1K3EA

Type iii secretion chaperone cest
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
141
Chain Sequence
MSSRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLKIEEISS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CesT
publication title Structural and biochemical characterization of the type III secretion chaperones CesT and SigE.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Chaperone
total genus 35
structure length 141
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05932 CesT Tir chaperone protein (CesT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.390 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k3eA01
3.30.1460.10 Alpha Beta 2-Layer Sandwich Yope Regulator; Chain: A, Yope Regulator; Chain: A, 1k3eA02
1RY9A 1XKPC 1TTWA 2BSJA 4AKXA 1JYOA 1N5BA 1JYAA 1K6ZA 1XKPB 3TU3A 1S28A 1L2WA 4G6TA 1K3EA 2BSHA 2BHOA 2PLGA 2XGAA 4JMFB 1K3SA 3CXJA 3EPUA 3KXYA 2FM8A 2BSIA 4GF3A
chains in the Genus database with same CATH superfamily
4XBFA 2QDOA 4JI2B 1K34A 2P06A 3AK3A 1Z2GA 3AG1C 2QA4V 2ETNA 3OMAB 2ADQB 4QE9A 4YJ2A 2PLGA 5EZYB 3K79A 1Q86W 1V55C 2CTWA 3HKBB 3P3PA 1YF2A 3RVZA 4A5UB 4DR4O 1XKPC 1TTWA 4CS3A 4I4TA 2B5UA 3L75H 3ZX6A 4LF4B 2UXBO 3HKDA 1YEWA 5KX5B 1VF7A 4J42A 2VQFB 4LFBO 5JH7B 4FZ1A 1KKDA 5IYCO 4GSLC 2E75B 1TGOA 2QEXV 4X66B 1PL0A 5H6QA 2P9SD 3K06A 4MW3A 3CCSV 1JCHA 3RSEF 2FMLA 3CXHF 5KA5A 2ZDIA 5IY5C 2LP7A 1O9GA 1OCOC 2WLIA 2FB5A 4GKJO 5EC1C 5KHHA 2ZIOA 2UU9O 2FYUH 4NVPA 3CC2V 5HFMA 2MK3A 3OTFA 4JYAB 4GUNA 1BQ0A 2WLJA 5LA6B 1SA0A 4HBNA 1G8MA 4AKXA 2ZNJA 3K9SA 2PGGA 4WF9V 1PM9A 3W7WA 1VQ9V 5BXZA 1U2VF 2ZR2A 3HKCB 3K5LA 3C3SA 5C8YA 1VQLV 1S72V 4K8XA 1I08A 2Y48A 3SJCC 3ZEDA 2OCHA 4B3MO 2CTRA 1SKVA 3CWBH 3K5MA 4DR3O 4DR1O 2VRZA 3R65A 4UV9A 1NQTA 5D5QA 3CCMV 3IAYA 1P7BA 1KB9F 3RBZA 2E76B 4O4HB 2BSKA 1MSWD 4YHHB 5LP6C 3RYCA 4X1YA 4JD2D 4E4EA 4FZ0A 3H1LH 3OD4A 4LFAO 1QBZA 4Q6GA 1KBHA 1IBMO 4QJFB 2PTMA 3ETGA 4KUMA 1AJPA 3JASA 4K0KB 3G6EV 4OPHA 3E8BA 3K9AA 1DTOA 1TUBA 3B40A 3QO8A 1HP8A 4PA3A 4JI3B 4GKKB 1QVFU 3CHXA 3B8NA 2R9IA 1I5YA 1F4MA 2QM8A 3L71H 2UUBO 2P90A 3ZHRA 5H5NA 1AR1B 4OX9B 1EZVH 2QWPB 3P3NA 2UUCB 1HNWB 4XEID 4ASUG 2DJVA 3EVKA 1TYQF 4JV5B 2HJDA 2F66C 4YIPA 2NNUA 1KKCA 4CS4A 1KMIZ 2HJFC 4CC6A 1QCEA 3UKMA 4FLVA 5B1OA 1W59A 1Y76B 3BCCH 3ULED 5LMUB 1Y74B 1N8RW 1GN4A 4AQYO 4GLXA 1FS0G 2JS3A 3LDCA 4FPPA 2P9ID 3N2GB 5CA3A 4ZOLB 5KHJA 4UCUA 3AK2A 5LXTB 2IH3C 2ZNIA 2PF4E 1OJHA 1S5HC 1XBLA 4WFBV 3JD3A 4LF4O 4HYOA 3T4ZA 3ASNC 1MA1A 4NXNB 4LBEC 1M57B 5FPRA 4FK5C 1JYAA 2JS5A 2PI4A 1ZUQA 2W0FC 4JI4B 2EZOA 3UQ8A 4X66O 1FFXA 3H01A 4DV4O 2EJ7A 2OIGA 2BTQA 4X88A 2YS8A 4IL6Z 4LF8B 3VX7B 3SPGA 2Q9LA 1EN4A 4BIUA 2HLDG 4ZI7A 4EKWA 1N33B 3D36A 3B2EE 1OHHG 3T2MA 4DV2O 1MG1A 3BA9A 5CBHA 5CN0A 4BW5A 3KKYA 5BR8B 3G80A 4U3JA 2IH1C 1JPXA 4MVZA 2PY5A 1O9HA 4JYAO 3UKRF 3TXQA 4LF5B 2LGQA 2A79B 2JIZG 3DXKF 3Q4HB 2RCVA 1YCIA 4K35A 3QO7A 4DUZO 5B1AB 1A32A 1RPOA 1QQCA 1AI4A 1K3EA 4DRXA 1UJWB 1VQNV 3IJ4A 3OMNB 3E35A 1B06A 2KSDA 5IWAB 3APOA 3FB5C 4P9PA 1I94B 3ZRWB 4PA6A 1GH6A 2G38A 2PUSA 3U10A 2Q7GA 2ZM6B 3RSED 3SYPA 3TJTA 1EN5A 4NYKA 3OT7A 2YIBD 4D6TH 1M1KW 2A0LA 3P32A 4P2ZA 3JD4A 3AEIA 1Q90D 1XNRB 1K3SA 2YICA 4LNUA 3EPUA 3SPIA 2LJ2A 1N32B 3ZHSA 1OZ0A 1FXKA 1VARA 5IYZA 4U7OA 2OD0A 2UXNA 4J10A 4PA4A 2DYRB 1DK1A 3CRAA 4PDRA 4UVCA 1U2VD 3K57A 4EFEA 1K8KF 1JMKC 3A0BZ 2AHZA 1R3LC 3UM7A 5LYJB 4LH7A 4P9OA 2YEVB 2ZD9A 1R6TA 2BOCC 4X64B 4JI8O 4IIJB 1QR9A 2GDSA 3UT5A 1WP7A 3WG7B 5GONB 4GKKO 1GM8A 3FAVA 2EINB 4KL1A 1QLNA 2N05A 2JEUA 4IT5A 1JFFA 3N2KB 2UXBB 1B04A 4O4LB 4W4KA 1IXBA 4O2AA 4X20B 4MVSA 4OX9O 3LUTB 3X2QB 5KHKA 1XMQB 4GCZA 1H8EG 2QTOA 3NXSA 1XI1A 2UUCO 1HNWO 5EBWC 5EBLC 3H9VA 2HHHB 3UKUF 1W0KG 5FNVB 2CH7B 2AZ0A 3E86A 2KG7B 4BIOA 2QM7A 5H6RA 1MZEA 2GBOA 1TVKB 1AP6A 3T4DA 4JV5O 5LHIA 1BT8A 4GKJB 2GUZA 4MTOA 4F4LA 2W0XA 4TSFG 4EB6B 1YTFD 1NJIW 4I50B 2UXDO 1FFTB 5CBFA 3DXMF 4NR1A 1VQOV 4O2BB 1R6KA 2B1IA 4IHJA 5L3DA 2PYLA 5LMUO 4DV6B 1HNXB 3EXAA 1KECA 5GTHZ 1JQ0A 4B7EA 2PI5A 5KMGA 1BQZA 1ZL8B 3JALB 2NLJC 4XDLA 3AG1B 4JI1O 3RGBA 2ZE8A 2DWEC 4TT3G 1NVPB 5K1PA 4YIOA 3AK1A 2R9AA 3ZBHA 1V55B 4DR1B 4FFKA 4LF6O 2Q6AA 2QWRB 2JVDA 3ZHTA 5DN6G 2XHBA 4NXNO 1K6ZA 1XKPB 4JI4O 3UO2A 4G6TA 4J7JA 3FB8C 4LF8O 3JSLA 3ABMB 2DYRC 3DGEA 5EYPA 3JAKB 1YSCA 1IXMA 1LNQA 2K9PA 1UPGA 1BS3A 1N33O 2RNBA 1Y67A 4FVMA 4I0XB 2P5OA 3FYEB 1SQPH 3UCSC 1AROP 4DR5B 1P4RA 3H1JH 5BR8O 4MTGA 1IBMB 3WG7C 2B1GA 5LBQA 1MOFA 2EINC 3ABUA 5BMVB 1OCOB 4TQFA 4G27B 2QSAA 2F4VB 1DF4A 1R3IC 1PNMA 2KB1A 4FMTA 1D2DA 3HKEB 5CA0A 4TUYA 3SJBC 3LNNA 3X2QC 2YXLA 4RUEA 1WNSA 2EULA 1BCCH 4MTFA 2R9RB 3ASOB 3J7AU 2UUBB 1XQ8A 1XHXA 1JVMA 1I94O 2QKSA 4FLTA 4TV8A 4UUJC 3L9DA 4TV9A 1H2MA 4L8JA 4R7CA 2DQ0A 2ZM6O 4JI7B 3VX8B 1AVMA 2BSJA 1NBMG 1K4DC 3CD6V 4JAUA 1VF6A 2XNDG 2F1MA 4J7ZA 4JI6B 3DSQA 1AJNA 3E2EA 3LDEA 2Q5ZA 3SYAA 5KLVH 4X89A 2CAZC 1S0VA 4XDKA 1HWYA 3UKRD 3WB1A 1N32O 4PJ0Z 2MQDA 1NTZH 4O4JA 4JTAB 1YTFB 3ZMZA 1RSOA 5HFLA 5LP6B 2PZSA 1GAXA 2KC5A 1U96A 3JAWB 2JGDB 2IU3A 3BAAA 1JR9A 3G6BA 2QJ1A 4HZ3A 3P30A 3RYHB 4AQYB 4Z2WA 4TQDA 1BGYH 4UB8Z 1EN6A 1RFYA 1Z5VA 3FFQA 4PV1B 3W7SA 3QO5A 4X64O 1SZTA 2ITDC 3OM3B 5EC2C 3ABKB 4LWSB 3GVMA 3RT3C 3ZHUA 5IJ0B 1D5AA 1XREA 1CEZA 2BOBC 2WAMA 3ABMC 3DTUB 1KP3A 3ABLC 3OE7G 4O4IA 1AR4A 4UB6Z 4JI0B 1XMQO 3ZJZA 4DV4B 1K8AW 1S76D 2WLLA 2HHHO 2WLHA 3STLC 3C90A 3CEIA 2Q67A 3S3WA 3AG4C 2UXCB 2P4VA 2WLKA 4GT1A 4UCOA 3IFXA 5CA1B 3OW2U 2AXTZ 1Q6HA 4DV2B 3QF7A 5IYBO 5B66Z 1K8KD 4JZ2A 3BHPA 4D7TA 2HP8A 3E22A 2WA3A 1J5EB 4X8AA 5LOVB 2Z5UA 1L8DA 3K04A 3U0ZA 2JJ1G 5KHIA 1PL4A 2KKWA 1U97A 1WPXA 2QE7G 4X1KA 5C93A 4NXMB 4DV6O 3FB6C 1HNXO 1JYOA 3ASOC 3AG2B 4DUZB 1FPOA 4WBNB 2Y4UA 3FD9A 4YY3B 2XUMA 3IC9A 1M56C 1IBKO 1EFRG 2XAFA 4MVRA 4GX2A 4U3FH 2ZDIC 1P84F 3UKUD 1IBLO 1YITV 1JA8A 4FJCC 2YIAA 1ZAUA 3BABA 1LUWA 4G28B 5EZYA 2CDYA 4UCTA 3HKBA 1DF5A 5F2VO 3DXMD 3ASNB 1D5NA 4WFFA 3LSQA 4KFMA 3RYFB 5KX5A 5JH7A 3FB7C 5A9GA 4JZGA 4I9QA 3JD1A 4RO2A 5ITZB 3FKSG 3MHHC 4DR5O 1F23A 3CSXA 3ABKC 1YJNV 1PKXA 1I0HA 3I55V 4WFHA 2WSSG 1QLEB 1Q43A 2F4VO 1XL6A 2ZQMA 2V7QG 1SS3A 3B09A 4LR3A 1WB8A 1K5SA 4JI8B 4X65B 3ZMTA 2WPDG 1K97A 3KZIZ 4JPRA 2V4DA 2ZIMA 2W6IG 1VQKV 3SDLA 2LW7A 1Q5OA 3DC5A 3OR7C 4CC5A 4H44B 5LA6A 4I55B 4DO2A 4JI7O 4RAIA 2V1DA 1W0JG 4ZI7B 1B3QA 5JJJB 5CB4B 3HKCA 4JI6O 1FYJA 2DWDC 4MS2A 2P9LD 4DK0A 4J80A 2CTQA 2DYTA 1P7GA 3T1HO 5L3BA 4D7SA 3N27A 5L3CA 5LHHA 2XAGA 1H2NA 1QU7A 3R66A 4K8ZA 1E79G 1GN2A 2UXDB 3AG2C 4FFBB 1R6NA 2HKOA 2IJIA 1PD3A 1F51A 4RWUA 3C3TA 1K73W 5LHGA 4UCSA 4O4HA 4BAYA 1Q7YW 1NU1H 3OAAG 1SETA 5KHGA 3MHSC 2BSIA 2KQXA 4ZHQB 3JD0A 4JI1B 1S5JA 5DEDA 1G6UA 1BHBA 4ZBMA 3SR2C 5IDJA 1N5BA 5A2QN 2DQ3A 4DYLA 4LF6B 3CRMA 4X1IB 4F6RB 4PD4F 4JI0O 3ETEA 1IVSA 3AG3B 2L6LA 5LMNB 1YZBA 5FPOA 3OGIB 2UXCO 2M6YA 3EFFK 1NH2B 3M99B 4XDJA 3H1IH 2N74A 2ARHA 4N21A 3M8AA 1QLEC 1S28A 5JWPA 1ZSPA 1J5EO 3F7YC 4UVAA 3KXYA 1YDXA 2LGWA 2EIMC 2Z0AA 3ZIAG 2F93B 2OCCB 2XAQA 2A7WA 4MW8A 4NXMO 1Z5WA 1NI8A 2GHYA 1WAZA 4G2KA 3BA8A 3BPZA 4YY3O 1UFIA 3WB2A 4UFZA 1QR8A 1SF9A 1XEQA 1NVPD 3CCLV 1E1RG 3DXRB 3CMEV 1XHZA 1Y76A 2Q4PA 4ICGA 1Y74A 1FXVA 3BFRA 5L3GA 2CE4A 2A3QA 2IM9A 4DR7O 3K5NA 4GX5A 3F5WC 5AG2A 3B8MA 2NR5A 3D8CA 3N2GA 1N0JA 3ZMUA 4ZOLA 1NZ6A 1T5EA 5EK0A 1N34B 1FJGB 3OMIB 4J7KA 5LXTA 2ZE6A 1AILA 1ZX3A 1L0NH 2A06H 2Q7HA 3OTOB 1R3KC 4JTDB 1XOUA 3WFVA 1SQQH 2A9HA 2QKAA 4LH6A 4UCRA 1YI2V 3K03A 4FLWA 2EZPA 2DYSB 4RQEA 1AB3A 1ZTEA 4EBRA 3T1YB 4JAVA 4FM0A 3A0HZ 2CGNA 4DV0B 4CS2A 2P9SF 1PNLA 1CXZB 4X65O 2HFEC 3SJQC 3LNMB 4DUYB 1I5XA 3AG3C 2X6BA 4HNAB 3CCVV 4B3RO 4DV7B 5L3FA 3CJHB 5IE9A 2Z3YA 2ITCC 3SPHA 2X6AA 1K9MW 5IT9N 4TWKA 1K92A 1AI5A 2ZE5A 4GZRB 4KXRA 5JVDB 4JAAA 4W4LA 1WLEA 5EIBC 3JARB 2OCCC 2XAHA 1BZKA 3A8TA 4PELA 2QGNA 1YVWA 3KCYA 3ZRWA 2H8PC 3MAQA 2P22C 3SJAC 5JCOC 1RY9A 4FLUA 1NTMH 2HEPA 1G1XB 1ZLZA 1VEWA 3RYIB 3JD2A 2OTLV 4RQFA 1L2WA 1COWG 3CP1A 1Y6XA 3K59A 1KYOF 5IJ9B 4PDVA 1IBKB 3HR0A 4B3SO 5J2UB 4JI5O 1FAFA 1AI7A 4LF7B 2L35A 2M7WA 3LSSA 1SQFA 2VWKA 3W7XA 1IBLB 4LF9B 4HAMA 2JDIG 3JATB 5J2TB 4IYIA 3BY6A 4AHCA 1TYQD 5LYJA 3OR6C 1FD9A 2YEVA 2WLNA 4IYHA 2YI9A 2XTAA 1SQBH 1WA8B 2QKCA 4QIWF 5LMNO 4IIJA 1VIBA 2DYSC 3OUSA 5GONA 3ABLB 2H3OA 4YJ3B 1S5LZ 3IGAC 1SERA 3CRCA 1M93A 3N2KA 2P4KA 2JK5C 4O4LA 2EBOA 3KG2A 3VQVA 1TUEB 4X20A 3AG4B 4WFGA 1K4CC 4JASA 1Y4MA 2F43G 4YJ2B 3K5OA 4X62O 3RVYA 1Q8IA 4ZKIA 4UCVA 5FNVA 2CH7A 1H2LA 1BE3H 2KG7A 4XEIF 3ETQA 2JEXA 2QWOB 1BHAA 5KAFZ 3ZN0A 4CH6A 1TVKA 4NB5A 4I4TB 4JTCB 1H2SB 3HKDB 2E5LO 1JX9A 1XMOB 3CRQA 4OXSA 4H0LB 3BRCA 2P9PF 4EB6A 2BHOA 3JYCA 1XNQB 4I50A 4P30A 1VQ8V 5JJNB 5B3SC 1G4YB 2AW9A 4O2BA 5KUMA 2YSUB 4BW9A 1NS1A 2X7RB 1M56B 2ZCEA 1YIJV 2HG5C 4UV8A 3QNEA 1JOYA 5FL7G 1ZL8A 3JALA 2WLIB 1AI6A 2YI8A 2Q7EA 1DGSA 2Q73A 3PJSK 1PV0A 1N34O 3T1HB 3VQWA 1FJGO 4PDMA 1HNZB 2Q69A 1V54B 2AGAA 3G67A 4C7UA 2D2CB 1I7FA 1NR1A 3OTOO 1ENVA 2RN9A 3TGUH 1H2KA 1IURA 4CH3A 1SA0B 5B1NA 3DXKD 3B77A 3CCJV 2VWJA 1SESA 1BSMA 1QNMA 2P9UF 1KU9A 2P9KF 4OPAA 4PDLA 1KP2A 2HVKC 2Y0PA 3T1YO 4LCUC 2YIBA 1VP7A 5C8YB 3L72H 1NTKH 4DV0O 1AJQA 4AILC 3JAKA 1X4TA 3CPWU 4DUYO 4I0XA 2VS0A 3TXSA 2C2AA 5B1BB 1GRJA 4GYCB 4J11A 2UUAO 4B3TB 1CPYA 4WCEV 4DV7O 3E8GA 1AP5A 2BCCH 1DLBA 5B5EZ 5BMVA 1US6A 2QR4A 2BSKB 3RYCB 4X1YB 4Z1MG 4PA7A 3H1HH 3HKEA 3GWKC 2Q68A 5BZBA 3SGIA 4DV3B 3QTCA 2Y4TA 1B6QA 4MVUA 2W6JG 4Z1VA 3DC6A 3JASB 4MVOA 2FM8A 2EX3A 3LSUA 4FLXA 5L3EA 4DV1B 3TK1A 1TUBB 3WU2Z 1TA8A 3E8HA 3ZMSA 4LFCB 5JQGA 1NKDA 3ZRVA 2WWWA 4F6EA 1N36O 4EFBA 2H94A 2EIJB 1Y66A 4CZZA 4I7ZB 1MNGA 3JSNA 4FIPC 3CXJA 1VQ7V 2P9NF 1HDJA 3S3XA 3CCQV 4LF7O 1VQ4V 4RUFA 2DE0X 5LP6A 1F4NA 2QTSA 3JAWA 4NTWA 2JGDA 4LF9O 1M4UA 1FKAO 1V54C 3RYHA 4DR7B 3B4SA 1OCZC 4R8CA 1SQGA 3CE2A 4JMFB 2F23A 3ZRSA 1URFA 1NH2D 3VOUA 2RJZA 2Q0AA 1SC5B 4LWSA 4MVQA 1KUQA 3W7TA 3VQYA 3ZHVA 5IJ0A 4KHPO 3E8FA 2EILB 3CCUV 2XOKG 1M5IA 2ZXWB 1GKFA 5EIBD 2XT9A 1F7YA 5B1BC 3RWRD 5JJEB 3D3IA 1VQMV 4QPKA 2LFRA 4K3AA 3GWOA 3SPJA 1BL8A 5CA1A 3H1KH 3QVNA 4CH5A 2EIMB 2ILMA 1E1QG 4QE7A 1XMOO 3JCZA 4TOIA 3J81N 1L0LH 4B3RB 1ROPA 1XNQO 2K1EA 4MVMA 5LOVA 1FFXB 1ZWIC 2IJHA 2BTQB 2IU0A 1WJZA 5D5PA 1BMFG 1QHTA 4WBNA 4MTXA 5GW7A 2DMXA 2RDCA 1IZ3A 4BIZA 1VQPV 2D3OW 3ZN1A 1HNZO 2ODMA 4U3JB 3OGCC 1FXHA 1VQ5V 4CH4A 3T1CA 1HR0B 3A2FA 3TCUA 3EHBB 2EIJC 2CTPA 4Q20A 1VF5B 3WB0A 1IDSA 3CXCU 2P9PD 4CBCA 1OCCB 1TAEA 2CK3G 4PI2A 4DRXB 2GV9A 2BTOA 1WN7A 4DR2B 1WP8A 2QWNB 4EEQA 2N04A 1GO3F 1KC8W 4JI2O 4B3SB 5KA6A 3RYFA 4JI5B 4B08A 2AZ2A 2R70A 3NR7A 3CYOA 4B3TO 5ITZA 1R1BA 3STZC 5E79Z 2LFSA 3OEHG 4FLZA 1IX9A 1XL4A 2P67A 3BVOA 1M9NA 2EILC 4LNUB 2R72A 4JYCA 3CX5F 2Q8VA 2ZXWC 3K08A 5TISZ 4GX0A 4JYYA 4DV3O 3UO3A 1FXKB 1H2GA 2VQFO 5IYZB 2P9UD 5E1AC 3SPCA 2P9KD 1VQ6V 1H8HG 2GTAA 3TU3A 2JRIA 2RMKB 1WPBA 2P6JA 2MW2B 2Y0IA 1GM9A 1LR1A 3LDDA 1AR5A 4I55A 4X62B 2ZINA 4DV1O 3HPLC 1Q82W 1S77D 4R6ZA 5LL6Y 1HW7A 3UT5B 1WB7A 4NTYA 1RM1B 5CB4A 3FAVB 4LFCO 3DWLF 1JFFB 2DOSA 2QWQB 3J80N 3FYIB 1Q81W 3I5DA 4DK1A 1EZJA 4JYBA 2E5LB 4QNHB 2XGAA 4H33A 3TETA 4O2AB 4R50A 1SQXH 5LGNA 1CP9A 3OUFA 3F5TA 1GN6A 4FFBA 3SYCA 3D36C 3BEHA 3CB2A 5LGTA 3ZS8C 3VBBA 3HB3B 2YC0A 4FM2A 2FTKA 3RW0A 5FLXN 1EM1A 1GTOA 4BWAA 2GSMB 4UVBA 5KUKA 4DR6B 2EJRA 4J9ZB 2GUZB 4FM1A 1VMGA 4ZHQA 3ZMVA 1W2BU 2Y69B 3APQA 3F7VC 2BE3A 3L70H 1PPJH 2IJJA 4WFAV 1M90W 1OCCC 5KAIZ 2GTSA 4IHJB 2VQEB 4BR6A 5DM6V 4X1IA 4F6RA 4QGPA 5KMGB 4YHHO 4WFEA 5H2FZ 3CC4V 2LO1A 2P9ND 2LPUA 3IC7A 4DV5B 1PP9H 1YXBA 3ZCCA 2O57A 1K7DA 3RFRA 2OYQA 2RQ6A 3CC7V 1MMMA 3K0DA 2UUAB 4FLYA 2B9ZA 2CUGA 4E2LA 1SZXA 4K0KO 1OCRB 2X0LA 1Q3EA 3ETDA 4MT8A 1FXKC 1MSDA 2EIKB 2HVJC 1M57C 4DR4B 1ORQC 4JI3O 5EYPB 3Q4HA 1OV9A 1JJOA 3JCUZ 1EBOA 3CRRA 5JCOA 3ICXA 4UXNA 4LFBB 5B3SB 2BSHA 3CS5A 2E74B 4I9WA 3DXRA 3CCEV 1RM1C 4J9YB 4X9QA 1HR0O 1X59A 1SRYA 4GX1A 4PI0A 5GTIZ 3QG5A 1JJ2U 3K3WA 3KCXA 4JGSA 5CA0B 1J95A 4TUYB 4LC1A 4ZIBA 4DW1A 2FL4A 2F95B 1KQSU 3ZHQA 2QM4A 3THOA 1YHQV 1N36B 1MZFA 3RN4A 1NT2B 1KD1W 4DR2O 2UU9B 3MD0A 4JD2F 2YDEA 5B1AC 4TV8B 5DECA 4TV9B 1Q6IA 1R73A 2XAJA 3O9OA 1NR7A 3OFNG 2ATKC 2IW5A 1H38A 5CMUA 1GMGA 2Q0OC 5IYDO 2Y69C 3ZRXA 4H5BA 2LQTA 4PA9A 4H37A 3I56V 2E3CA 4IGGA 1XDCA 4B3MB 3E83A 4NTXA 2YXYA 2P7TC 2X6CA 4KP4A 4DR3B 4O4JB 1L1FA 3JAMN 4HNAA 3K58A 1RSOB 1SQVH 4KHPB 3ML0A 2FKXA 2ZR3A 4MSWC 2PYJA 4I5SA 1V9PA 1K33A 3CJHA 1S3JA 3M7MX 4ABMA 3SYQA 4PHZA 5K1XA 2ADPA 2ZT9B 1THZA 5EBMC 2DN9A 5CBGA 1XUQA 5JVDA 3L73H 2CGOA 2AHYA 1OCRC 4LFAB 3CMAV 3U11A 3JARA 2ZE7A 2EIKC 3VQXA 2P9LF 3MDSA 1N0NA 1YJ9V 4DXWA 1P49A 4O4IB 3K0GA 5IY5B 1RP3B 3OEEG 2YUAA 3FX7A 2ZKOA 4H13B 3GB7C 4DW0A 1R3JC 4LF5O 2LW1A 4B7KA 4GF3A 1RPRA 4NKGB 5BY1A 3W7UA 2UXXA 1K5QA 2IJKA 2WLLB 3A0RA 5LGUA 4LP8A 3RYIA 2WLMA 3ULEF 4QPJA 3CCRV 1LUVA 3E89A 3L74H 4U7NA 4OGQB 1GM7A 3ABTA 1N4CA 4YXWG 4DR6O 2NN4A 4N23A 5IJ9A 5IWAO 2YXHA 2P9IF 2WA4A 3O65A 1XILA 2JGUA 3E22B 2YIDA 5J2UA 3G4SV 2OWOA 1OCZB 3PN1A 5J9PC 4J41A 1MABG 2XASA 4JF3A 1GN3A 1Q6UA 2OTJV 4X1KB 3JATA 2VQEO 2DW4A 1PNKA 3DWLD 5J2TA 2OT5A 5JQGB 1GK9A 4L87A 3AG7A 1XNRO 2JJ2G 5H9CA 2OIEA 1WA8A 1QVGU 1YJWV 2IBZH 3D3QA 2HR3A 3G71V 3SYOA 4AI8A 4DV5O 1VF6C 4YJ3A
chains in the Genus database with same CATH topology
4XBFA 2LFRA 1VQOV 3GWOA 1R6KA 3SPJA 1BL8A 1K34A 2B1IA 5L3DA 1KECA 2EIMB 2GHYA 3AG1C 2QA4V 1E1QG 4QE7A 1JQ0A 4G2KA 3JCZA 2PI5A 3OMAB 4QE9A 2PLGA 1ROPA 1QR8A 2NLJC 4XDLA 3K79A 1Q86W 2K1EA 4MVMA 1NVPD 3AG1B 3CCLV 1E1RG 1V55C 1ZWIC 2IJHA 3RVZA 3CMEV 2IU0A 2DWEC 4TT3G 1XKPC 1TTWA 1NVPB 1BMFG 1FXVA 5L3GA 2B5UA 1V55B 2Q6AA 4MTXA 4GX5A 5GW7A 5DN6G 1KKDA 4QPKA 3F5WC 5IYCO 1K6ZA 3B8MA 1XKPB 4GSLC 4BIZA 1VQPV 4G6TA 3FB8C 3ZMUA 2D3OW 3ZN1A 5EK0A 2QEXV 1PL0A 3OMIB 3OGCC 3ABMB 5H6QA 2DYRC 1FXHA 2P9SD 3DGEA 1VQ5V 3T1CA 1R3KC 4JTDB 1YSCA 3K06A 3WFVA 1IXMA 1LNQA 2A9HA 4MW3A 3EHBB 3TCUA 3CCSV 1JCHA 1YI2V 3RSEF 2EIJC 3K03A 5KA5A 2EZPA 2DYSB 2ZDIA 5IY5C 4Q20A 2LP7A 3FYEB 1OCOC 4RQEA 3CXCU 2WLIA 2P9PD 5EC1C 1AROP 4CBCA 1P4RA 4EBRA 4MTGA 1OCCB 3WG7C 2CK3G 4JAVA 2B1GA 3CC2V 5LBQA 1MOFA 2EINC 3ABUA 5HFMA 1OCOB 2MK3A 2P9SF 4G27B 2WLJA 1DF4A 1GO3F 1R3IC 1PNMA 1KC8W 1PNLA 2KB1A 5KA6A 1G8MA 2HFEC 3SJQC 4FMTA 3LNMB 1I5XA 4AKXA 4WF9V 3CYOA 3AG3C 2X6BA 3W7WA 3CCVV 1VQ9V 3X2QC 1U2VF 3STZC 4RUEA 2ZR2A 5L3FA 2LFSA 4MTFA 1VQLV 2R9RB 2Z3YA 3ASOB 1S72V 2ITCC 3OEHG 3SPHA 2X6AA 1XL4A 1JVMA 2P67A 2QKSA 1M9NA 2EILC 2Y48A 4UUJC 1K9MW 4R7CA 4TWKA 1AI5A 1K92A 4JYCA 2DQ0A 3VX8B 3K08A 2ZXWC 4GX0A 2BSJA 1NBMG 1FXKB 1K4DC 3CD6V 4JAUA 1H2GA 2XNDG 3R65A 2P9UD 4UV9A 5E1AC 1NQTA 3SPCA 2P9KD 1VQ6V 1H8HG 1WLEA 3CCMV 1AJNA 2OCCC 3E2EA 1P7BA 3LDEA 3SYAA 3TU3A 2XAHA 3RBZA 4X89A 2P6JA 1MSWD 4PELA 1S0VA 4JD2D 1GM9A 4XDKA 1HWYA 3ZRWA 3UKRD 3LDDA 2H8PC 2MQDA 3HPLC 1Q82W 1RY9A 1S77D 4JTAB 4R6ZA 1YTFB 3ZMZA 1RM1B 5HFLA 2KC5A 2IU3A 1QBZA 3DWLF 3JD2A 4HZ3A 3FYIB 3P30A 1Q81W 2OTLV 4QJFB 1EZJA 4JYBA 4RQFA 1L2WA 1COWG 3ETGA 4QNHB 3CP1A 4KUMA 2XGAA 1AJPA 4H33A 3TETA 4R50A 3W7SA 3G6EV 5LGNA 3QO5A 1CP9A 3OUFA 4PDVA 1SZTA 3E8BA 1DTOA 2ITDC 3K9AA 3OM3B 3SYCA 5EC2C 1AI7A 3QO8A 3ABKB 3BEHA 5LGTA 2M7WA 3LSSA 3VBBA 4PA3A 3HB3B 3W7XA 4HAMA 2JDIG 1QVFU 2FTKA 3RW0A 1CEZA 2BOBC 2WAMA 3B8NA 3ABMC 3DTUB 3BY6A 1GTOA 1KP3A 2R9IA 1TYQD 3ABLC 3OE7G 3OR6C 1I5YA 1F4MA 2GSMB 2QM8A 2YEVA 4UVBA 5KUKA 2WLNA 2P90A 2EJRA 4J9ZB 1AR1B 3ZJZA 4QIWF 1K8AW 2DYSC 3ZMVA 3OUSA 2Y69B 1W2BU 1S76D 2WLLA 3F7VC 2WLHA 3STLC 3ABLB 2Q67A 3AG4C 4XEID 3IGAC 2IJJA 4ASUG 1SERA 2WLKA 4WFAV 1M90W 1OCCC 4GT1A 3IFXA 3OW2U 2JK5C 5DM6V 2EBOA 5IYBO 1K8KD 3KG2A 1TUEB 1TYQF 3AG4B 4WFGA 1K4CC 4JASA 2NNUA 1Y4MA 2F43G 4WFEA 3RVYA 3CC4V 4X8AA 2P9ND 2HJFC 2LPUA 3IC7A 4ZKIA 2Z5UA 1QCEA 3K04A 2JJ1G 3UKMA 5B1OA 1WPXA 4XEIF 2QE7G 2JEXA 5C93A 3ZCCA 1BHAA 3ZN0A 3FB6C 3ULED 1K7DA 1JYOA 1N8RW 3ASOC 4JTCB 3CC7V 3AG2B 3K0DA 1JX9A 4OXSA 1FS0G 3LDCA 2P9PF 4E2LA 4FPPA 1OCRB 2BHOA 2P9ID 2X0LA 3ETDA 3JYCA 5CA3A 1M56C 4MT8A 1EFRG 1FXKC 2XAFA 2EIKB 4P30A 2HVJC 4MVRA 1VQ8V 4GX2A 5B3SC 1G4YB 2IH3C 2ZDIC 1M57C 3UKUD 1ORQC 5KUMA 2YSUB 1S5HC 4WFBV 2X7RB 1YITV 3JD3A 1M56B 4FJCC 4HYOA 1YIJV 1EBOA 2HG5C 4UV8A 3T4ZA 3QNEA 4UXNA 3ASNC 5B3SB 1JOYA 1JYAA 4LBEC 1M57B 4G28B 4FK5C 5FL7G 2PI4A 2WLIB 1AI6A 2W0FC 3PJSK 2BSHA 2EZOA 4PDMA 3H01A 2Q69A 1V54B 4I9WA 1DF5A 3CCEV 1RM1C 4J9YB 4X88A 3DXMD 1NR1A 3ASNB 3VX7B 3SPGA 1ENVA 4BIUA 1SRYA 2HLDG 4GX1A 4WFFA 5B1NA 1JJ2U 3LSQA 3DXKD 3K3WA 4KFMA 3B77A 4EKWA 3CCJV 4JGSA 1SESA 3D36A 1OHHG 3FB7C 3T2MA 1J95A 1MG1A 4LC1A 5CBHA 2P9UF 3JD1A 4RO2A 2P9KF 3FKSG 3MHHC 5CN0A 4BW5A 1F23A 4PDLA 1KQSU 1KP2A 2HVKC 1YHQV 3ABKC 4LCUC 1YJNV 1PKXA 3I55V 1KD1W 2IH1C 1AJQA 1JPXA 4MVZA 3MD0A 4WFHA 2WSSG 4JD2F 1QLEB 3UKRF 5B1AC 1XL6A 2ZQMA 2V7QG 1K5SA 1R73A 2A79B 3CPWU 2JIZG 3DXKF 3ZMTA 2C2AA 2XAJA 1NR7A 5B1BB 3OFNG 2WPDG 2ATKC 2IW5A 3QO7A 1K97A 5B1AB 1H38A 4JPRA 1CPYA 1RPOA 5CMUA 4WCEV 1GMGA 5IYDO 1AI4A 2W6IG 2Y69C 3E8GA 3ZRXA 1VQKV 4H5BA 1K3EA 1UJWB 1DLBA 4PA9A 4H37A 3I56V 3OMNB 1VQNV 3E35A 3OR7C 3FB5C 4P9PA 4Z1MG 4PA7A 3ZRWB 4PA6A 4DO2A 4RAIA 3E83A 2V1DA 2Q68A 5BZBA 3RSED 1W0JG 2P7TC 2X6CA 4KP4A 3SYPA 1L1FA 3ML0A 2ZR3A 4MSWC 2DWDC 4I5SA 2A0LA 1M1KW 1K33A 3P32A 4MS2A 2P9LD 1S3JA 4P2ZA 2DYTA 1B6QA 3JD4A 4MVUA 5L3BA 2W6JG 3AEIA 3SYQA 1K3SA 5L3CA 5LHHA 3EPUA 2XAGA 4MVOA 2FM8A 1E79G 1THZA 5EBMC 3SPIA 3AG2C 5L3EA 3TK1A 1OZ0A 1FXKA 5CBGA 1R6NA 2HKOA 4U7OA 2IJIA 1PD3A 2AHYA 2UXNA 1OCRC 4PA4A 2DYRB 1F51A 3E8HA 4PDRA 4UVCA 3ZMSA 3CMAV 1K73W 1U2VD 5LHGA 1NKDA 3ZRVA 2WWWA 2EIKC 2P9LF 1K8KF 1YJ9V 4DXWA 2H94A 2EIJB 1Y66A 2AHZA 1R3LC 3UM7A 4BAYA 4CZZA 1Q7YW 4FIPC 3OAAG 1SETA 3K0GA 5IY5B 3CXJA 1VQ7V 4P9OA 2YEVB 2ZD9A 3OEEG 3MHSC 2P9NF 3GB7C 1R3JC 3CCQV 2BSIA 2BOCC 4GF3A 1VQ4V 4RUFA 1RPRA 3JD0A 1QR9A 3W7UA 2UXXA 1K5QA 2IJKA 3WG7B 2WLLB 3A0RA 5LGUA 1F4NA 1BHBA 1GM8A 2EINB 1QLNA 4LP8A 4ZBMA 2JEUA 2WLMA 5IDJA 3ULEF 4QPJA 1V54C 1N5BA 3CCRV 3E89A 2DQ3A 4U7NA 1GM7A 3ABTA 1OCZC 4R8CA 4YXWG 4MVSA 4N23A 3ETEA 4JMFB 2P9IF 3AG3B 3ZRSA 3LUTB 3X2QB 4GCZA 1H8EG 2QTOA 1NH2D 3VOUA 3G4SV 3NXSA 1OCZB 5EBWC 4MVQA 5EBLC 5J9PC 3UKUF 1MABG 2XASA 1W0KG 4JF3A 3W7TA 3EFFK 3E86A 3E8FA 2OTJV 2EILB 1NH2B 3M99B 2DW4A 1PNKA 2QM7A 3CCUV 3DWLD 4XDJA 5H6RA 2XOKG 3T4DA 4N21A 2OT5A 2ZXWB 5LHIA 1QLEC 1GK9A 1GKFA 4L87A 1S28A 2JJ2G 5H9CA 4MTOA 1QVGU 4F4LA 1YJWV 3F7YC 4TSFG 4UVAA 1YTFD 3KXYA 1NJIW 2HR3A 5B1BC 2EIMC 3G71V 3ZIAG 1FFTB 2OCCB 2XAQA 3D3IA 3SYOA 5CBFA 3DXMF 1VQMV 4MW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RY9 A;  1XKP C;  1TTW A;  2BSJ A;  4AKX A;  1JYO A;  1N5B A;  1JYA A;  1K6Z A;  1XKP B;  3TU3 A;  1S28 A;  1L2W A;  4G6T A;  1K3E A;  2BSH A;  2BHO A;  2PLG A;  2XGA A;  4JMF B;  1K3S A;  3CXJ A;  3EPU A;  3KXY A;  2FM8 A;  2BSI A;  4GF3 A; 
#chains in the Genus database with same CATH topology
 4XBF A;  2QDO A;  4JI2 B;  1K34 A;  2P06 A;  3AK3 A;  1Z2G A;  3AG1 C;  2QA4 V;  2ETN A;  3OMA B;  2ADQ B;  4QE9 A;  4YJ2 A;  2PLG A;  5EZY B;  3K79 A;  1Q86 W;  1V55 C;  2CTW A;  3HKB B;  3P3P A;  1YF2 A;  3RVZ A;  4A5U B;  4DR4 O;  1XKP C;  1TTW A;  4CS3 A;  4I4T A;  2B5U A;  3L75 H;  3ZX6 A;  4LF4 B;  2UXB O;  3HKD A;  1YEW A;  5KX5 B;  1VF7 A;  4J42 A;  2VQF B;  4LFB O;  5JH7 B;  4FZ1 A;  1KKD A;  5IYC O;  4GSL C;  2E75 B;  1TGO A;  2QEX V;  4X66 B;  1PL0 A;  5H6Q A;  2P9S D;  3K06 A;  4MW3 A;  3CCS V;  1JCH A;  3RSE F;  2FML A;  3CXH F;  5KA5 A;  2ZDI A;  5IY5 C;  2LP7 A;  1O9G A;  1OCO C;  2WLI A;  2FB5 A;  4GKJ O;  5EC1 C;  5KHH A;  2ZIO A;  2UU9 O;  2FYU H;  4NVP A;  3CC2 V;  5HFM A;  2MK3 A;  3OTF A;  4JYA B;  4GUN A;  1BQ0 A;  2WLJ A;  5LA6 B;  1SA0 A;  4HBN A;  1G8M A;  4AKX A;  2ZNJ A;  3K9S A;  2PGG A;  4WF9 V;  1PM9 A;  3W7W A;  1VQ9 V;  5BXZ A;  1U2V F;  2ZR2 A;  3HKC B;  3K5L A;  3C3S A;  5C8Y A;  1VQL V;  1S72 V;  4K8X A;  1I08 A;  2Y48 A;  3SJC C;  3ZED A;  2OCH A;  4B3M O;  2CTR A;  1SKV A;  3CWB H;  3K5M A;  4DR3 O;  4DR1 O;  2VRZ A;  3R65 A;  4UV9 A;  1NQT A;  5D5Q A;  3CCM V;  3IAY A;  1P7B A;  1KB9 F;  3RBZ A;  2E76 B;  4O4H B;  2BSK A;  1MSW D;  4YHH B;  5LP6 C;  3RYC A;  4X1Y A;  4JD2 D;  4E4E A;  4FZ0 A;  3H1L H;  3OD4 A;  4LFA O;  1QBZ A;  4Q6G A;  1KBH A;  1IBM O;  4QJF B;  2PTM A;  3ETG A;  4KUM A;  1AJP A;  3JAS A;  4K0K B;  3G6E V;  4OPH A;  3E8B A;  3K9A A;  1DTO A;  1TUB A;  3B40 A;  3QO8 A;  1HP8 A;  4PA3 A;  4JI3 B;  4GKK B;  1QVF U;  3CHX A;  3B8N A;  2R9I A;  1I5Y A;  1F4M A;  2QM8 A;  3L71 H;  2UUB O;  2P90 A;  3ZHR A;  5H5N A;  1AR1 B;  4OX9 B;  1EZV H;  2QWP B;  3P3N A;  2UUC B;  1HNW B;  4XEI D;  4ASU G;  2DJV A;  3EVK A;  1TYQ F;  4JV5 B;  2HJD A;  2F66 C;  4YIP A;  2NNU A;  1KKC A;  4CS4 A;  1KMI Z;  2HJF C;  4CC6 A;  1QCE A;  3UKM A;  4FLV A;  5B1O A;  1W59 A;  1Y76 B;  3BCC H;  3ULE D;  5LMU B;  1Y74 B;  1N8R W;  1GN4 A;  4AQY O;  4GLX A;  1FS0 G;  2JS3 A;  3LDC A;  4FPP A;  2P9I D;  3N2G B;  5CA3 A;  4ZOL B;  5KHJ A;  4UCU A;  3AK2 A;  5LXT B;  2IH3 C;  2ZNI A;  2PF4 E;  1OJH A;  1S5H C;  1XBL A;  4WFB V;  3JD3 A;  4LF4 O;  4HYO A;  3T4Z A;  3ASN C;  1MA1 A;  4NXN B;  4LBE C;  1M57 B;  5FPR A;  4FK5 C;  1JYA A;  2JS5 A;  2PI4 A;  1ZUQ A;  2W0F C;  4JI4 B;  2EZO A;  3UQ8 A;  4X66 O;  1FFX A;  3H01 A;  4DV4 O;  2EJ7 A;  2OIG A;  2BTQ A;  4X88 A;  2YS8 A;  4IL6 Z;  4LF8 B;  3VX7 B;  3SPG A;  2Q9L A;  1EN4 A;  4BIU A;  2HLD G;  4ZI7 A;  4EKW A;  1N33 B;  3D36 A;  3B2E E;  1OHH G;  3T2M A;  4DV2 O;  1MG1 A;  3BA9 A;  5CBH A;  5CN0 A;  4BW5 A;  3KKY A;  5BR8 B;  3G80 A;  4U3J A;  2IH1 C;  1JPX A;  4MVZ A;  2PY5 A;  1O9H A;  4JYA O;  3UKR F;  3TXQ A;  4LF5 B;  2LGQ A;  2A79 B;  2JIZ G;  3DXK F;  3Q4H B;  2RCV A;  1YCI A;  4K35 A;  3QO7 A;  4DUZ O;  5B1A B;  1A32 A;  1RPO A;  1QQC A;  1AI4 A;  1K3E A;  4DRX A;  1UJW B;  1VQN V;  3IJ4 A;  3OMN B;  3E35 A;  1B06 A;  2KSD A;  5IWA B;  3APO A;  3FB5 C;  4P9P A;  1I94 B;  3ZRW B;  4PA6 A;  1GH6 A;  2G38 A;  2PUS A;  3U10 A;  2Q7G A;  2ZM6 B;  3RSE D;  3SYP A;  3TJT A;  1EN5 A;  4NYK A;  3OT7 A;  2YIB D;  4D6T H;  1M1K W;  2A0L A;  3P32 A;  4P2Z A;  3JD4 A;  3AEI A;  1Q90 D;  1XNR B;  1K3S A;  2YIC A;  4LNU A;  3EPU A;  3SPI A;  2LJ2 A;  1N32 B;  3ZHS A;  1OZ0 A;  1FXK A;  1VAR A;  5IYZ A;  4U7O A;  2OD0 A;  2UXN A;  4J10 A;  4PA4 A;  2DYR B;  1DK1 A;  3CRA A;  4PDR A;  4UVC A;  1U2V D;  3K57 A;  4EFE A;  1K8K F;  1JMK C;  3A0B Z;  2AHZ A;  1R3L C;  3UM7 A;  5LYJ B;  4LH7 A;  4P9O A;  2YEV B;  2ZD9 A;  1R6T A;  2BOC C;  4X64 B;  4JI8 O;  4IIJ B;  1QR9 A;  2GDS A;  3UT5 A;  1WP7 A;  3WG7 B;  5GON B;  4GKK O;  1GM8 A;  3FAV A;  2EIN B;  4KL1 A;  1QLN A;  2N05 A;  2JEU A;  4IT5 A;  1JFF A;  3N2K B;  2UXB B;  1B04 A;  4O4L B;  4W4K A;  1IXB A;  4O2A A;  4X20 B;  4MVS A;  4OX9 O;  3LUT B;  3X2Q B;  5KHK A;  1XMQ B;  4GCZ A;  1H8E G;  2QTO A;  3NXS A;  1XI1 A;  2UUC O;  1HNW O;  5EBW C;  5EBL C;  3H9V A;  2HHH B;  3UKU F;  1W0K G;  5FNV B;  2CH7 B;  2AZ0 A;  3E86 A;  2KG7 B;  4BIO A;  2QM7 A;  5H6R A;  1MZE A;  2GBO A;  1TVK B;  1AP6 A;  3T4D A;  4JV5 O;  5LHI A;  1BT8 A;  4GKJ B;  2GUZ A;  4MTO A;  4F4L A;  2W0X A;  4TSF G;  4EB6 B;  1YTF D;  1NJI W;  4I50 B;  2UXD O;  1FFT B;  5CBF A;  3DXM F;  4NR1 A;  1VQO V;  4O2B B;  1R6K A;  2B1I A;  4IHJ A;  5L3D A;  2PYL A;  5LMU O;  4DV6 B;  1HNX B;  3EXA A;  1KEC A;  5GTH Z;  1JQ0 A;  4B7E A;  2PI5 A;  5KMG A;  1BQZ A;  1ZL8 B;  3JAL B;  2NLJ C;  4XDL A;  3AG1 B;  4JI1 O;  3RGB A;  2ZE8 A;  2DWE C;  4TT3 G;  1NVP B;  5K1P A;  4YIO A;  3AK1 A;  2R9A A;  3ZBH A;  1V55 B;  4DR1 B;  4FFK A;  4LF6 O;  2Q6A A;  2QWR B;  2JVD A;  3ZHT A;  5DN6 G;  2XHB A;  4NXN O;  1K6Z A;  1XKP B;  4JI4 O;  3UO2 A;  4G6T A;  4J7J A;  3FB8 C;  4LF8 O;  3JSL A;  3ABM B;  2DYR C;  3DGE A;  5EYP A;  3JAK B;  1YSC A;  1IXM A;  1LNQ A;  2K9P A;  1UPG A;  1BS3 A;  1N33 O;  2RNB A;  1Y67 A;  4FVM A;  4I0X B;  2P5O A;  3FYE B;  1SQP H;  3UCS C;  1ARO P;  4DR5 B;  1P4R A;  3H1J H;  5BR8 O;  4MTG A;  1IBM B;  3WG7 C;  2B1G A;  5LBQ A;  1MOF A;  2EIN C;  3ABU A;  5BMV B;  1OCO B;  4TQF A;  4G27 B;  2QSA A;  2F4V B;  1DF4 A;  1R3I C;  1PNM A;  2KB1 A;  4FMT A;  1D2D A;  3HKE B;  5CA0 A;  4TUY A;  3SJB C;  3LNN A;  3X2Q C;  2YXL A;  4RUE A;  1WNS A;  2EUL A;  1BCC H;  4MTF A;  2R9R B;  3ASO B;  3J7A U;  2UUB B;  1XQ8 A;  1XHX A;  1JVM A;  1I94 O;  2QKS A;  4FLT A;  4TV8 A;  4UUJ C;  3L9D A;  4TV9 A;  1H2M A;  4L8J A;  4R7C A;  2DQ0 A;  2ZM6 O;  4JI7 B;  3VX8 B;  1AVM A;  2BSJ A;  1NBM G;  1K4D C;  3CD6 V;  4JAU A;  1VF6 A;  2XND G;  2F1M A;  4J7Z A;  4JI6 B;  3DSQ A;  1AJN A;  3E2E A;  3LDE A;  2Q5Z A;  3SYA A;  5KLV H;  4X89 A;  2CAZ C;  1S0V A;  4XDK A;  1HWY A;  3UKR D;  3WB1 A;  1N32 O;  4PJ0 Z;  2MQD A;  1NTZ H;  4O4J A;  4JTA B;  1YTF B;  3ZMZ A;  1RSO A;  5HFL A;  5LP6 B;  2PZS A;  1GAX A;  2KC5 A;  1U96 A;  3JAW B;  2JGD B;  2IU3 A;  3BAA A;  1JR9 A;  3G6B A;  2QJ1 A;  4HZ3 A;  3P30 A;  3RYH B;  4AQY B;  4Z2W A;  4TQD A;  1BGY H;  4UB8 Z;  1EN6 A;  1RFY A;  1Z5V A;  3FFQ A;  4PV1 B;  3W7S A;  3QO5 A;  4X64 O;  1SZT A;  2ITD C;  3OM3 B;  5EC2 C;  3ABK B;  4LWS B;  3GVM A;  3RT3 C;  3ZHU A;  5IJ0 B;  1D5A A;  1XRE A;  1CEZ A;  2BOB C;  2WAM A;  3ABM C;  3DTU B;  1KP3 A;  3ABL C;  3OE7 G;  4O4I A;  1AR4 A;  4UB6 Z;  4JI0 B;  1XMQ O;  3ZJZ A;  4DV4 B;  1K8A W;  1S76 D;  2WLL A;  2HHH O;  2WLH A;  3STL C;  3C90 A;  3CEI A;  2Q67 A;  3S3W A;  3AG4 C;  2UXC B;  2P4V A;  2WLK A;  4GT1 A;  4UCO A;  3IFX A;  5CA1 B;  3OW2 U;  2AXT Z;  1Q6H A;  4DV2 B;  3QF7 A;  5IYB O;  5B66 Z;  1K8K D;  4JZ2 A;  3BHP A;  4D7T A;  2HP8 A;  3E22 A;  2WA3 A;  1J5E B;  4X8A A;  5LOV B;  2Z5U A;  1L8D A;  3K04 A;  3U0Z A;  2JJ1 G;  5KHI A;  1PL4 A;  2KKW A;  1U97 A;  1WPX A;  2QE7 G;  4X1K A;  5C93 A;  4NXM B;  4DV6 O;  3FB6 C;  1HNX O;  1JYO A;  3ASO C;  3AG2 B;  4DUZ B;  1FPO A;  4WBN B;  2Y4U A;  3FD9 A;  4YY3 B;  2XUM A;  3IC9 A;  1M56 C;  1IBK O;  1EFR G;  2XAF A;  4MVR A;  4GX2 A;  4U3F H;  2ZDI C;  1P84 F;  3UKU D;  1IBL O;  1YIT V;  1JA8 A;  4FJC C;  2YIA A;  1ZAU A;  3BAB A;  1LUW A;  4G28 B;  5EZY A;  2CDY A;  4UCT A;  3HKB A;  1DF5 A;  5F2V O;  3DXM D;  3ASN B;  1D5N A;  4WFF A;  3LSQ A;  4KFM A;  3RYF B;  5KX5 A;  5JH7 A;  3FB7 C;  5A9G A;  4JZG A;  4I9Q A;  3JD1 A;  4RO2 A;  5ITZ B;  3FKS G;  3MHH C;  4DR5 O;  1F23 A;  3CSX A;  3ABK C;  1YJN V;  1PKX A;  1I0H A;  3I55 V;  4WFH A;  2WSS G;  1QLE B;  1Q43 A;  2F4V O;  1XL6 A;  2ZQM A;  2V7Q G;  1SS3 A;  3B09 A;  4LR3 A;  1WB8 A;  1K5S A;  4JI8 B;  4X65 B;  3ZMT A;  2WPD G;  1K97 A;  3KZI Z;  4JPR A;  2V4D A;  2ZIM A;  2W6I G;  1VQK V;  3SDL A;  2LW7 A;  1Q5O A;  3DC5 A;  3OR7 C;  4CC5 A;  4H44 B;  5LA6 A;  4I55 B;  4DO2 A;  4JI7 O;  4RAI A;  2V1D A;  1W0J G;  4ZI7 B;  1B3Q A;  5JJJ B;  5CB4 B;  3HKC A;  4JI6 O;  1FYJ A;  2DWD C;  4MS2 A;  2P9L D;  4DK0 A;  4J80 A;  2CTQ A;  2DYT A;  1P7G A;  3T1H O;  5L3B A;  4D7S A;  3N27 A;  5L3C A;  5LHH A;  2XAG A;  1H2N A;  1QU7 A;  3R66 A;  4K8Z A;  1E79 G;  1GN2 A;  2UXD B;  3AG2 C;  4FFB B;  1R6N A;  2HKO A;  2IJI A;  1PD3 A;  1F51 A;  4RWU A;  3C3T A;  1K73 W;  5LHG A;  4UCS A;  4O4H A;  4BAY A;  1Q7Y W;  1NU1 H;  3OAA G;  1SET A;  5KHG A;  3MHS C;  2BSI A;  2KQX A;  4ZHQ B;  3JD0 A;  4JI1 B;  1S5J A;  5DED A;  1G6U A;  1BHB A;  4ZBM A;  3SR2 C;  5IDJ A;  1N5B A;  5A2Q N;  2DQ3 A;  4DYL A;  4LF6 B;  3CRM A;  4X1I B;  4F6R B;  4PD4 F;  4JI0 O;  3ETE A;  1IVS A;  3AG3 B;  2L6L A;  5LMN B;  1YZB A;  5FPO A;  3OGI B;  2UXC O;  2M6Y A;  3EFF K;  1NH2 B;  3M99 B;  4XDJ A;  3H1I H;  2N74 A;  2ARH A;  4N21 A;  3M8A A;  1QLE C;  1S28 A;  5JWP A;  1ZSP A;  1J5E O;  3F7Y C;  4UVA A;  3KXY A;  1YDX A;  2LGW A;  2EIM C;  2Z0A A;  3ZIA G;  2F93 B;  2OCC B;  2XAQ A;  2A7W A;  4MW8 A;  4NXM O;  1Z5W A;  1NI8 A;  2GHY A;  1WAZ A;  4G2K A;  3BA8 A;  3BPZ A;  4YY3 O;  1UFI A;  3WB2 A;  4UFZ A;  1QR8 A;  1SF9 A;  1XEQ A;  1NVP D;  3CCL V;  1E1R G;  3DXR B;  3CME V;  1XHZ A;  1Y76 A;  2Q4P A;  4ICG A;  1Y74 A;  1FXV A;  3BFR A;  5L3G A;  2CE4 A;  2A3Q A;  2IM9 A;  4DR7 O;  3K5N A;  4GX5 A;  3F5W C;  5AG2 A;  3B8M A;  2NR5 A;  3D8C A;  3N2G A;  1N0J A;  3ZMU A;  4ZOL A;  1NZ6 A;  1T5E A;  5EK0 A;  1N34 B;  1FJG B;  3OMI B;  4J7K A;  5LXT A;  2ZE6 A;  1AIL A;  1ZX3 A;  1L0N H;  2A06 H;  2Q7H A;  3OTO B;  1R3K C;  4JTD B;  1XOU A;  3WFV A;  1SQQ H;  2A9H A;  2QKA A;  4LH6 A;  4UCR A;  1YI2 V;  3K03 A;  4FLW A;  2EZP A;  2DYS B;  4RQE A;  1AB3 A;  1ZTE A;  4EBR A;  3T1Y B;  4JAV A;  4FM0 A;  3A0H Z;  2CGN A;  4DV0 B;  4CS2 A;  2P9S F;  1PNL A;  1CXZ B;  4X65 O;  2HFE C;  3SJQ C;  3LNM B;  4DUY B;  1I5X A;  3AG3 C;  2X6B A;  4HNA B;  3CCV V;  4B3R O;  4DV7 B;  5L3F A;  3CJH B;  5IE9 A;  2Z3Y A;  2ITC C;  3SPH A;  2X6A A;  1K9M W;  5IT9 N;  4TWK A;  1K92 A;  1AI5 A;  2ZE5 A;  4GZR B;  4KXR A;  5JVD B;  4JAA A;  4W4L A;  1WLE A;  5EIB C;  3JAR B;  2OCC C;  2XAH A;  1BZK A;  3A8T A;  4PEL A;  2QGN A;  1YVW A;  3KCY A;  3ZRW A;  2H8P C;  3MAQ A;  2P22 C;  3SJA C;  5JCO C;  1RY9 A;  4FLU A;  1NTM H;  2HEP A;  1G1X B;  1ZLZ A;  1VEW A;  3RYI B;  3JD2 A;  2OTL V;  4RQF A;  1L2W A;  1COW G;  3CP1 A;  1Y6X A;  3K59 A;  1KYO F;  5IJ9 B;  4PDV A;  1IBK B;  3HR0 A;  4B3S O;  5J2U B;  4JI5 O;  1FAF A;  1AI7 A;  4LF7 B;  2L35 A;  2M7W A;  3LSS A;  1SQF A;  2VWK A;  3W7X A;  1IBL B;  4LF9 B;  4HAM A;  2JDI G;  3JAT B;  5J2T B;  4IYI A;  3BY6 A;  4AHC A;  1TYQ D;  5LYJ A;  3OR6 C;  1FD9 A;  2YEV A;  2WLN A;  4IYH A;  2YI9 A;  2XTA A;  1SQB H;  1WA8 B;  2QKC A;  4QIW F;  5LMN O;  4IIJ A;  1VIB A;  2DYS C;  3OUS A;  5GON A;  3ABL B;  2H3O A;  4YJ3 B;  1S5L Z;  3IGA C;  1SER A;  3CRC A;  1M93 A;  3N2K A;  2P4K A;  2JK5 C;  4O4L A;  2EBO A;  3KG2 A;  3VQV A;  1TUE B;  4X20 A;  3AG4 B;  4WFG A;  1K4C C;  4JAS A;  1Y4M A;  2F43 G;  4YJ2 B;  3K5O A;  4X62 O;  3RVY A;  1Q8I A;  4ZKI A;  4UCV A;  5FNV A;  2CH7 A;  1H2L A;  1BE3 H;  2KG7 A;  4XEI F;  3ETQ A;  2JEX A;  2QWO B;  1BHA A;  5KAF Z;  3ZN0 A;  4CH6 A;  1TVK A;  4NB5 A;  4I4T B;  4JTC B;  1H2S B;  3HKD B;  2E5L O;  1JX9 A;  1XMO B;  3CRQ A;  4OXS A;  4H0L B;  3BRC A;  2P9P F;  4EB6 A;  2BHO A;  3JYC A;  1XNQ B;  4I50 A;  4P30 A;  1VQ8 V;  5JJN B;  5B3S C;  1G4Y B;  2AW9 A;  4O2B A;  5KUM A;  2YSU B;  4BW9 A;  1NS1 A;  2X7R B;  1M56 B;  2ZCE A;  1YIJ V;  2HG5 C;  4UV8 A;  3QNE A;  1JOY A;  5FL7 G;  1ZL8 A;  3JAL A;  2WLI B;  1AI6 A;  2YI8 A;  2Q7E A;  1DGS A;  2Q73 A;  3PJS K;  1PV0 A;  1N34 O;  3T1H B;  3VQW A;  1FJG O;  4PDM A;  1HNZ B;  2Q69 A;  1V54 B;  2AGA A;  3G67 A;  4C7U A;  2D2C B;  1I7F A;  1NR1 A;  3OTO O;  1ENV A;  2RN9 A;  3TGU H;  1H2K A;  1IUR A;  4CH3 A;  1SA0 B;  5B1N A;  3DXK D;  3B77 A;  3CCJ V;  2VWJ A;  1SES A;  1BSM A;  1QNM A;  2P9U F;  1KU9 A;  2P9K F;  4OPA A;  4PDL A;  1KP2 A;  2HVK C;  2Y0P A;  3T1Y O;  4LCU C;  2YIB A;  1VP7 A;  5C8Y B;  3L72 H;  1NTK H;  4DV0 O;  1AJQ A;  4AIL C;  3JAK A;  1X4T A;  3CPW U;  4DUY O;  4I0X A;  2VS0 A;  3TXS A;  2C2A A;  5B1B B;  1GRJ A;  4GYC B;  4J11 A;  2UUA O;  4B3T B;  1CPY A;  4WCE V;  4DV7 O;  3E8G A;  1AP5 A;  2BCC H;  1DLB A;  5B5E Z;  5BMV A;  1US6 A;  2QR4 A;  2BSK B;  3RYC B;  4X1Y B;  4Z1M G;  4PA7 A;  3H1H H;  3HKE A;  3GWK C;  2Q68 A;  5BZB A;  3SGI A;  4DV3 B;  3QTC A;  2Y4T A;  1B6Q A;  4MVU A;  2W6J G;  4Z1V A;  3DC6 A;  3JAS B;  4MVO A;  2FM8 A;  2EX3 A;  3LSU A;  4FLX A;  5L3E A;  4DV1 B;  3TK1 A;  1TUB B;  3WU2 Z;  1TA8 A;  3E8H A;  3ZMS A;  4LFC B;  5JQG A;  1NKD A;  3ZRV A;  2WWW A;  4F6E A;  1N36 O;  4EFB A;  2H94 A;  2EIJ B;  1Y66 A;  4CZZ A;  4I7Z B;  1MNG A;  3JSN A;  4FIP C;  3CXJ A;  1VQ7 V;  2P9N F;  1HDJ A;  3S3X A;  3CCQ V;  4LF7 O;  1VQ4 V;  4RUF A;  2DE0 X;  5LP6 A;  1F4N A;  2QTS A;  3JAW A;  4NTW A;  2JGD A;  4LF9 O;  1M4U A;  1FKA O;  1V54 C;  3RYH A;  4DR7 B;  3B4S A;  1OCZ C;  4R8C A;  1SQG A;  3CE2 A;  4JMF B;  2F23 A;  3ZRS A;  1URF A;  1NH2 D;  3VOU A;  2RJZ A;  2Q0A A;  1SC5 B;  4LWS A;  4MVQ A;  1KUQ A;  3W7T A;  3VQY A;  3ZHV A;  5IJ0 A;  4KHP O;  3E8F A;  2EIL B;  3CCU V;  2XOK G;  1M5I A;  2ZXW B;  1GKF A;  5EIB D;  2XT9 A;  1F7Y A;  5B1B C;  3RWR D;  5JJE B;  3D3I A;  1VQM V;  4QPK A;  2LFR A;  4K3A A;  3GWO A;  3SPJ A;  1BL8 A;  5CA1 A;  3H1K H;  3QVN A;  4CH5 A;  2EIM B;  2ILM A;  1E1Q G;  4QE7 A;  1XMO O;  3JCZ A;  4TOI A;  3J81 N;  1L0L H;  4B3R B;  1ROP A;  1XNQ O;  2K1E A;  4MVM A;  5LOV A;  1FFX B;  1ZWI C;  2IJH A;  2BTQ B;  2IU0 A;  1WJZ A;  5D5P A;  1BMF G;  1QHT A;  4WBN A;  4MTX A;  5GW7 A;  2DMX A;  2RDC A;  1IZ3 A;  4BIZ A;  1VQP V;  2D3O W;  3ZN1 A;  1HNZ O;  2ODM A;  4U3J B;  3OGC C;  1FXH A;  1VQ5 V;  4CH4 A;  3T1C A;  1HR0 B;  3A2F A;  3TCU A;  3EHB B;  2EIJ C;  2CTP A;  4Q20 A;  1VF5 B;  3WB0 A;  1IDS A;  3CXC U;  2P9P D;  4CBC A;  1OCC B;  1TAE A;  2CK3 G;  4PI2 A;  4DRX B;  2GV9 A;  2BTO A;  1WN7 A;  4DR2 B;  1WP8 A;  2QWN B;  4EEQ A;  2N04 A;  1GO3 F;  1KC8 W;  4JI2 O;  4B3S B;  5KA6 A;  3RYF A;  4JI5 B;  4B08 A;  2AZ2 A;  2R70 A;  3NR7 A;  3CYO A;  4B3T O;  5ITZ A;  1R1B A;  3STZ C;  5E79 Z;  2LFS A;  3OEH G;  4FLZ A;  1IX9 A;  1XL4 A;  2P67 A;  3BVO A;  1M9N A;  2EIL C;  4LNU B;  2R72 A;  4JYC A;  3CX5 F;  2Q8V A;  2ZXW C;  3K08 A;  5TIS Z;  4GX0 A;  4JYY A;  4DV3 O;  3UO3 A;  1FXK B;  1H2G A;  2VQF O;  5IYZ B;  2P9U D;  5E1A C;  3SPC A;  2P9K D;  1VQ6 V;  1H8H G;  2GTA A;  3TU3 A;  2JRI A;  2RMK B;  1WPB A;  2P6J A;  2MW2 B;  2Y0I A;  1GM9 A;  1LR1 A;  3LDD A;  1AR5 A;  4I55 A;  4X62 B;  2ZIN A;  4DV1 O;  3HPL C;  1Q82 W;  1S77 D;  4R6Z A;  5LL6 Y;  1HW7 A;  3UT5 B;  1WB7 A;  4NTY A;  1RM1 B;  5CB4 A;  3FAV B;  4LFC O;  3DWL F;  1JFF B;  2DOS A;  2QWQ B;  3J80 N;  3FYI B;  1Q81 W;  3I5D A;  4DK1 A;  1EZJ A;  4JYB A;  2E5L B;  4QNH B;  2XGA A;  4H33 A;  3TET A;  4O2A B;  4R50 A;  1SQX H;  5LGN A;  1CP9 A;  3OUF A;  3F5T A;  1GN6 A;  4FFB A;  3SYC A;  3D36 C;  3BEH A;  3CB2 A;  5LGT A;  3ZS8 C;  3VBB A;  3HB3 B;  2YC0 A;  4FM2 A;  2FTK A;  3RW0 A;  5FLX N;  1EM1 A;  1GTO A;  4BWA A;  2GSM B;  4UVB A;  5KUK A;  4DR6 B;  2EJR A;  4J9Z B;  2GUZ B;  4FM1 A;  1VMG A;  4ZHQ A;  3ZMV A;  1W2B U;  2Y69 B;  3APQ A;  3F7V C;  2BE3 A;  3L70 H;  1PPJ H;  2IJJ A;  4WFA V;  1M90 W;  1OCC C;  5KAI Z;  2GTS A;  4IHJ B;  2VQE B;  4BR6 A;  5DM6 V;  4X1I A;  4F6R A;  4QGP A;  5KMG B;  4YHH O;  4WFE A;  5H2F Z;  3CC4 V;  2LO1 A;  2P9N D;  2LPU A;  3IC7 A;  4DV5 B;  1PP9 H;  1YXB A;  3ZCC A;  2O57 A;  1K7D A;  3RFR A;  2OYQ A;  2RQ6 A;  3CC7 V;  1MMM A;  3K0D A;  2UUA B;  4FLY A;  2B9Z A;  2CUG A;  4E2L A;  1SZX A;  4K0K O;  1OCR B;  2X0L A;  1Q3E A;  3ETD A;  4MT8 A;  1FXK C;  1MSD A;  2EIK B;  2HVJ C;  1M57 C;  4DR4 B;  1ORQ C;  4JI3 O;  5EYP B;  3Q4H A;  1OV9 A;  1JJO A;  3JCU Z;  1EBO A;  3CRR A;  5JCO A;  3ICX A;  4UXN A;  4LFB B;  5B3S B;  2BSH A;  3CS5 A;  2E74 B;  4I9W A;  3DXR A;  3CCE V;  1RM1 C;  4J9Y B;  4X9Q A;  1HR0 O;  1X59 A;  1SRY A;  4GX1 A;  4PI0 A;  5GTI Z;  3QG5 A;  1JJ2 U;  3K3W A;  3KCX A;  4JGS A;  5CA0 B;  1J95 A;  4TUY B;  4LC1 A;  4ZIB A;  4DW1 A;  2FL4 A;  2F95 B;  1KQS U;  3ZHQ A;  2QM4 A;  3THO A;  1YHQ V;  1N36 B;  1MZF A;  3RN4 A;  1NT2 B;  1KD1 W;  4DR2 O;  2UU9 B;  3MD0 A;  4JD2 F;  2YDE A;  5B1A C;  4TV8 B;  5DEC A;  4TV9 B;  1Q6I A;  1R73 A;  2XAJ A;  3O9O A;  1NR7 A;  3OFN G;  2ATK C;  2IW5 A;  1H38 A;  5CMU A;  1GMG A;  2Q0O C;  5IYD O;  2Y69 C;  3ZRX A;  4H5B A;  2LQT A;  4PA9 A;  4H37 A;  3I56 V;  2E3C A;  4IGG A;  1XDC A;  4B3M B;  3E83 A;  4NTX A;  2YXY A;  2P7T C;  2X6C A;  4KP4 A;  4DR3 B;  4O4J B;  1L1F A;  3JAM N;  4HNA A;  3K58 A;  1RSO B;  1SQV H;  4KHP B;  3ML0 A;  2FKX A;  2ZR3 A;  4MSW C;  2PYJ A;  4I5S A;  1V9P A;  1K33 A;  3CJH A;  1S3J A;  3M7M X;  4ABM A;  3SYQ A;  4PHZ A;  5K1X A;  2ADP A;  2ZT9 B;  1THZ A;  5EBM C;  2DN9 A;  5CBG A;  1XUQ A;  5JVD A;  3L73 H;  2CGO A;  2AHY A;  1OCR C;  4LFA B;  3CMA V;  3U11 A;  3JAR A;  2ZE7 A;  2EIK C;  3VQX A;  2P9L F;  3MDS A;  1N0N A;  1YJ9 V;  4DXW A;  1P49 A;  4O4I B;  3K0G A;  5IY5 B;  1RP3 B;  3OEE G;  2YUA A;  3FX7 A;  2ZKO A;  4H13 B;  3GB7 C;  4DW0 A;  1R3J C;  4LF5 O;  2LW1 A;  4B7K A;  4GF3 A;  1RPR A;  4NKG B;  5BY1 A;  3W7U A;  2UXX A;  1K5Q A;  2IJK A;  2WLL B;  3A0R A;  5LGU A;  4LP8 A;  3RYI A;  2WLM A;  3ULE F;  4QPJ A;  3CCR V;  1LUV A;  3E89 A;  3L74 H;  4U7N A;  4OGQ B;  1GM7 A;  3ABT A;  1N4C A;  4YXW G;  4DR6 O;  2NN4 A;  4N23 A;  5IJ9 A;  5IWA O;  2YXH A;  2P9I F;  2WA4 A;  3O65 A;  1XIL A;  2JGU A;  3E22 B;  2YID A;  5J2U A;  3G4S V;  2OWO A;  1OCZ B;  3PN1 A;  5J9P C;  4J41 A;  1MAB G;  2XAS A;  4JF3 A;  1GN3 A;  1Q6U A;  2OTJ V;  4X1K B;  3JAT A;  2VQE O;  2DW4 A;  1PNK A;  3DWL D;  5J2T A;  2OT5 A;  5JQG B;  1GK9 A;  4L87 A;  3AG7 A;  1XNR O;  2JJ2 G;  5H9C A;  2OIE A;  1WA8 A;  1QVG U;  1YJW V;  2IBZ H;  3D3Q A;  2HR3 A;  3G71 V;  3SYO A;  4AI8 A;  4DV5 O;  1VF6 C;  4YJ3 A; 
#chains in the Genus database with same CATH homology
 4XBF A;  2LFR A;  1VQO V;  3GWO A;  1R6K A;  3SPJ A;  1BL8 A;  1K34 A;  2B1I A;  5L3D A;  1KEC A;  2EIM B;  2GHY A;  3AG1 C;  2QA4 V;  1E1Q G;  4QE7 A;  1JQ0 A;  4G2K A;  3JCZ A;  2PI5 A;  3OMA B;  4QE9 A;  2PLG A;  1ROP A;  1QR8 A;  2NLJ C;  4XDL A;  3K79 A;  1Q86 W;  2K1E A;  4MVM A;  1NVP D;  3AG1 B;  3CCL V;  1E1R G;  1V55 C;  1ZWI C;  2IJH A;  3RVZ A;  3CME V;  2IU0 A;  2DWE C;  4TT3 G;  1XKP C;  1TTW A;  1NVP B;  1BMF G;  1FXV A;  5L3G A;  2B5U A;  1V55 B;  2Q6A A;  4MTX A;  4GX5 A;  5GW7 A;  5DN6 G;  1KKD A;  4QPK A;  3F5W C;  5IYC O;  1K6Z A;  3B8M A;  1XKP B;  4GSL C;  4BIZ A;  1VQP V;  4G6T A;  3FB8 C;  3ZMU A;  2D3O W;  3ZN1 A;  5EK0 A;  2QEX V;  1PL0 A;  3OMI B;  3OGC C;  3ABM B;  5H6Q A;  2DYR C;  1FXH A;  2P9S D;  3DGE A;  1VQ5 V;  3T1C A;  1R3K C;  4JTD B;  1YSC A;  3K06 A;  3WFV A;  1IXM A;  1LNQ A;  2A9H A;  4MW3 A;  3EHB B;  3TCU A;  3CCS V;  1JCH A;  1YI2 V;  3RSE F;  2EIJ C;  3K03 A;  5KA5 A;  2EZP A;  2DYS B;  2ZDI A;  5IY5 C;  4Q20 A;  2LP7 A;  3FYE B;  1OCO C;  4RQE A;  3CXC U;  2WLI A;  2P9P D;  5EC1 C;  1ARO P;  4CBC A;  1P4R A;  4EBR A;  4MTG A;  1OCC B;  3WG7 C;  2CK3 G;  4JAV A;  2B1G A;  3CC2 V;  5LBQ A;  1MOF A;  2EIN C;  3ABU A;  5HFM A;  1OCO B;  2MK3 A;  2P9S F;  4G27 B;  2WLJ A;  1DF4 A;  1GO3 F;  1R3I C;  1PNM A;  1KC8 W;  1PNL A;  2KB1 A;  5KA6 A;  1G8M A;  2HFE C;  3SJQ C;  4FMT A;  3LNM B;  1I5X A;  4AKX A;  4WF9 V;  3CYO A;  3AG3 C;  2X6B A;  3W7W A;  3CCV V;  1VQ9 V;  3X2Q C;  1U2V F;  3STZ C;  4RUE A;  2ZR2 A;  5L3F A;  2LFS A;  4MTF A;  1VQL V;  2R9R B;  2Z3Y A;  3ASO B;  1S72 V;  2ITC C;  3OEH G;  3SPH A;  2X6A A;  1XL4 A;  1JVM A;  2P67 A;  2QKS A;  1M9N A;  2EIL C;  2Y48 A;  4UUJ C;  1K9M W;  4R7C A;  4TWK A;  1AI5 A;  1K92 A;  4JYC A;  2DQ0 A;  3VX8 B;  3K08 A;  2ZXW C;  4GX0 A;  2BSJ A;  1NBM G;  1FXK B;  1K4D C;  3CD6 V;  4JAU A;  1H2G A;  2XND G;  3R65 A;  2P9U D;  4UV9 A;  5E1A C;  1NQT A;  3SPC A;  2P9K D;  1VQ6 V;  1H8H G;  1WLE A;  3CCM V;  1AJN A;  2OCC C;  3E2E A;  1P7B A;  3LDE A;  3SYA A;  3TU3 A;  2XAH A;  3RBZ A;  4X89 A;  2P6J A;  1MSW D;  4PEL A;  1S0V A;  4JD2 D;  1GM9 A;  4XDK A;  1HWY A;  3ZRW A;  3UKR D;  3LDD A;  2H8P C;  2MQD A;  3HPL C;  1Q82 W;  1RY9 A;  1S77 D;  4JTA B;  4R6Z A;  1YTF B;  3ZMZ A;  1RM1 B;  5HFL A;  2KC5 A;  2IU3 A;  1QBZ A;  3DWL F;  3JD2 A;  4HZ3 A;  3FYI B;  3P30 A;  1Q81 W;  2OTL V;  4QJF B;  1EZJ A;  4JYB A;  4RQF A;  1L2W A;  1COW G;  3ETG A;  4QNH B;  3CP1 A;  4KUM A;  2XGA A;  1AJP A;  4H33 A;  3TET A;  4R50 A;  3W7S A;  3G6E V;  5LGN A;  3QO5 A;  1CP9 A;  3OUF A;  4PDV A;  1SZT A;  3E8B A;  1DTO A;  2ITD C;  3K9A A;  3OM3 B;  3SYC A;  5EC2 C;  1AI7 A;  3QO8 A;  3ABK B;  3BEH A;  5LGT A;  2M7W A;  3LSS A;  3VBB A;  4PA3 A;  3HB3 B;  3W7X A;  4HAM A;  2JDI G;  1QVF U;  2FTK A;  3RW0 A;  1CEZ A;  2BOB C;  2WAM A;  3B8N A;  3ABM C;  3DTU B;  3BY6 A;  1GTO A;  1KP3 A;  2R9I A;  1TYQ D;  3ABL C;  3OE7 G;  3OR6 C;  1I5Y A;  1F4M A;  2GSM B;  2QM8 A;  2YEV A;  4UVB A;  5KUK A;  2WLN A;  2P90 A;  2EJR A;  4J9Z B;  1AR1 B;  3ZJZ A;  4QIW F;  1K8A W;  2DYS C;  3ZMV A;  3OUS A;  2Y69 B;  1W2B U;  1S76 D;  2WLL A;  3F7V C;  2WLH A;  3STL C;  3ABL B;  2Q67 A;  3AG4 C;  4XEI D;  3IGA C;  2IJJ A;  4ASU G;  1SER A;  2WLK A;  4WFA V;  1M90 W;  1OCC C;  4GT1 A;  3IFX A;  3OW2 U;  2JK5 C;  5DM6 V;  2EBO A;  5IYB O;  1K8K D;  3KG2 A;  1TUE B;  1TYQ F;  3AG4 B;  4WFG A;  1K4C C;  4JAS A;  2NNU A;  1Y4M A;  2F43 G;  4WFE A;  3RVY A;  3CC4 V;  4X8A A;  2P9N D;  2HJF C;  2LPU A;  3IC7 A;  4ZKI A;  2Z5U A;  1QCE A;  3K04 A;  2JJ1 G;  3UKM A;  5B1O A;  1WPX A;  4XEI F;  2QE7 G;  2JEX A;  5C93 A;  3ZCC A;  1BHA A;  3ZN0 A;  3FB6 C;  3ULE D;  1K7D A;  1JYO A;  1N8R W;  3ASO C;  4JTC B;  3CC7 V;  3AG2 B;  3K0D A;  1JX9 A;  4OXS A;  1FS0 G;  3LDC A;  2P9P F;  4E2L A;  4FPP A;  1OCR B;  2BHO A;  2P9I D;  2X0L A;  3ETD A;  3JYC A;  5CA3 A;  1M56 C;  4MT8 A;  1EFR G;  1FXK C;  2XAF A;  2EIK B;  4P30 A;  2HVJ C;  4MVR A;  1VQ8 V;  4GX2 A;  5B3S C;  1G4Y B;  2IH3 C;  2ZDI C;  1M57 C;  3UKU D;  1ORQ C;  5KUM A;  2YSU B;  1S5H C;  4WFB V;  2X7R B;  1YIT V;  3JD3 A;  1M56 B;  4FJC C;  4HYO A;  1YIJ V;  1EBO A;  2HG5 C;  4UV8 A;  3T4Z A;  3QNE A;  4UXN A;  3ASN C;  5B3S B;  1JOY A;  1JYA A;  4LBE C;  1M57 B;  4G28 B;  4FK5 C;  5FL7 G;  2PI4 A;  2WLI B;  1AI6 A;  2W0F C;  3PJS K;  2BSH A;  2EZO A;  4PDM A;  3H01 A;  2Q69 A;  1V54 B;  4I9W A;  1DF5 A;  3CCE V;  1RM1 C;  4J9Y B;  4X88 A;  3DXM D;  1NR1 A;  3ASN B;  3VX7 B;  3SPG A;  1ENV A;  4BIU A;  1SRY A;  2HLD G;  4GX1 A;  4WFF A;  5B1N A;  1JJ2 U;  3LSQ A;  3DXK D;  3K3W A;  4KFM A;  3B77 A;  4EKW A;  3CCJ V;  4JGS A;  1SES A;  3D36 A;  1OHH G;  3FB7 C;  3T2M A;  1J95 A;  1MG1 A;  4LC1 A;  5CBH A;  2P9U F;  3JD1 A;  4RO2 A;  2P9K F;  3FKS G;  3MHH C;  5CN0 A;  4BW5 A;  1F23 A;  4PDL A;  1KQS U;  1KP2 A;  2HVK C;  1YHQ V;  3ABK C;  4LCU C;  1YJN V;  1PKX A;  3I55 V;  1KD1 W;  2IH1 C;  1AJQ A;  1JPX A;  4MVZ A;  3MD0 A;  4WFH A;  2WSS G;  4JD2 F;  1QLE B;  3UKR F;  5B1A C;  1XL6 A;  2ZQM A;  2V7Q G;  1K5S A;  1R73 A;  2A79 B;  3CPW U;  2JIZ G;  3DXK F;  3ZMT A;  2C2A A;  2XAJ A;  1NR7 A;  5B1B B;  3OFN G;  2WPD G;  2ATK C;  2IW5 A;  3QO7 A;  1K97 A;  5B1A B;  1H38 A;  4JPR A;  1CPY A;  1RPO A;  5CMU A;  4WCE V;  1GMG A;  5IYD O;  1AI4 A;  2W6I G;  2Y69 C;  3E8G A;  3ZRX A;  1VQK V;  4H5B A;  1K3E A;  1UJW B;  1DLB A;  4PA9 A;  4H37 A;  3I56 V;  3OMN B;  1VQN V;  3E35 A;  3OR7 C;  3FB5 C;  4P9P A;  4Z1M G;  4PA7 A;  3ZRW B;  4PA6 A;  4DO2 A;  4RAI A;  3E83 A;  2V1D A;  2Q68 A;  5BZB A;  3RSE D;  1W0J G;  2P7T C;  2X6C A;  4KP4 A;  3SYP A;  1L1F A;  3ML0 A;  2ZR3 A;  4MSW C;  2DWD C;  4I5S A;  2A0L A;  1M1K W;  1K33 A;  3P32 A;  4MS2 A;  2P9L D;  1S3J A;  4P2Z A;  2DYT A;  1B6Q A;  3JD4 A;  4MVU A;  5L3B A;  2W6J G;  3AEI A;  3SYQ A;  1K3S A;  5L3C A;  5LHH A;  3EPU A;  2XAG A;  4MVO A;  2FM8 A;  1E79 G;  1THZ A;  5EBM C;  3SPI A;  3AG2 C;  5L3E A;  3TK1 A;  1OZ0 A;  1FXK A;  5CBG A;  1R6N A;  2HKO A;  4U7O A;  2IJI A;  1PD3 A;  2AHY A;  2UXN A;  1OCR C;  4PA4 A;  2DYR B;  1F51 A;  3E8H A;  4PDR A;  4UVC A;  3ZMS A;  3CMA V;  1K73 W;  1U2V D;  5LHG A;  1NKD A;  3ZRV A;  2WWW A;  2EIK C;  2P9L F;  1K8K F;  1YJ9 V;  4DXW A;  2H94 A;  2EIJ B;  1Y66 A;  2AHZ A;  1R3L C;  3UM7 A;  4BAY A;  4CZZ A;  1Q7Y W;  4FIP C;  3OAA G;  1SET A;  3K0G A;  5IY5 B;  3CXJ A;  1VQ7 V;  4P9O A;  2YEV B;  2ZD9 A;  3OEE G;  3MHS C;  2P9N F;  3GB7 C;  1R3J C;  3CCQ V;  2BSI A;  2BOC C;  4GF3 A;  1VQ4 V;  4RUF A;  1RPR A;  3JD0 A;  1QR9 A;  3W7U A;  2UXX A;  1K5Q A;  2IJK A;  3WG7 B;  2WLL B;  3A0R A;  5LGU A;  1F4N A;  1BHB A;  1GM8 A;  2EIN B;  1QLN A;  4LP8 A;  4ZBM A;  2JEU A;  2WLM A;  5IDJ A;  3ULE F;  4QPJ A;  1V54 C;  1N5B A;  3CCR V;  3E89 A;  2DQ3 A;  4U7N A;  1GM7 A;  3ABT A;  1OCZ C;  4R8C A;  4YXW G;  4MVS A;  4N23 A;  3ETE A;  4JMF B;  2P9I F;  3AG3 B;  3ZRS A;  3LUT B;  3X2Q B;  4GCZ A;  1H8E G;  2QTO A;  1NH2 D;  3VOU A;  3G4S V;  3NXS A;  1OCZ B;  5EBW C;  4MVQ A;  5EBL C;  5J9P C;  3UKU F;  1MAB G;  2XAS A;  1W0K G;  4JF3 A;  3W7T A;  3EFF K;  3E86 A;  3E8F A;  2OTJ V;  2EIL B;  1NH2 B;  3M99 B;  2DW4 A;  1PNK A;  2QM7 A;  3CCU V;  3DWL D;  4XDJ A;  5H6R A;  2XOK G;  3T4D A;  4N21 A;  2OT5 A;  2ZXW B;  5LHI A;  1QLE C;  1GK9 A;  1GKF A;  4L87 A;  1S28 A;  2JJ2 G;  5H9C A;  4MTO A;  1QVG U;  4F4L A;  1YJW V;  3F7Y C;  4TSF G;  4UVA A;  1YTF D;  3KXY A;  1NJI W;  2HR3 A;  5B1B C;  2EIM C;  3G71 V;  3ZIA G;  1FFT B;  2OCC B;  2XAQ A;  3D3I A;  3SYO A;  5CBF A;  3DXM F;  1VQM V;  4MW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...