3AG1 C;  4XEI F;  2WLM A;  3OEH G;  3B8M A;  3E8G A;  4BIZ A;  1M90 W;  3X2Q B;  1K4C C;  3E8H A;  3ZN0 A;  3W7S A;  1GM9 A;  2QM7 A;  3T4D A;  2IJI A;  2IW5 A;  2WSS G;  3ZJZ A;  1VQM V;  4JAU A;  4MVU A;  3F7Y C;  1R6N A;  3E83 A;  4TWK A;  2P9N F;  2P9I F;  2ZQM A;  1EZJ A;  2X6C A;  1EFR G;  2WLJ A;  2X6A A;  4JTC B;  4QE7 A;  4X88 A;  2WLN A;  1GMG A;  1I5X A;  1QLE C;  4UVB A;  3SYQ A;  3WG7 B;  4CZZ A;  4U7N A;  3JD4 A;  1G8M A;  4EKW A;  5IYC O;  3ABL B;  2ZDI C;  3CD6 V;  4UUJ C;  1H8H G;  2YSU B;  4R7C A;  2WLI B;  5KUK A;  4LP8 A;  4PA4 A;  4GCZ A;  2A79 B;  4E2L A;  4Q20 A;  2IJK A;  4PA3 A;  4MTF A;  1R3J C;  1Y66 A;  5L3G A;  5KUM A;  1OCC B;  3SPC A;  1K73 W;  3MD0 A;  3JD0 A;  1WLE A;  4RO2 A;  1VQ8 V;  3RVZ A;  1TUE B;  3ZMV A;  1JYA A;  4R8C A;  2B1G A;  1RY9 A;  2DQ0 A;  3SPH A;  4JTA B;  2Q68 A;  1B6Q A;  2WAM A;  2HKO A;  3IGA C;  4RQE A;  1AJN A;  3B8N A;  1S28 A;  1R3L C;  2EIK C;  3AG3 C;  1JX9 A;  5L3E A;  5LGT A;  5CBG A;  1W2B U;  1NH2 B;  1DF4 A;  1MAB G;  2WLH A;  5B3S B;  1BL8 A;  4WFE A;  2PI5 A;  1Q7Y W;  1SZT A;  4MTG A;  4FMT A;  3W7W A;  2BHO A;  3K79 A;  3KG2 A;  4N23 A;  3AG4 C;  3QO8 A;  1KP2 A;  5L3D A;  3SYC A;  3CCQ V;  1RM1 C;  4MTO A;  1JPX A;  3B77 A;  5LHG A;  4LCU C;  4AKX A;  1K5S A;  3DXK F;  3AG2 C;  4GX2 A;  3G6E V;  2DWD C;  5KA5 A;  1K9M W;  3SYP A;  4XBF A;  3CC4 V;  3TCU A;  5HFL A;  4WFG A;  2V7Q G;  3MHH C;  3UKM A;  3ULE D;  4RQF A;  2F43 G;  4MS2 A;  4XEI D;  3QO5 A;  1H38 A;  2PI4 A;  5H6Q A;  3FKS G;  5L3C A;  1F4M A;  1JQ0 A;  3AEI A;  3CCU V;  5KA6 A;  1SET A;  2XAQ A;  4GX1 A;  4PDV A;  1FFT B;  1W0K G;  2LPU A;  3SYO A;  3P32 A;  4J9Y B;  4RUF A;  3G4S V;  1BHB A;  1VQ7 V;  3JD3 A;  2DYR C;  2A9H A;  1P7B A;  4GX0 A;  2HFE C;  3CMA V;  2P9N D;  4MSW C;  1ARO P;  3CCR V;  5GW7 A;  4TSF G;  2OTL V;  4JD2 D;  1OHH G;  5IY5 B;  3CME V;  2EIL C;  1ROP A;  2HJF C;  3CCL V;  3AG1 B;  4WFB V;  3LUT B;  2XAG A;  5CA3 A;  1AJP A;  1OCR C;  1QVG U;  2QE7 G;  1K8K F;  4EBR A;  1OCO C;  1K3E A;  3HPL C;  3LDD A;  3CYO A;  4MVZ A;  1NR7 A;  1VQ6 V;  4HYO A;  3CC7 V;  2ZDI A;  3K08 A;  4MVQ A;  4TT3 G;  2OCC B;  3QO7 A;  3TET A;  4JYC A;  5LHH A;  4JPR A;  2DWE C;  3SYA A;  1FXK A;  3DTU B;  3OE7 G;  2EBO A;  3FYI B;  4X89 A;  3ULE F;  5B1O A;  4DO2 A;  1E1Q G;  3CXC U;  2AHZ A;  3ASN B;  1OCZ C;  1QLE B;  2ITD C;  1YJN V;  1S76 D;  1G4Y B;  2JIZ G;  2IH3 C;  4I9W A;  3UM7 A;  4H33 A;  1VQO V;  2W6J G;  2EJR A;  3ABM C;  2WLI A;  4P2Z A;  4PA6 A;  3ASO C;  4WFH A;  3ZMS A;  4DXW A;  1FXK B;  1UJW B;  3E2E A;  2EIJ C;  1KEC A;  1QLN A;  3VX7 B;  2BOB C;  2C2A A;  3JD2 A;  1VQN V;  2BSI A;  4JD2 F;  3OEE G;  4RAI A;  3LNM B;  3FB8 C;  5E1A C;  3OGC C;  2P9U F;  3ZMU A;  3DXK D;  4XDK A;  3VX8 B;  4ZBM A;  4QNH B;  2XND G;  3ABK B;  3D3I A;  3K06 A;  5CBF A;  4QJF B;  3LSS A;  1M1K W;  1NBM G;  3FB5 C;  4JMF B;  2EIK B;  1M57 C;  2HR3 A;  2PLG A;  3JD1 A;  1XKP B;  1V54 C;  2M7W A;  4MVR A;  1CP9 A;  2KB1 A;  3K0D A;  4QIW F;  2AHY A;  4UVA A;  1VQL V;  1NVP B;  1SES A;  2Q69 A;  3FB7 C;  1R6K A;  3FB6 C;  3GWO A;  1J95 A;  4JGS A;  3RVY A;  1QR8 A;  3X2Q C;  4WFA V;  1LNQ A;  1DTO A;  1S77 D;  1KKD A;  2IH1 C;  4R50 A;  4N21 A;  4ASU G;  1YIT V;  1YTF B;  2WPD G;  3T1C A;  3AG2 B;  5EC1 C;  3CCS V;  3RSE D;  2DQ3 A;  4HAM A;  2EIM C;  2Z5U A;  1SRY A;  4J9Z B;  2ZXW B;  2QKS A;  1NH2 D;  5IYD O;  2V1D A;  1S0V A;  1IXM A;  3DWL D;  3I55 V;  2X0L A;  3BEH A;  1K8K D;  5LHI A;  2K1E A;  1K92 A;  3OR7 C;  3T4Z A;  1V55 C;  1AI6 A;  2UXN A;  3F5W C;  3K0G A;  2ITC C;  5B1A B;  4LC1 A;  3T2M A;  1U2V F;  1AI7 A;  3KXY A;  1Q82 W;  4KP4 A;  2ATK C;  1QCE A;  1JCH A;  3ZRS A;  5IDJ A;  3SPG A;  4XDL A;  1QBZ A;  2XAS A;  4H37 A;  1MOF A;  2DYS C;  4FIP C;  5H9C A;  3CP1 A;  4P9P A;  2DYR B;  2EZP A;  2OT5 A;  2P7T C;  4FPP A;  4GX5 A;  5C93 A;  2W6I G;  1AJQ A;  1YI2 V;  1GK9 A;  4P9O A;  2HG5 C;  1VQP V;  2EIL B;  1M9N A;  3UKU F;  3ZRW A;  5BZB A;  1GO3 F;  3K3W A;  2X6B A;  3MHS C;  3W7U A;  1YHQ V;  4JAS A;  1K5Q A;  5B1B B;  3VBB A;  1L1F A;  1OCR B;  4KFM A;  1PKX A;  1Q81 W;  4PEL A;  5J9P C;  4GF3 A;  3EHB B;  5CBH A;  3IFX A;  1FXV A;  3FYE B;  1BHA A;  2Q6A A;  3RSE F;  1Y4M A;  1RPO A;  3OMN B;  4G2K A;  2P9K D;  4OXS A;  3OUF A;  1VQ5 V;  1CEZ A;  2KC5 A;  3E8B A;  3W7X A;  2CK3 G;  3ZRV A;  4BW5 A;  2D3O W;  2QA4 V;  3ZRW B;  1K6Z A;  2P9S D;  1M56 C;  2P9U D;  2EIN B;  3DWL F;  3W7T A;  2JJ2 G;  3ETE A;  1ORQ C;  4MVS A;  1R3I C;  1YSC A;  1S5H C;  2BSJ A;  3SPI A;  1OCZ B;  5L3B A;  1F51 A;  3E89 A;  4G28 B;  1R3K C;  2XOK G;  2YEV B;  1QR9 A;  2HLD G;  5LGN A;  4FK5 C;  3ABM B;  1NJI W;  4L87 A;  1FXH A;  1P4R A;  2ZR3 A;  2FTK A;  2XGA A;  3P30 A;  3GB7 C;  4JAV A;  1H8E G;  1K3S A;  3CPW U;  1K8A W;  4BAY A;  4WF9 V;  4Z1M G;  2Y69 C;  5EK0 A;  4PDL A;  2UXX A;  3JCZ A;  4MW3 A;  2QEX V;  4P30 A;  3UKR F;  1ENV A;  1N5B A;  1K97 A;  2IJH A;  5EC2 C;  4X8A A;  3I56 V;  3ZCC A;  1I5Y A;  2P9P D;  2P9L D;  1GTO A;  1VQK V;  1K34 A;  1NQT A;  3STL C;  3H01 A;  1DLB A;  3OMI B;  1M57 B;  2DYT A;  2P9K F;  3M99 B;  2IU0 A;  1V54 B;  3RW0 A;  1XL6 A;  3OM3 B;  3CCE V;  4BIU A;  3QNE A;  2XAH A;  3JYC A;  2P9S F;  3E8F A;  1COW G;  1AI5 A;  1RPR A;  2HVJ C;  4UV8 A;  3K04 A;  3E86 A;  4WCE V;  2Z3Y A;  2OTJ V;  5IYB O;  1R73 A;  3LDE A;  3VOU A;  1GKF A;  1U2V D;  4CBC A;  3TK1 A;  3DGE A;  1YJW V;  2P67 A;  2P90 A;  3SPJ A;  1K4D C;  1N8R W;  3ETG A;  4UXN A;  5B1N A;  2OCC C;  3HB3 B;  1JVM A;  3ABT A;  2A0L A;  1Q86 W;  3AG3 B;  4PDM A;  2EIM B;  3OMA B;  2ZR2 A;  1HWY A;  3ZIA G;  2BOC C;  2IU3 A;  1F23 A;  2FM8 A;  3R65 A;  1YJ9 V;  1NKD A;  4QE9 A;  4GSL C;  1OZ0 A;  3UKU D;  1NVP D;  3ASN C;  5H6R A;  3AG4 B;  1RM1 B;  1V55 B;  2MK3 A;  1W0J G;  2HVK C;  3K9A A;  5LBQ A;  1YTF D;  3OR6 C;  3ABU A;  1SER A;  2W0F C;  3DXM F;  1FXK C;  4F4L A;  2DYS B;  2P9P F;  2P9L F;  2JDI G;  1PNM A;  2WLK A;  4MT8 A;  4ZKI A;  4HZ3 A;  1K33 A;  3ZMT A;  2P6J A;  4R6Z A;  3OUS A;  1TYQ D;  1KQS U;  3WG7 C;  3G71 V;  1E79 G;  4MW8 A;  3ML0 A;  3ABL C;  1JJ2 U;  3NXS A;  3ABK C;  4JYB A;  3E35 A;  5HFM A;  1XL4 A;  2NNU A;  2BSH A;  1CPY A;  2LFR A;  2NLJ C;  4JTD B;  5EBL C;  2LFS A;  4U7O A;  1XKP C;  2WLL A;  5LGU A;  1OCC C;  3CXJ A;  1MSW D;  1PD3 A;  5CN0 A;  1BMF G;  1MG1 A;  3RBZ A;  4QPK A;  3F7V C;  2Y48 A;  2GHY A;  2R9R B;  4LBE C;  1AI4 A;  1M56 B;  2JEU A;  2QTO A;  3CCJ V;  4G27 B;  5DM6 V;  3LDC A;  4I5S A;  3UKR D;  3WFV A;  1E1R G;  1OCO B;  1QVF U;  1F4N A;  4JF3 A;  3OAA G;  4QPJ A;  1KP3 A;  2WLL B;  1KD1 W;  2YEV A;  3OW2 U;  4XDJ A;  2ZXW C;  5B3S C;  1JOY A;  3CCM V;  4PA7 A;  3PJS K;  1FS0 G;  2DW4 A;  1EBO A;  5EBW C;  3STZ C;  2B1I A;  2X7R B;  4PA9 A;  4UV9 A;  1DF5 A;  2JK5 C;  4FJC C;  4MVO A;  1TTW A;  3CCV V;  1YIJ V;  4MVM A;  2B5U A;  2JJ1 G;  5B1A C;  1TYQ F;  1S3J A;  5DN6 G;  4G6T A;  4YXW G;  2WWW A;  2Y69 B;  1VQ4 V;  2XAF A;  1H2G A;  1WPX A;  2JEX A;  2GSM B;  1ZWI C;  3CC2 V;  3ETD A;  1K7D A;  5EBM C;  1L2W A;  3A0R A;  2XAJ A;  4WFF A;  4KUM A;  2LP7 A;  2MQD A;  1AR1 B;  4GT1 A;  1PNL A;  4MTX A;  3LSQ A;  2P9I D;  4RUE A;  3ASO B;  2Q67 A;  3BY6 A;  4PDR A;  1GM8 A;  2IJJ A;  4H5B A;  4UVC A;  3IC7 A;  2EIJ B;  2EZO A;  1JYO A;  3EPU A;  1THZ A;  3ZMZ A;  1NR1 A;  2R9I A;  3K03 A;  5CMU A;  5B1B C;  5L3F A;  3OFN G;  1VQ9 V;  2H94 A;  3TU3 A;  2ZD9 A;  1PNK A;  2QM8 A;  1GM7 A;  3D36 A;  3DXM D;  3ZRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...