1K3EA

Type iii secretion chaperone cest
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
141
Chain Sequence
b'MSSRSELLLEKFAEKIGIGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNSNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLKIEEISS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CesT
publication title Structural and biochemical characterization of the type III secretion chaperones CesT and SigE.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Chaperone
total genus 35
structure length 141
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05932 CesT Tir chaperone protein (CesT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.390 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1k3eA01
3.30.1460.10 Alpha Beta 2-Layer Sandwich Yope Regulator; Chain: A, Yope Regulator; Chain: A, 1k3eA02
1L2WA 2BSIA 1N5BA 1XKPC 2FM8A 1S28A 1JYOA 3CXJA 1K3EA 3TU3A 4G6TA 1K6ZA 3KXYA 1XKPB 4JMFB 2PLGA 1JYAA 4AKXA 1TTWA 3EPUA 2BHOA 2BSHA 2BSJA 1K3SA 1RY9A 4GF3A 2XGAA
chains in the Genus database with same CATH superfamily
3K57A 2YXHA 3QO5A 5LMNO 3B8MA 1KYOF 4U3JA 4X8AA 1K8KD 1WB8A 4PDMA 2QDOA 3FYIB 2YEVA 1FJGO 3ZS8C 3CP1A 4GX1A 1YCIA 1JVMA 1PNKA 1K97A 1DF5A 4U7OA 1JPXA 3B77A 4Z2WA 4CS4A 4I7ZB 4G28B 1GKFA 3RYCB 5EC1C 4JI2B 5KHGA 4DR7O 2P9PD 3PJSK 1QLNA 4DV5B 1WP8A 1TGOA 4F6RA 2B1GA 4LFAO 1H8HG 1UJWB 2HEPA 4FM0A 1VQPV 3WB0A 5IY5B 1YDXA 5LMUO 4PA4A 3N2GB 4DUZO 2DWEC 1SRYA 4IYIA 1YEWA 2CUGA 3WG7C 5HFLA 2DWDC 4TQFA 4CC5A 1FXKC 1SQBH 4N21A 2YI8A 4JI3B 1Q6IA 5H6QA 1AP6A 2LPUA 4JI5B 2Q5ZA 1TYQF 1JFFB 4DV7B 1MABG 2IJJA 3RYIA 1ZUQA 3UKUD 2DYTA 2Z0AA 2F1MA 4DR1O 3STZC 3FB7C 1AVMA 2QM8A 4RAIA 1FXKA 4J9ZB 4UVAA 4BAYA 4WBNB 5KA5A 1ZSPA 2XHBA 3CB2A 3SR2C 3JAKA 3EVKA 1HNZB 2WLIB 5KUKA 2VS0A 4X89A 3RSEF 3SPIA 3CXHF 4PA6A 5BMVB 1Q90D 3SYPA 5EBWC 2E76B 4DUYB 5F2VO 3LSUA 1EFRG 4ZHQA 1Q82W 4JTDB 4FM1A 4MS2A 3W7TA 3AG4C 2JS5A 5B1OA 4O2AB 1I94B 2OIEA 4JYCA 5J9PC 1B3QA 5EBLC 3CRMA 3JAMN 5CB4A 4FFBA 3G6EV 3CC4V 5C8YB 4FLUA 2FB5A 3STLC 3VQWA 2BSJA 3FAVA 2ADPA 1H2GA 2VQEO 3SJAC 3QO8A 1Q7YW 1K73W 1NTMH 3APQA 2PI4A 2GTAA 1OCRB 2HJFC 2ZD9A 3OTOB 1XMQB 2ITCC 3CX5F 5KAFZ 3UQ8A 4QIWF 4W4KA 2CTPA 2W0XA 4NVPA 3IJ4A 2QWRB 4ABMA 4YJ3B 4TV9B 5KHJA 3CE2A 2UUAO 2W6IG 1F7YA 1OHHG 2F66C 4LF9O 4DO2A 4DV3O 1Q43A 1WA8A 5KAIZ 2P06A 3ZRSA 2EILC 1NTZH 3BPZA 1PV0A 1K4CC 3I55V 2JVDA 4MVZA 4JV5O 3UT5A 1QLEB 3KG2A 5IYBO 5EZYB 1E1QG 3OEHG 1KKDA 3IGAC 1SERA 2YSUB 4B08A 5LHHA 3FB6C 3D8CA 3T1HB 1PP9H 4DR4O 1P7GA 4O4IB 1OZ0A 2UUBO 3CPWU 4PDLA 1M5IA 1TVKB 3OUFA 2Z3YA 2E74B 4KHPO 3S3WA 3SPGA 2KG7B 1FFTB 1OCCC 4DV6B 4DW0A 2X6AA 2VQFO 2YC0A 3ZCCA 4K8ZA 2XTAA 4DV0O 3JCZA 3TK1A 1HWYA 5IY5C 1THZA 4EFBA 5J2UB 3OD4A 1S5JA 2P4VA 1YJNV 3E86A 4GKJO 1JOYA 3RYCA 2EIMB 3E2EA 4K0KO 2R72A 4DV2O 2JGUA 4FJCC 4TSFG 4BR6A 3H1JH 4GT1A 1CXZB 1FS0G 3M8AA 5KHKA 2EIJB 4ZOLB 3L71H 4JZGA 1A32A 5BR8B 2D2CB 4DK0A 5FL7G 2BTOA 5LL6Y 1PNLA 1H2NA 3OR7C 1PM9A 3CC2V 3N2GA 4OX9B 4DW1A 5FNVB 4LWSB 3F5TA 5LGNA 2XT9A 3JSLA 4JI0O 4ZKIA 5B1NA 4LC1A 3ZMVA 1IBLO 2DJVA 4UV9A 4MTXA 4XDJA 5CBGA 2D3OW 3TCUA 2LO1A 3VX8B 3OTFA 2PLGA 2P6JA 1XILA 1MOFA 2DYSB 2P9ID 3DXMD 1R6TA 1JFFA 2HP8A 1ORQC 3LDEA 4GSLC 2YXLA 3K58A 5LOVB 5D5PA 1RFYA 1DK1A 1MSWD 5DEDA 4WBNA 2A9HA 4DV1B 1R3KC 1AP5A 2QSAA 3A0RA 4IGGA 2WLIA 2EINB 2IH1C 3K5LA 2BTQB 1HDJA 1R6NA 2FKXA 3UO3A 4X65B 1NI8A 2ZDIC 1Q86W 1SA0B 2OCCC 4IIJB 4JI4B 2HFEC 3K79A 3ZHRA 5BMVA 4LF5B 3CCVV 2XAGA 3RYFB 1GTOA 3X2QB 1KQSU 5IJ9B 2JDIG 1N0JA 4LNUB 3E89A 2LFSA 1J5EB 1VARA 1BQZA 1OCRC 1YITV 3AK2A 1GRJA 1VF7A 1EBOA 4DV4O 4FM2A 4O2AA 4HAMA 4XEIF 3JSNA 1FAFA 1KC8W 2ZDIA 3T1CA 3CCLV 2BCCH 1NR7A 1ZAUA 3VX7B 5EK0A 5C8YA 4WFGA 1KMIZ 3WU2Z 4H13B 1G8MA 4RWUA 3GB7C 4PA3A 4B3SB 1QBZA 4YIOA 1P7BA 4Q6GA 4J10A 3K5NA 2B1IA 2LQTA 5E79Z 4DR2O 4PA7A 3E8BA 1QLEC 4U3FH 3ZMTA 4G27B 4YY3B 4YJ3A 1B6QA 4TV9A 2UUCB 1KBHA 3A2FA 3ZMZA 1M56B 5KX5B 1RSOB 2JEXA 1BGYH 3K06A 3ZMSA 1R6KA 3RT3C 1H2LA 2B5UA 1YTFB 3T1YO 2ARHA 5EZYA 1N34O 2QWQB 3RVYA 2E5LB 4DR5O 1R3IC 4AILC 1VQMV 1G6UA 4NR1A 3OFNG 2CTRA 1BSMA 2YIDA 5LA6B 3SYAA 3VQXA 1XKPB 4O4IA 1JQ0A 2OCHA 4RQEA 3M7MX 2F43G 4HNAB 2EIMC 1TVKA 2ZKOA 1U2VF 4CZZA 3EPUA 2IJKA 1Q81W 3ZMUA 4I9WA 1IBKO 2PYJA 2KG7A 4QPJA 2ZR3A 2EIJC 4O2BB 1Q3EA 4JI1O 5IYCO 4H33A 3DXKF 4IYHA 5A9GA 2DYRB 4HYOA 4G6TA 2Y0PA 2QKAA 1SZXA 2XAJA 1BS3A 5J2UA 1XHZA 5CA3A 3FD9A 1WNSA 3LUTB 2HJDA 2AZ2A 3VQVA 4EB6B 4DK1A 2Y48A 4D7SA 5KLVH 5L3BA 1DTOA 3CCJV 3ASOB 2EIKB 3DGEA 3ZRWB 4MVSA 5FPRA 3OEEG 4B3RO 5CBHA 4ZOLA 5LXTB 4JI8O 3B8NA 3OUSA 2XAQA 1OCOB 1I5XA 2DYSC 3G4SV 1VQ5V 2LFRA 1MSDA 3SPJA 4MTOA 5B3SB 4NXNO 1SQPH 1NT2B 4DR6B 1VQ7V 3CXCU 2BOBC 2OWOA 1HNXO 4WFBV 2H94A 1N36O 5FNVA 1S76D 4LWSA 3H01A 1ROPA 3BFRA 1LUVA 1PPJH 4AQYB 5E1AC 5H9CA 3IAYA 2F93B 4X62O 3ASNC 3L70H 3K59A 2XNDG 1H2MA 1IBMO 4UCVA 3K9AA 4PDRA 1GH6A 2OT5A 4FLWA 4ASUG 2P9LF 2BSKA 1HR0O 2UXXA 1N32B 2G38A 2EINC 2ZE5A 1YTFD 4LP8A 4LF6O 2H3OA 2ZE6A 5B5EZ 2NNUA 2P9PF 1JA8A 3X2QC 2QWPB 5LOVA 1XNRO 4FLYA 2HLDG 4PA9A 4JZ2A 4W4LA 3ZIAG 1R73A 3DSQA 1TTWA 2CE4A 3H1LH 1KB9F 3O9OA 3FB8C 2BTQA 4UUJC 2NR5A 1I08A 2N74A 1SKVA 1SA0A 5IWAB 4IIJA 5K1XA 5JH7B 3W7WA 2UXCO 1N5BA 4QGPA 5B1AB 3BHPA 3RYFA 2ZXWB 5IJ9A 4GZRB 2P9UF 4X88A 2AHZA 4LNUA 2UXDB 1S5HC 2A06H 2W0FC 2P4KA 1O9GA 1FXVA 4CS3A 3UKUF 4LFBB 2WWWA 5CBFA 3BABA 1NKDA 3H1HH 4QE7A 2RJZA 2KQXA 1XEQA 1VQKV 1L0NH 1XREA 1IZ3A 3TXQA 4AI8A 2P5OA 3P3NA 5CA1B 4JI7B 3ZHQA 2V4DA 2E75B 1RP3B 5BY1A 2F4VO 2ZNIA 1XI1A 1GN3A 2XGAA 2ILMA 1W0JG 4X66O 3L73H 3RBZA 1HNWO 1AJNA 5LHGA 5L3DA 3LNNA 2IBZH 3CEIA 5JCOC 2P7TC 4R8CA 2IM9A 3BY6A 2EJ7A 1CP9A 3ETEA 5EYPB 4PV1B 5ITZB 4PELA 4QNHB 3HKDB 3KZIZ 1NQTA 4MVQA 5KX5A 1Y74B 2P9SF 3ZHVA 4OXSA 4J7JA 4LF8O 2EJRA 1RSOA 3B40A 4X9QA 5EBMC 3UCSC 3CCRV 2ITDC 2EZPA 4UB8Z 5JCOA 1M90W 2YI9A 2OTLV 3K9SA 1FXHA 5KUMA 2JJ1G 4I55B 4KFMA 3RYHB 3RN4A 3CSXA 4JD2D 4B3MO 1XBLA 2UU9O 3CRCA 3A0HZ 2N05A 5LA6A 4KP4A 4B3TO 4H0LB 3E35A 3PN1A 4HNAA 2OIGA 3BEHA 3ASOC 2EIKC 3K5OA 1M4UA 3CMAV 2AZ0A 4O2BA 2GTSA 4UVCA 4YHHB 1HW7A 4TWKA 2YDEA 4BW5A 2Q69A 3E22B 5B3SC 1V55C 2ODMA 3BA9A 3HKBB 5JVDB 4FZ1A 4JYAB 4H44B 4EB6A 3AG3B 4GX2A 1VF6C 2IJIA 3H9VA 1XMOB 2Y4TA 3QF7A 1ZL8B 1S77D 3ZRWA 2M6YA 2P9NF 3IC7A 2XASA 5LXTA 3SDLA 5DECA 1QR8A 1AI4A 1RM1C 3ETDA 1K3EA 2JJ2G 4CBCA 1XL4A 5JJEB 1KUQA 2EBOA 4JASA 5KHHA 4NXMB 3OM3B 1AILA 1VF6A 5KA6A 3DC6A 4IT5A 1F23A 2GHYA 3ZEDA 4L87A 2CDYA 2X7RB 3JALB 4X64O 2ZR2A 1QVGU 2YICA 4L8JA 4UCSA 2ZM6B 2RN9A 3JARB 4JI6O 4FLXA 3Q4HB 3ETQA 3OMIB 1GO3F 3EHBB 2Q67A 3AG1B 1EN6A 4GKKO 3TGUH 2HHHB 3GVMA 1S3JA 3FYEB 1OV9A 5B1AC 4B7EA 1LR1A 4F4LA 3S3XA 2ZXWC 2QEXV 2H8PC 5L3FA 3A8TA 1NVPB 5A2QN 2CK3G 4LF7O 4MVMA 1J95A 4DR3B 1R3JC 4I50B 1N4CA 3EFFK 4LF4B 1LNQA 1N33O 3U11A 1S5LZ 3CCQV 2ZNJA 1IXBA 4UCOA 4X20B 2RCVA 3CJHB 4UCUA 1IVSA 4NKGB 5EC2C 2UXBB 5JH7A 1XNQB 2WA3A 2IU0A 2ZINA 4LF6B 3I5DA 3QG5A 3CCSV 4JPRA 1O9HA 3DXRB 3ULED 1YSCA 1BZKA 5EIBD 2P9IF 5LMNB 2DQ3A 2ZIOA 3JATB 3WB1A 2YIAA 4LFCO 2YXYA 3DXMF 1VIBA 3ABLB 1GM7A 4XDKA 4CS2A 5D5QA 1FJGB 4FVMA 1VF5B 1AI7A 1AJPA 2W6JG 1V9PA 3QVNA 2MK3A 3C90A 2QM7A 3D3QA 3DTUB 3AK1A 5CA1A 4DR7B 1F51A 4FLTA 3FB5C 4AKXA 2Q6AA 2F95B 2QJ1A 4I4TB 4B7KA 3C3TA 4LFAB 2DE0X 1TUBB 2PF4E 4MW3A 3AEIA 3ABKB 1V54B 2KKWA 3CS5A 1L2WA 5C93A 2WLJA 5LMUB 2RQ6A 5HFMA 3CYOA 4WFAV 4DUZB 4PI0A 1YHQV 1I7FA 3H1KH 3IFXA 4UVBA 2WLMA 5EYPA 5ITZA 1G1XB 1H8EG 1L0LH 1XHXA 2ETNA 5LHIA 1AR1B 3HKDA 4H37A 4JI2O 1Y74A 1AR4A 1NU1H 3FFQA 3C3SA 4DV5O 3SYQA 2F4VB 4OPAA 1KU9A 2YS8A 2UXNA 4NTWA 4K35A 1NVPD 5L3EA 2P9KF 3ABTA 4I55A 1SETA 4DR1B 2QKCA 3RYHA 2AHYA 3KCXA 3G67A 5IYDO 1NTKH 2XOKG 3SJBC 1M1KW 3F7VC 3L74H 3AG3C 1F4MA 2ZQMA 3K04A 2ATKC 2Y4UA 3SJQC 2P90A 4P9PA 4A5UB 4H5BA 2XAFA 4JI3O 1S72V 3SGIA 1YIJV 2OD0A 4HBNA 1JJOA 1IXMA 4JI5O 3HPLC 3BAAA 5CA0B 3W7XA 4DV7O 4RUFA 3E22A 2BE3A 1K33A 4GX5A 3JCUZ 1K4DC 3BCCH 3HKBA 5JVDA 1P84F 5FLXN 1W2BU 1BMFG 4WFEA 3ZBHA 2VRZA 4FK5C 4BIZA 3TXSA 1ZL8A 1Y76B 1YVWA 1HNZO 3EXAA 2Q68A 5H6RA 1QQCA 3OMAB 4ZIBA 2VQEB 3ZHTA 2B9ZA 4GX0A 1VEWA 4XEID 3BA8A 4DUYO 3RGBA 4NB5A 2L35A 2JIZG 2LGQA 3CCEV 4YJ2B 2EX3A 2AGAA 4X1YB 1Z5VA 3O65A 1NJIW 4XDLA 3OMNB 1KKCA 4BIOA 3J81N 5IT9N 3CC7V 3JALA 3JAWB 3ABUA 3D3IA 3JARA 2LGWA 3Q4HA 2V1DA 2UUAB 1QVFU 3TU3A 4K8XA 2IW5A 3W7SA 4LF9B 3R65A 4DV3B 4O4HB 1WPXA 2Q0AA 4X1IB 3DWLD 3B2EE 4YIPA 4MVRA 3OTOO 1XMQO 2DOSA 4ZHQB 1H2SB 1XL6A 4JV5B 1QR9A 1M57B 4J41A 4I50A 4R7CA 3ABMB 3NR7A 4JAUA 4DXWA 4EBRA 1GAXA 1WJZA 3ABLC 3KCYA 4X20A 4JYYA 3CJHA 4JAAA 2R9AA 3MHHC 4X1KB 4FFKA 4IHJB 3ZRVA 1BHAA 1MZFA 1H2KA 1D2DA 5LBQA 4DR4B 1Z5WA 1K3SA 2UUBB 1DLBA 4Z1VA 2P67A 3DXRA 3JASB 4JF3A 4JTCB 4KHPB 4UFZA 4EFEA 3OGIB 4UB6Z 3JD1A 1F4NA 3JATA 2IJHA 4QPKA 3OAAG 3A0BZ 3UKRF 1K9MW 1QNMA 2VQFB 1EM1A 2YIBD 3ABKC 4DV0B 5JJJB 2JEUA 2CH7B 3F5WC 2Q4PA 3VQYA 1K8KF 1VQ9V 3OE7G 4J7ZA 1B04A 1I0HA 4RO2A 3T1HO 4GKJB 1GN4A 3L75H 4K0KB 4DV2B 3CXJA 1VQLV 2PY5A 1Q5OA 3DXKD 2WAMA 5DM6V 4I4TA 1Y67A 2FL4A 2KC5A 1QCEA 3M99B 2NLJC 3B09A 1TUBA 5IDJA 1WN7A 1FKAO 1MMMA 3L9DA 2Q0OC 4DV6O 2AW9A 3QO7A 2A79B 5AG2A 2WPDG 1L1FA 5H5NA 4JI0B 2C2AA 2A3QA 3HKCB 1IBLB 5IYZB 2RMKB 3SJCC 3E83A 3HB3B 4JYBA 5LYJB 4JAVA 3E8HA 2R70A 1COWG 3VBBA 1SQVH 4IL6Z 3MDSA 3K5MA 2ZCEA 1DF4A 1URFA 3B4SA 4BW9A 5BR8O 3E8GA 5JJNB 1BT8A 2WA4A 1UFIA 2LJ2A 2P9LD 3ZHSA 3GWKC 2OYQA 4OX9O 1SC5B 4JGSA 5TISZ 3OT7A 3AG2B 4E4EA 5BZBA 2Q9LA 4D7TA 5CN0A 2QTSA 1PL4A 3ZJZA 4TQDA 2DW4A 3THOA 1N8RW 3OGCC 1OCCB 3K03A 3HR0A 4TUYB 2ZE8A 2RDCA 4RQFA 2Z5UA 3E8FA 2QTOA 3CRQA 3N27A 5CA0A 3GWOA 1M9NA 1VQ4V 1M56C 3J7AU 3BRCA 1GN2A 3IC9A 4D6TH 2DQ0A 3I56V 2FM8A 3ZHUA 3UM7A 2PTMA 4DV4B 2YIBA 4PHZA 4DV1O 1B06A 2P9UD 1AJQA 4OPHA 1Y76A 4P9OA 4HZ3A 5B1BB 2JS3A 5GTIZ 4JD2F 3ICXA 4X65O 3K3WA 2R9IA 4JI4O 4MW8A 4WFFA 3HKEB 4LF5O 1K5QA 4OGQB 1EZVH 1SS3A 2X0LA 1R3LC 1XKPC 1Y66A 4TOIA 3RW0A 2PGGA 3UO2A 1FFXB 3K0DA 1J5EO 3KXYA 4DR2B 1JX9A 1ZWIC 1UPGA 4EKWA 4YJ2A 4JTAB 2IH3C 5DN6G 4X1YA 3DC5A 2GV9A 1N0NA 5KMGB 4UCRA 1M57C 2AXTZ 3JAWA 1K5SA 3ABMC 2PI5A 3AK3A 2MQDA 2DYRC 1SQFA 3CCMV 3OW2U 3CHXA 1JYOA 4CH5A 4LBEC 1TYQD 3MAQA 4B3SO 1Z2GA 3CD6V 4FPPA 4N23A 2ZE7A 4O4HA 3RVZA 4X1IA 1Y4MA 3LDDA 1IURA 2RNBA 1NR1A 2CGNA 4PDVA 2WLHA 3T1YB 3SPCA 1P49A 1OCOC 1PL0A 1N34B 4DR5B 2P9SD 2QA4V 2DMXA 4UCTA 4R6ZA 2WLLB 1XQ8A 4YY3O 2OCCB 1FD9A 1QU7A 4X1KA 2QR4A 4F6EA 4UV8A 2UUCO 4IHJA 5L3CA 3RSED 2M7WA 4P30A 5H2FZ 2L6LA 1YF2A 3G71V 1BE3H 3JASA 4QE9A 3U0ZA 1DGSA 1VQ8V 1IBKB 1R1BA 2A7WA 2N04A 4MT8A 1PKXA 4JI1B 1VQOV 1US6A 4MTGA 1YJ9V 4FLVA 2QWNB 4KXRA 2CH7A 4CH6A 2FYUH 2E5LO 3OR6C 3WB2A 4PD4F 1VQ6V 5GONB 4GF3A 1X4TA 3KKYA 1WP7A 3T4DA 4O4JB 4J42A 1H38A 2P22C 1AR5A 4LCUC 1YXBA 3FX7A 4GCZA 4B3RB 1SESA 1K6ZA 3LSSA 2YUAA 1W59A 1AI5A 4I0XB 1IDSA 4NTXA 4JI8B 4JMFB 4FLZA 5L3GA 4NXNB 1MA1A 3N2KB 5FPOA 1HNXB 1N36B 1GN6A 2BSIA 2P9ND 3ULEF 1SQQH 5LP6B 4TT3G 2GUZB 3HKCA 4LH6A 4X62B 5IYZA 3CCUV 5B66Z 4KL1A 4O4LB 1IBMB 2LW1A 4J80A 1K8AW 3AG2C 1U97A 3VOUA 4WFHA 5LYJA 2CTWA 4K3AA 1Q6UA 1HR0B 2BHOA 1BCCH 2E3CA 2A0LA 3UKMA 3K0GA 5IJ0B 1EN5A 1Y6XA 4CH3A 1KP2A 4FMTA 2VWJA 1EN4A 1HP8A 4J9YB 4FZ0A 2EZOA 4WF9V 4DR6O 4GLXA 4QJFB 1XDCA 1XNRB 1ZLZA 1JYAA 4AQYO 1KP3A 3JD2A 1G4YB 1GK9A 5J2TB 1NBMG 3K08A 1OJHA 3ZN1A 3ETGA 1SQGA 2Q8VA 1YZBA 1SQXH 2F23A 2QWOB 3QNEA 1YJWV 1N32O 4TUYA 5B1BC 2UXCB 1BQ0A 3TETA 3JD0A 1XUQA 2WLKA 4RUEA 2HG5C 4ZI7B 3CWBH 2O57A 4R50A 1I5YA 1OCZB 4NTYA 2K1EA 1NS1A 3P3PA 4XBFA 2V7QG 1EZJA 5JQGB 4CH4A 2Y69B 4MVUA 1E79G 2BSKB 1VQNV 5IWAO 1RPRA 2NN4A 2JGDB 2JK5C 2Q73A 1U96A 4DRXB 1JMKC 3HKEA 4TV8B 2IU3A 1Q8IA 2HR3A 2FTKA 2XUMA 1TAEA 1VMGA 4NYKA 1FFXA 1JR9A 2UXDO 3ASNB 4X66B 5GTHZ 1NH2B 5GW7A 1HNWB 4U3JB 3MD0A 2R9RB 1TUEB 2FMLA 5KMGA 3ZX6A 3CMEV 1LUWA 2YEVB 4LFBO 3W7UA 1WB7A 1K34A 4GYCB 4YXWG 1PD3A 5EIBC 4LR3A 2BOCC 4C7UA 1CEZA 3U10A 1S28A 4JI7O 2GDSA 1ENVA 4LF8B 1BL8A 3LSQA 5CMUA 1CPYA 1ZTEA 4F6RB 2QE7G 4UXNA 5K1PA 2ADQB 1TA8A 1FPOA 4U7NA 4KUMA 1MG1A 3CRRA 1BHBA 3ZN0A 4AHCA 2MW2B 2WLLA 3L72H 1GM8A 4B3MB 2UU9B 3SYCA 4BIUA 3P30A 4B3TB 3RWRD 1VP7A 2X6BA 2P9KD 3JD4A 1D5NA 1RY9A 1AI6A 1GM9A 2JRIA 5JWPA 1L8DA 4ICGA 3TJTA 1NZ6A 3AG1C 2Q7GA 3RYIB 3T4ZA 3J80N 3APOA 4ZBMA 4P2ZA 1AROP 2DN9A 2OTJV 3DWLF 5KHIA 1RPOA 2ZIMA 3FKSG 3WG7B 5GONA 2QM4A 1JJ2U 4WCEV 1QHTA 1FXKB 4O4JA 5LP6C 3JYCA 1I94O 3JAKB 3T2MA 2CGOA 1P4RA 3JD3A 4I0XA 4G2KA 3AG7A 2KSDA 5BXZA 1WLEA 1NH2D 1SZTA 3D36C 4YHHO 2ZT9B 1D5AA 3N2KA 2WSSG 4FIPC 2BSHA 1T5EA 4DYLA 4MTFA 2Q7HA 3ML0A 5LP6A 2GUZA 4PJ0Z 4JYAO 3P32A 2GSMB 4O4LA 3R66A 4X64B 1XMOO 4JI6B 5CB4B 5LGTA 4FFBB 3CRAA 3D36A 3G6BA 4Q20A 1Q6HA 3G80A 4CC6A 4GKKB 2EULA 5IJ0A 1E1RG 1WPBA 3FAVB 2PYLA 2HVJC 3H1IH 1GMGA 1FYJA 1K7DA 1MZEA 4NXMO 1S0VA 2PZSA 4LF7B 4Z1MG 1X59A 3AG4B 1K92A 2X6CA 1N33B 1YI2V 5IE9A 5LGUA 4GUNA 1V54C 2XAHA 1JCHA 1OCZC 1W0KG 2HVKC 1KECA 1IX9A 5J2TA 4PI2A 2LW7A 1U2VD 3NXSA 2ZM6O 2KB1A 2Y69C 2K9PA 1WAZA 2CTQA 2HHHO 1PNMA 2QGNA 3LNMB 2QKSA 1V55B 1WA8B 4EEQA 4MSWC 3SYOA 1M93A 3F7YC 1ZX3A 2HKOA 4ZI7A 4J7KA 4LFCB 3BVOA 3UT5B 3LDCA 4DR3O 4J11A 4LH7A 4LF4O 3SPHA 3MHSC 2CAZC 5JQGA 2PUSA 1AB3A 4BWAA 2LP7A 4E2LA 1RM1B 4I5SA 4MVOA 2WLNA 2UXBO 1KD1W 1SF9A 3RFRA 3QTCA 3ZRXA 2JGDA 3UKRD 2GBOA 1MNGA 2Y0IA 4DRXA 1XOUA 4TV8A 1XNQO 4I9QA 2Q7EA 2EILB 3WFVA 2VWKA
chains in the Genus database with same CATH topology
3ZMZA 1OCOC 1PL0A 1M56B 2QM7A 3QO5A 2P9SD 3B8MA 4X8AA 2QA4V 1K8KD 4R6ZA 4PDMA 3DTUB 2WLLB 2OCCB 1F51A 2JEXA 3FYIB 3K06A 3ZMSA 2YEVA 1R6KA 4UV8A 3FB5C 4AKXA 2B5UA 3CP1A 2Q6AA 5L3CA 4GX1A 1YTFB 2M7WA 4P30A 3RSED 1JVMA 1PNKA 1K97A 1DF5A 4U7OA 1JPXA 3B77A 3G71V 4MW3A 3AEIA 3RVYA 3ABKB 1V54B 4QE9A 1R3IC 4G28B 1GKFA 1L2WA 5C93A 5EC1C 1VQ8V 2P9PD 2WLJA 3PJSK 1VQMV 3OFNG 5HFMA 3CYOA 1PKXA 4MT8A 4WFAV 1VQOV 1QLNA 4MTGA 1YHQV 3SYAA 3IFXA 1XKPB 4UVBA 2WLMA 1JQ0A 2B1GA 4RQEA 1YJ9V 1H8EG 1H8HG 2F43G 2EIMC 1UJWB 1VQPV 5LHIA 1AR1B 1U2VF 3OR6C 4CZZA 3EPUA 4H37A 2IJKA 1Q81W 3ZMUA 4I9WA 5IY5B 1VQ6V 4GF3A 4QPJA 2ZR3A 2EIJC 3T4DA 4PA4A 3SYQA 1H38A 2DWEC 5IYCO 1SRYA 4H33A 4LCUC 2UXNA 3DXKF 1NVPD 4GCZA 2DYRB 3WG7C 4HYOA 1SESA 5HFLA 3LSSA 1K6ZA 4G6TA 1AI5A 2XAJA 2DWDC 4JMFB 5L3GA 5L3EA 5CA3A 1FXKC 2P9KF 3ABTA 3LUTB 1SETA 2Y48A 4N21A 2AHYA 5L3BA 1DTOA 5IYDO 3CCJV 3ASOB 5H6QA 2EIKB 2XOKG 3DGEA 3ZRWB 2LPUA 4MVSA 1TYQF 3OEEG 2BSIA 1MABG 2IJJA 5CBHA 2P9ND 3ULEF 1M1KW 3F7VC 3UKUD 4TT3G 3AG3C 3B8NA 2DYTA 1F4MA 2ZQMA 3OUSA 3CCUV 3K04A 2XAQA 2ATKC 1OCOB 1I5XA 2DYSC 2P90A 4P9PA 3SJQC 3G4SV 1VQ5V 2LFRA 3SPJA 3STZC 4MTOA 3FB7C 5B3SB 1K8AW 4H5BA 2XAFA 3AG2C 1S72V 3VOUA 3CXCU 2QM8A 2BOBC 4WFHA 1VQ7V 1YIJV 4RAIA 1FXKA 1IXMA 2H94A 3HPLC 4J9ZB 4UVAA 4BAYA 3H01A 5KA5A 4WFBV 1S76D 1ROPA 2BHOA 3W7XA 2A0LA 4RUFA 5E1AC 5H9CA 3UKMA 3ASNC 1K33A 3K0GA 2WLIB 2XNDG 4GX5A 5KUKA 1K4DC 3K9AA 1KP2A 4FMTA 4PDRA 4J9YB 2OT5A 2EZOA 4WF9V 1W2BU 4ASUG 1BMFG 4X89A 2P9LF 3RSEF 3SPIA 4WFEA 4QJFB 4PA6A 4FK5C 4BIZA 2UXXA 1JYAA 2EINC 1KP3A 3SYPA 5EBWC 3JD2A 4LP8A 1YTFD 1EFRG 1G4YB 1Q82W 1GK9A 2NNUA 4JTDB 2P9PF 2Q68A 4MS2A 1NBMG 5H6RA 3K08A 3X2QC 3W7TA 3OMAB 3AG4C 5B1OA 3ZN1A 3ETGA 3QNEA 1YJWV 4GX0A 5B1BC 4JYCA 4XEID 5J9PC 5EBLC 2HLDG 4PA9A 3TETA 3ZIAG 1R73A 3JD0A 3G6EV 2JIZG 3CC4V 1TTWA 2WLKA 3CCEV 4RUEA 3STLC 1NJIW 3FB8C 4XDLA 4UUJC 2BSJA 3OMNB 2HG5C 1H2GA 3CC7V 3QO8A 1Q7YW 1K73W 4R50A 3W7WA 1I5YA 3ABUA 2PI4A 1N5BA 1OCZB 3D3IA 1OCRB 2HJFC 5B1AB 2K1EA 2ZD9A 2ZXWB 4XBFA 2V1DA 2ITCC 2P9UF 1QVFU 4X88A 2AHZA 2V7QG 1EZJA 3TU3A 2Y69B 4MVUA 1E79G 4QIWF 2IW5A 3W7SA 1S5HC 3R65A 1WPXA 1VQNV 2W0FC 3DWLD 1RPRA 1FXVA 2JK5C 4MVRA 3UKUF 2IU3A 2WWWA 5CBFA 2HR3A 1XL6A 1QR9A 1M57B 1NKDA 2FTKA 2W6IG 4QE7A 4R7CA 1OHHG 3ABMB 3ASNB 1NH2B 4JAUA 4DXWA 1VQKV 4EBRA 4DO2A 3ABLC 5GW7A 3MD0A 2R9RB 1TUEB 3CMEV 3ZRSA 3MHHC 2EILC 2YEVB 1K4CC 3W7UA 3I55V 4MVZA 3ZRVA 1BHAA 1K34A 5LBQA 1QLEB 3KG2A 5IYBO 4YXWG 1K3SA 1E1QG 1DLBA 3OEHG 1KKDA 1PD3A 2XGAA 3IGAC 1W0JG 1SERA 2YSUB 3RBZA 2BOCC 2P67A 1CEZA 4JTCB 4JF3A 1AJNA 5LHGA 5L3DA 1S28A 3JD1A 1F4NA 5LHHA 3FB6C 1ENVA 2IJHA 1BL8A 2P7TC 3OAAG 4QPKA 3UKRF 1K9MW 3LSQA 4R8CA 5CMUA 3BY6A 1CP9A 1CPYA 1OZ0A 3ETEA 3ABKC 2QE7G 4PELA 4UXNA 3CPWU 4QNHB 2JEUA 4PDLA 3OUFA 4U7NA 2Z3YA 3F5WC 4KUMA 1NQTA 4MVQA 3SPGA 1MG1A 2P9SF 1K8KF 1VQ9V 3OE7G 4OXSA 2EJRA 1FFTB 1OCCC 4RO2A 3ZN0A 1BHBA 2WLLA 2X6AA 1GM8A 3CXJA 1VQLV 5EBMC 3ZCCA 3CCRV 2ITDC 3SYCA 2EZPA 4BIUA 3DXKD 3P30A 2WAMA 5DM6V 3JCZA 3TK1A 1HWYA 5IY5C 1M90W 1THZA 2KC5A 2OTLV 2X6BA 1QCEA 3M99B 1FXHA 2NLJC 5KUMA 5IDJA 2P9KD 3JD4A 2JJ1G 1YJNV 3E86A 1RY9A 1AI6A 4KFMA 1GM9A 1JOYA 3E2EA 2EIMB 4JD2D 3QO7A 4FJCC 2A79B 4TSFG 2WPDG 4GT1A 3AG1C 4KP4A 1FS0G 1L1FA 2EIJB 2C2AA 3E35A 3T4ZA 4ZBMA 4P2ZA 1AROP 3BEHA 2OTJV 3DWLF 3ASOC 5FL7G 2EIKC 1RPOA 1PNLA 3E83A 3FKSG 3WG7B 3HB3B 4JYBA 3CMAV 3OR7C 4JAVA 3E8HA 1JJ2U 4WCEV 3CC2V 1COWG 1FXKB 3VBBA 4UVCA 5LGNA 3JYCA 4TWKA 4ZKIA 5B1NA 4LC1A 3T2MA 3ZMVA 4BW5A 1DF4A 2Q69A 1P4RA 3JD3A 5B3SC 1V55C 4UV9A 3E8GA 4MTXA 4G2KA 4XDJA 5CBGA 2D3OW 3TCUA 1WLEA 3VX8B 1NH2D 3AG3B 2PLGA 1SZTA 2P9LD 2P6JA 4GX2A 2IJIA 2P9ID 1MOFA 2DYSB 4JGSA 1S77D 3ZRWA 2WSSG 4FIPC 2BSHA 3DXMD 3AG2B 5BZBA 4MTFA 2P9NF 3IC7A 5CN0A 2XASA 1ORQC 3ML0A 3LDEA 1QR8A 1AI4A 1RM1C 4GSLC 3P32A 2GSMB 3ETDA 3ZJZA 2DW4A 1K3EA 2JJ2G 1N8RW 3OGCC 1OCCB 4CBCA 1XL4A 3K03A 2EBOA 4JASA 3OM3B 1MSWD 5LGTA 4RQFA 2Z5UA 2A9HA 3E8FA 2QTOA 1R3KC 3GWOA 5KA6A 3D36A 4Q20A 1M9NA 1F23A 2GHYA 1VQ4V 3A0RA 1M56C 2WLIA 4L87A 2EINB 2IH1C 1E1RG 1R6NA 2HVJC 2X7RB 2ZDIC 1GMGA 1Q86W 2OCCC 2ZR2A 1K7DA 2DQ0A 3I56V 1QVGU 2FM8A 2HFEC 3K79A 3UM7A 3CCVV 1S0VA 3OMIB 2XAGA 1GO3F 1GTOA 3X2QB 4Z1MG 1KQSU 3EHBB 2Q67A 3AG1B 3AG4B 2P9UD 1AJQA 2JDIG 1K92A 4P9OA 3E89A 2X6CA 2LFSA 4HZ3A 1S3JA 5B1BB 1YI2V 3FYEB 5LGUA 1V54C 4JD2F 2XAHA 1JCHA 1OCZC 1W0KG 2R9IA 1OCRC 1KECA 2HVKC 3K3WA 5B1AC 1YITV 4F4LA 2ZXWC 2QEXV 2H8PC 5L3FA 1U2VD 4MW8A 4WFFA 3NXSA 1EBOA 2KB1A 1NVPB 1K5QA 4HAMA 2CK3G 2Y69C 1XKPC 4XEIF 2X0LA 1R3LC 4MVMA 1KC8W 1J95A 1Y66A 1R3JC 2ZDIA 3T1CA 3RW0A 3EFFK 3CCLV 1LNQA 1NR7A 1PNMA 3K0DA 3VX7B 3LNMB 2QKSA 3KXYA 5EK0A 4WFGA 1JX9A 1V55B 1ZWIC 4EKWA 4JTAB 1G8MA 2IH3C 3CCQV 3GB7C 4PA3A 5DN6G 4MSWC 3SYOA 3F7YC 2HKOA 1M57C 1QBZA 1K5SA 5EC2C 3ABMC 2PI5A 1P7BA 3LDCA 2IU0A 2MQDA 2DYRC 2B1IA 3SPHA 3CCMV 3CCSV 3MHSC 4PA7A 4JPRA 3OW2U 3E8BA 1JYOA 4LBEC 1TYQD 2LP7A 3CD6V 3ULED 1YSCA 4E2LA 4FPPA 1RM1B 4N23A 2P9IF 4I5SA 1QLEC 2DQ3A 4MVOA 2WLNA 3RVZA 1KD1W 3DXMF 3ZMTA 3UKRD 4G27B 1Y4MA 3ABLB 1GM7A 4XDKA 3ZRXA 1B6QA 3LDDA 1NR1A 1AI7A 1AJPA 2W6JG 4PDVA 2EILB 2WLHA 3WFVA 3SPCA 2MK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2W A;  2BSI A;  1N5B A;  1XKP C;  2FM8 A;  1S28 A;  1JYO A;  3CXJ A;  1K3E A;  3TU3 A;  4G6T A;  1K6Z A;  3KXY A;  1XKP B;  4JMF B;  2PLG A;  1JYA A;  4AKX A;  1TTW A;  3EPU A;  2BHO A;  2BSH A;  2BSJ A;  1K3S A;  1RY9 A;  4GF3 A;  2XGA A; 
#chains in the Genus database with same CATH topology
 3K57 A;  2YXH A;  3QO5 A;  5LMN O;  3B8M A;  1KYO F;  4U3J A;  4X8A A;  1K8K D;  1WB8 A;  4PDM A;  2QDO A;  3FYI B;  2YEV A;  1FJG O;  3ZS8 C;  3CP1 A;  4GX1 A;  1YCI A;  1JVM A;  1PNK A;  1K97 A;  1DF5 A;  4U7O A;  1JPX A;  3B77 A;  4Z2W A;  4CS4 A;  4I7Z B;  4G28 B;  1GKF A;  3RYC B;  5EC1 C;  4JI2 B;  5KHG A;  4DR7 O;  2P9P D;  3PJS K;  1QLN A;  4DV5 B;  1WP8 A;  1TGO A;  4F6R A;  2B1G A;  4LFA O;  1H8H G;  1UJW B;  2HEP A;  4FM0 A;  1VQP V;  3WB0 A;  5IY5 B;  1YDX A;  5LMU O;  4PA4 A;  3N2G B;  4DUZ O;  2DWE C;  1SRY A;  4IYI A;  1YEW A;  2CUG A;  3WG7 C;  5HFL A;  2DWD C;  4TQF A;  4CC5 A;  1FXK C;  1SQB H;  4N21 A;  2YI8 A;  4JI3 B;  1Q6I A;  5H6Q A;  1AP6 A;  2LPU A;  4JI5 B;  2Q5Z A;  1TYQ F;  1JFF B;  4DV7 B;  1MAB G;  2IJJ A;  3RYI A;  1ZUQ A;  3UKU D;  2DYT A;  2Z0A A;  2F1M A;  4DR1 O;  3STZ C;  3FB7 C;  1AVM A;  2QM8 A;  4RAI A;  1FXK A;  4J9Z B;  4UVA A;  4BAY A;  4WBN B;  5KA5 A;  1ZSP A;  2XHB A;  3CB2 A;  3SR2 C;  3JAK A;  3EVK A;  1HNZ B;  2WLI B;  5KUK A;  2VS0 A;  4X89 A;  3RSE F;  3SPI A;  3CXH F;  4PA6 A;  5BMV B;  1Q90 D;  3SYP A;  5EBW C;  2E76 B;  4DUY B;  5F2V O;  3LSU A;  1EFR G;  4ZHQ A;  1Q82 W;  4JTD B;  4FM1 A;  4MS2 A;  3W7T A;  3AG4 C;  2JS5 A;  5B1O A;  4O2A B;  1I94 B;  2OIE A;  4JYC A;  5J9P C;  1B3Q A;  5EBL C;  3CRM A;  3JAM N;  5CB4 A;  4FFB A;  3G6E V;  3CC4 V;  5C8Y B;  4FLU A;  2FB5 A;  3STL C;  3VQW A;  2BSJ A;  3FAV A;  2ADP A;  1H2G A;  2VQE O;  3SJA C;  3QO8 A;  1Q7Y W;  1K73 W;  1NTM H;  3APQ A;  2PI4 A;  2GTA A;  1OCR B;  2HJF C;  2ZD9 A;  3OTO B;  1XMQ B;  2ITC C;  3CX5 F;  5KAF Z;  3UQ8 A;  4QIW F;  4W4K A;  2CTP A;  2W0X A;  4NVP A;  3IJ4 A;  2QWR B;  4ABM A;  4YJ3 B;  4TV9 B;  5KHJ A;  3CE2 A;  2UUA O;  2W6I G;  1F7Y A;  1OHH G;  2F66 C;  4LF9 O;  4DO2 A;  4DV3 O;  1Q43 A;  1WA8 A;  5KAI Z;  2P06 A;  3ZRS A;  2EIL C;  1NTZ H;  3BPZ A;  1PV0 A;  1K4C C;  3I55 V;  2JVD A;  4MVZ A;  4JV5 O;  3UT5 A;  1QLE B;  3KG2 A;  5IYB O;  5EZY B;  1E1Q G;  3OEH G;  1KKD A;  3IGA C;  1SER A;  2YSU B;  4B08 A;  5LHH A;  3FB6 C;  3D8C A;  3T1H B;  1PP9 H;  4DR4 O;  1P7G A;  4O4I B;  1OZ0 A;  2UUB O;  3CPW U;  4PDL A;  1M5I A;  1TVK B;  3OUF A;  2Z3Y A;  2E74 B;  4KHP O;  3S3W A;  3SPG A;  2KG7 B;  1FFT B;  1OCC C;  4DV6 B;  4DW0 A;  2X6A A;  2VQF O;  2YC0 A;  3ZCC A;  4K8Z A;  2XTA A;  4DV0 O;  3JCZ A;  3TK1 A;  1HWY A;  5IY5 C;  1THZ A;  4EFB A;  5J2U B;  3OD4 A;  1S5J A;  2P4V A;  1YJN V;  3E86 A;  4GKJ O;  1JOY A;  3RYC A;  2EIM B;  3E2E A;  4K0K O;  2R72 A;  4DV2 O;  2JGU A;  4FJC C;  4TSF G;  4BR6 A;  3H1J H;  4GT1 A;  1CXZ B;  1FS0 G;  3M8A A;  5KHK A;  2EIJ B;  4ZOL B;  3L71 H;  4JZG A;  1A32 A;  5BR8 B;  2D2C B;  4DK0 A;  5FL7 G;  2BTO A;  5LL6 Y;  1PNL A;  1H2N A;  3OR7 C;  1PM9 A;  3CC2 V;  3N2G A;  4OX9 B;  4DW1 A;  5FNV B;  4LWS B;  3F5T A;  5LGN A;  2XT9 A;  3JSL A;  4JI0 O;  4ZKI A;  5B1N A;  4LC1 A;  3ZMV A;  1IBL O;  2DJV A;  4UV9 A;  4MTX A;  4XDJ A;  5CBG A;  2D3O W;  3TCU A;  2LO1 A;  3VX8 B;  3OTF A;  2PLG A;  2P6J A;  1XIL A;  1MOF A;  2DYS B;  2P9I D;  3DXM D;  1R6T A;  1JFF A;  2HP8 A;  1ORQ C;  3LDE A;  4GSL C;  2YXL A;  3K58 A;  5LOV B;  5D5P A;  1RFY A;  1DK1 A;  1MSW D;  5DED A;  4WBN A;  2A9H A;  4DV1 B;  1R3K C;  1AP5 A;  2QSA A;  3A0R A;  4IGG A;  2WLI A;  2EIN B;  2IH1 C;  3K5L A;  2BTQ B;  1HDJ A;  1R6N A;  2FKX A;  3UO3 A;  4X65 B;  1NI8 A;  2ZDI C;  1Q86 W;  1SA0 B;  2OCC C;  4IIJ B;  4JI4 B;  2HFE C;  3K79 A;  3ZHR A;  5BMV A;  4LF5 B;  3CCV V;  2XAG A;  3RYF B;  1GTO A;  3X2Q B;  1KQS U;  5IJ9 B;  2JDI G;  1N0J A;  4LNU B;  3E89 A;  2LFS A;  1J5E B;  1VAR A;  1BQZ A;  1OCR C;  1YIT V;  3AK2 A;  1GRJ A;  1VF7 A;  1EBO A;  4DV4 O;  4FM2 A;  4O2A A;  4HAM A;  4XEI F;  3JSN A;  1FAF A;  1KC8 W;  2ZDI A;  3T1C A;  3CCL V;  2BCC H;  1NR7 A;  1ZAU A;  3VX7 B;  5EK0 A;  5C8Y A;  4WFG A;  1KMI Z;  3WU2 Z;  4H13 B;  1G8M A;  4RWU A;  3GB7 C;  4PA3 A;  4B3S B;  1QBZ A;  4YIO A;  1P7B A;  4Q6G A;  4J10 A;  3K5N A;  2B1I A;  2LQT A;  5E79 Z;  4DR2 O;  4PA7 A;  3E8B A;  1QLE C;  4U3F H;  3ZMT A;  4G27 B;  4YY3 B;  4YJ3 A;  1B6Q A;  4TV9 A;  2UUC B;  1KBH A;  3A2F A;  3ZMZ A;  1M56 B;  5KX5 B;  1RSO B;  2JEX A;  1BGY H;  3K06 A;  3ZMS A;  1R6K A;  3RT3 C;  1H2L A;  2B5U A;  1YTF B;  3T1Y O;  2ARH A;  5EZY A;  1N34 O;  2QWQ B;  3RVY A;  2E5L B;  4DR5 O;  1R3I C;  4AIL C;  1VQM V;  1G6U A;  4NR1 A;  3OFN G;  2CTR A;  1BSM A;  2YID A;  5LA6 B;  3SYA A;  3VQX A;  1XKP B;  4O4I A;  1JQ0 A;  2OCH A;  4RQE A;  3M7M X;  2F43 G;  4HNA B;  2EIM C;  1TVK A;  2ZKO A;  1U2V F;  4CZZ A;  3EPU A;  2IJK A;  1Q81 W;  3ZMU A;  4I9W A;  1IBK O;  2PYJ A;  2KG7 A;  4QPJ A;  2ZR3 A;  2EIJ C;  4O2B B;  1Q3E A;  4JI1 O;  5IYC O;  4H33 A;  3DXK F;  4IYH A;  5A9G A;  2DYR B;  4HYO A;  4G6T A;  2Y0P A;  2QKA A;  1SZX A;  2XAJ A;  1BS3 A;  5J2U A;  1XHZ A;  5CA3 A;  3FD9 A;  1WNS A;  3LUT B;  2HJD A;  2AZ2 A;  3VQV A;  4EB6 B;  4DK1 A;  2Y48 A;  4D7S A;  5KLV H;  5L3B A;  1DTO A;  3CCJ V;  3ASO B;  2EIK B;  3DGE A;  3ZRW B;  4MVS A;  5FPR A;  3OEE G;  4B3R O;  5CBH A;  4ZOL A;  5LXT B;  4JI8 O;  3B8N A;  3OUS A;  2XAQ A;  1OCO B;  1I5X A;  2DYS C;  3G4S V;  1VQ5 V;  2LFR A;  1MSD A;  3SPJ A;  4MTO A;  5B3S B;  4NXN O;  1SQP H;  1NT2 B;  4DR6 B;  1VQ7 V;  3CXC U;  2BOB C;  2OWO A;  1HNX O;  4WFB V;  2H94 A;  1N36 O;  5FNV A;  1S76 D;  4LWS A;  3H01 A;  1ROP A;  3BFR A;  1LUV A;  1PPJ H;  4AQY B;  5E1A C;  5H9C A;  3IAY A;  2F93 B;  4X62 O;  3ASN C;  3L70 H;  3K59 A;  2XND G;  1H2M A;  1IBM O;  4UCV A;  3K9A A;  4PDR A;  1GH6 A;  2OT5 A;  4FLW A;  4ASU G;  2P9L F;  2BSK A;  1HR0 O;  2UXX A;  1N32 B;  2G38 A;  2EIN C;  2ZE5 A;  1YTF D;  4LP8 A;  4LF6 O;  2H3O A;  2ZE6 A;  5B5E Z;  2NNU A;  2P9P F;  1JA8 A;  3X2Q C;  2QWP B;  5LOV A;  1XNR O;  4FLY A;  2HLD G;  4PA9 A;  4JZ2 A;  4W4L A;  3ZIA G;  1R73 A;  3DSQ A;  1TTW A;  2CE4 A;  3H1L H;  1KB9 F;  3O9O A;  3FB8 C;  2BTQ A;  4UUJ C;  2NR5 A;  1I08 A;  2N74 A;  1SKV A;  1SA0 A;  5IWA B;  4IIJ A;  5K1X A;  5JH7 B;  3W7W A;  2UXC O;  1N5B A;  4QGP A;  5B1A B;  3BHP A;  3RYF A;  2ZXW B;  5IJ9 A;  4GZR B;  2P9U F;  4X88 A;  2AHZ A;  4LNU A;  2UXD B;  1S5H C;  2A06 H;  2W0F C;  2P4K A;  1O9G A;  1FXV A;  4CS3 A;  3UKU F;  4LFB B;  2WWW A;  5CBF A;  3BAB A;  1NKD A;  3H1H H;  4QE7 A;  2RJZ A;  2KQX A;  1XEQ A;  1VQK V;  1L0N H;  1XRE A;  1IZ3 A;  3TXQ A;  4AI8 A;  2P5O A;  3P3N A;  5CA1 B;  4JI7 B;  3ZHQ A;  2V4D A;  2E75 B;  1RP3 B;  5BY1 A;  2F4V O;  2ZNI A;  1XI1 A;  1GN3 A;  2XGA A;  2ILM A;  1W0J G;  4X66 O;  3L73 H;  3RBZ A;  1HNW O;  1AJN A;  5LHG A;  5L3D A;  3LNN A;  2IBZ H;  3CEI A;  5JCO C;  2P7T C;  4R8C A;  2IM9 A;  3BY6 A;  2EJ7 A;  1CP9 A;  3ETE A;  5EYP B;  4PV1 B;  5ITZ B;  4PEL A;  4QNH B;  3HKD B;  3KZI Z;  1NQT A;  4MVQ A;  5KX5 A;  1Y74 B;  2P9S F;  3ZHV A;  4OXS A;  4J7J A;  4LF8 O;  2EJR A;  1RSO A;  3B40 A;  4X9Q A;  5EBM C;  3UCS C;  3CCR V;  2ITD C;  2EZP A;  4UB8 Z;  5JCO A;  1M90 W;  2YI9 A;  2OTL V;  3K9S A;  1FXH A;  5KUM A;  2JJ1 G;  4I55 B;  4KFM A;  3RYH B;  3RN4 A;  3CSX A;  4JD2 D;  4B3M O;  1XBL A;  2UU9 O;  3CRC A;  3A0H Z;  2N05 A;  5LA6 A;  4KP4 A;  4B3T O;  4H0L B;  3E35 A;  3PN1 A;  4HNA A;  2OIG A;  3BEH A;  3ASO C;  2EIK C;  3K5O A;  1M4U A;  3CMA V;  2AZ0 A;  4O2B A;  2GTS A;  4UVC A;  4YHH B;  1HW7 A;  4TWK A;  2YDE A;  4BW5 A;  2Q69 A;  3E22 B;  5B3S C;  1V55 C;  2ODM A;  3BA9 A;  3HKB B;  5JVD B;  4FZ1 A;  4JYA B;  4H44 B;  4EB6 A;  3AG3 B;  4GX2 A;  1VF6 C;  2IJI A;  3H9V A;  1XMO B;  2Y4T A;  3QF7 A;  1ZL8 B;  1S77 D;  3ZRW A;  2M6Y A;  2P9N F;  3IC7 A;  2XAS A;  5LXT A;  3SDL A;  5DEC A;  1QR8 A;  1AI4 A;  1RM1 C;  3ETD A;  1K3E A;  2JJ2 G;  4CBC A;  1XL4 A;  5JJE B;  1KUQ A;  2EBO A;  4JAS A;  5KHH A;  4NXM B;  3OM3 B;  1AIL A;  1VF6 A;  5KA6 A;  3DC6 A;  4IT5 A;  1F23 A;  2GHY A;  3ZED A;  4L87 A;  2CDY A;  2X7R B;  3JAL B;  4X64 O;  2ZR2 A;  1QVG U;  2YIC A;  4L8J A;  4UCS A;  2ZM6 B;  2RN9 A;  3JAR B;  4JI6 O;  4FLX A;  3Q4H B;  3ETQ A;  3OMI B;  1GO3 F;  3EHB B;  2Q67 A;  3AG1 B;  1EN6 A;  4GKK O;  3TGU H;  2HHH B;  3GVM A;  1S3J A;  3FYE B;  1OV9 A;  5B1A C;  4B7E A;  1LR1 A;  4F4L A;  3S3X A;  2ZXW C;  2QEX V;  2H8P C;  5L3F A;  3A8T A;  1NVP B;  5A2Q N;  2CK3 G;  4LF7 O;  4MVM A;  1J95 A;  4DR3 B;  1R3J C;  4I50 B;  1N4C A;  3EFF K;  4LF4 B;  1LNQ A;  1N33 O;  3U11 A;  1S5L Z;  3CCQ V;  2ZNJ A;  1IXB A;  4UCO A;  4X20 B;  2RCV A;  3CJH B;  4UCU A;  1IVS A;  4NKG B;  5EC2 C;  2UXB B;  5JH7 A;  1XNQ B;  2WA3 A;  2IU0 A;  2ZIN A;  4LF6 B;  3I5D A;  3QG5 A;  3CCS V;  4JPR A;  1O9H A;  3DXR B;  3ULE D;  1YSC A;  1BZK A;  5EIB D;  2P9I F;  5LMN B;  2DQ3 A;  2ZIO A;  3JAT B;  3WB1 A;  2YIA A;  4LFC O;  2YXY A;  3DXM F;  1VIB A;  3ABL B;  1GM7 A;  4XDK A;  4CS2 A;  5D5Q A;  1FJG B;  4FVM A;  1VF5 B;  1AI7 A;  1AJP A;  2W6J G;  1V9P A;  3QVN A;  2MK3 A;  3C90 A;  2QM7 A;  3D3Q A;  3DTU B;  3AK1 A;  5CA1 A;  4DR7 B;  1F51 A;  4FLT A;  3FB5 C;  4AKX A;  2Q6A A;  2F95 B;  2QJ1 A;  4I4T B;  4B7K A;  3C3T A;  4LFA B;  2DE0 X;  1TUB B;  2PF4 E;  4MW3 A;  3AEI A;  3ABK B;  1V54 B;  2KKW A;  3CS5 A;  1L2W A;  5C93 A;  2WLJ A;  5LMU B;  2RQ6 A;  5HFM A;  3CYO A;  4WFA V;  4DUZ B;  4PI0 A;  1YHQ V;  1I7F A;  3H1K H;  3IFX A;  4UVB A;  2WLM A;  5EYP A;  5ITZ A;  1G1X B;  1H8E G;  1L0L H;  1XHX A;  2ETN A;  5LHI A;  1AR1 B;  3HKD A;  4H37 A;  4JI2 O;  1Y74 A;  1AR4 A;  1NU1 H;  3FFQ A;  3C3S A;  4DV5 O;  3SYQ A;  2F4V B;  4OPA A;  1KU9 A;  2YS8 A;  2UXN A;  4NTW A;  4K35 A;  1NVP D;  5L3E A;  2P9K F;  3ABT A;  4I55 A;  1SET A;  4DR1 B;  2QKC A;  3RYH A;  2AHY A;  3KCX A;  3G67 A;  5IYD O;  1NTK H;  2XOK G;  3SJB C;  1M1K W;  3F7V C;  3L74 H;  3AG3 C;  1F4M A;  2ZQM A;  3K04 A;  2ATK C;  2Y4U A;  3SJQ C;  2P90 A;  4P9P A;  4A5U B;  4H5B A;  2XAF A;  4JI3 O;  1S72 V;  3SGI A;  1YIJ V;  2OD0 A;  4HBN A;  1JJO A;  1IXM A;  4JI5 O;  3HPL C;  3BAA A;  5CA0 B;  3W7X A;  4DV7 O;  4RUF A;  3E22 A;  2BE3 A;  1K33 A;  4GX5 A;  3JCU Z;  1K4D C;  3BCC H;  3HKB A;  5JVD A;  1P84 F;  5FLX N;  1W2B U;  1BMF G;  4WFE A;  3ZBH A;  2VRZ A;  4FK5 C;  4BIZ A;  3TXS A;  1ZL8 A;  1Y76 B;  1YVW A;  1HNZ O;  3EXA A;  2Q68 A;  5H6R A;  1QQC A;  3OMA B;  4ZIB A;  2VQE B;  3ZHT A;  2B9Z A;  4GX0 A;  1VEW A;  4XEI D;  3BA8 A;  4DUY O;  3RGB A;  4NB5 A;  2L35 A;  2JIZ G;  2LGQ A;  3CCE V;  4YJ2 B;  2EX3 A;  2AGA A;  4X1Y B;  1Z5V A;  3O65 A;  1NJI W;  4XDL A;  3OMN B;  1KKC A;  4BIO A;  3J81 N;  5IT9 N;  3CC7 V;  3JAL A;  3JAW B;  3ABU A;  3D3I A;  3JAR A;  2LGW A;  3Q4H A;  2V1D A;  2UUA B;  1QVF U;  3TU3 A;  4K8X A;  2IW5 A;  3W7S A;  4LF9 B;  3R65 A;  4DV3 B;  4O4H B;  1WPX A;  2Q0A A;  4X1I B;  3DWL D;  3B2E E;  4YIP A;  4MVR A;  3OTO O;  1XMQ O;  2DOS A;  4ZHQ B;  1H2S B;  1XL6 A;  4JV5 B;  1QR9 A;  1M57 B;  4J41 A;  4I50 A;  4R7C A;  3ABM B;  3NR7 A;  4JAU A;  4DXW A;  4EBR A;  1GAX A;  1WJZ A;  3ABL C;  3KCY A;  4X20 A;  4JYY A;  3CJH A;  4JAA A;  2R9A A;  3MHH C;  4X1K B;  4FFK A;  4IHJ B;  3ZRV A;  1BHA A;  1MZF A;  1H2K A;  1D2D A;  5LBQ A;  4DR4 B;  1Z5W A;  1K3S A;  2UUB B;  1DLB A;  4Z1V A;  2P67 A;  3DXR A;  3JAS B;  4JF3 A;  4JTC B;  4KHP B;  4UFZ A;  4EFE A;  3OGI B;  4UB6 Z;  3JD1 A;  1F4N A;  3JAT A;  2IJH A;  4QPK A;  3OAA G;  3A0B Z;  3UKR F;  1K9M W;  1QNM A;  2VQF B;  1EM1 A;  2YIB D;  3ABK C;  4DV0 B;  5JJJ B;  2JEU A;  2CH7 B;  3F5W C;  2Q4P A;  3VQY A;  1K8K F;  1VQ9 V;  3OE7 G;  4J7Z A;  1B04 A;  1I0H A;  4RO2 A;  3T1H O;  4GKJ B;  1GN4 A;  3L75 H;  4K0K B;  4DV2 B;  3CXJ A;  1VQL V;  2PY5 A;  1Q5O A;  3DXK D;  2WAM A;  5DM6 V;  4I4T A;  1Y67 A;  2FL4 A;  2KC5 A;  1QCE A;  3M99 B;  2NLJ C;  3B09 A;  1TUB A;  5IDJ A;  1WN7 A;  1FKA O;  1MMM A;  3L9D A;  2Q0O C;  4DV6 O;  2AW9 A;  3QO7 A;  2A79 B;  5AG2 A;  2WPD G;  1L1F A;  5H5N A;  4JI0 B;  2C2A A;  2A3Q A;  3HKC B;  1IBL B;  5IYZ B;  2RMK B;  3SJC C;  3E83 A;  3HB3 B;  4JYB A;  5LYJ B;  4JAV A;  3E8H A;  2R70 A;  1COW G;  3VBB A;  1SQV H;  4IL6 Z;  3MDS A;  3K5M A;  2ZCE A;  1DF4 A;  1URF A;  3B4S A;  4BW9 A;  5BR8 O;  3E8G A;  5JJN B;  1BT8 A;  2WA4 A;  1UFI A;  2LJ2 A;  2P9L D;  3ZHS A;  3GWK C;  2OYQ A;  4OX9 O;  1SC5 B;  4JGS A;  5TIS Z;  3OT7 A;  3AG2 B;  4E4E A;  5BZB A;  2Q9L A;  4D7T A;  5CN0 A;  2QTS A;  1PL4 A;  3ZJZ A;  4TQD A;  2DW4 A;  3THO A;  1N8R W;  3OGC C;  1OCC B;  3K03 A;  3HR0 A;  4TUY B;  2ZE8 A;  2RDC A;  4RQF A;  2Z5U A;  3E8F A;  2QTO A;  3CRQ A;  3N27 A;  5CA0 A;  3GWO A;  1M9N A;  1VQ4 V;  1M56 C;  3J7A U;  3BRC A;  1GN2 A;  3IC9 A;  4D6T H;  2DQ0 A;  3I56 V;  2FM8 A;  3ZHU A;  3UM7 A;  2PTM A;  4DV4 B;  2YIB A;  4PHZ A;  4DV1 O;  1B06 A;  2P9U D;  1AJQ A;  4OPH A;  1Y76 A;  4P9O A;  4HZ3 A;  5B1B B;  2JS3 A;  5GTI Z;  4JD2 F;  3ICX A;  4X65 O;  3K3W A;  2R9I A;  4JI4 O;  4MW8 A;  4WFF A;  3HKE B;  4LF5 O;  1K5Q A;  4OGQ B;  1EZV H;  1SS3 A;  2X0L A;  1R3L C;  1XKP C;  1Y66 A;  4TOI A;  3RW0 A;  2PGG A;  3UO2 A;  1FFX B;  3K0D A;  1J5E O;  3KXY A;  4DR2 B;  1JX9 A;  1ZWI C;  1UPG A;  4EKW A;  4YJ2 A;  4JTA B;  2IH3 C;  5DN6 G;  4X1Y A;  3DC5 A;  2GV9 A;  1N0N A;  5KMG B;  4UCR A;  1M57 C;  2AXT Z;  3JAW A;  1K5S A;  3ABM C;  2PI5 A;  3AK3 A;  2MQD A;  2DYR C;  1SQF A;  3CCM V;  3OW2 U;  3CHX A;  1JYO A;  4CH5 A;  4LBE C;  1TYQ D;  3MAQ A;  4B3S O;  1Z2G A;  3CD6 V;  4FPP A;  4N23 A;  2ZE7 A;  4O4H A;  3RVZ A;  4X1I A;  1Y4M A;  3LDD A;  1IUR A;  2RNB A;  1NR1 A;  2CGN A;  4PDV A;  2WLH A;  3T1Y B;  3SPC A;  1P49 A;  1OCO C;  1PL0 A;  1N34 B;  4DR5 B;  2P9S D;  2QA4 V;  2DMX A;  4UCT A;  4R6Z A;  2WLL B;  1XQ8 A;  4YY3 O;  2OCC B;  1FD9 A;  1QU7 A;  4X1K A;  2QR4 A;  4F6E A;  4UV8 A;  2UUC O;  4IHJ A;  5L3C A;  3RSE D;  2M7W A;  4P30 A;  5H2F Z;  2L6L A;  1YF2 A;  3G71 V;  1BE3 H;  3JAS A;  4QE9 A;  3U0Z A;  1DGS A;  1VQ8 V;  1IBK B;  1R1B A;  2A7W A;  2N04 A;  4MT8 A;  1PKX A;  4JI1 B;  1VQO V;  1US6 A;  4MTG A;  1YJ9 V;  4FLV A;  2QWN B;  4KXR A;  2CH7 A;  4CH6 A;  2FYU H;  2E5L O;  3OR6 C;  3WB2 A;  4PD4 F;  1VQ6 V;  5GON B;  4GF3 A;  1X4T A;  3KKY A;  1WP7 A;  3T4D A;  4O4J B;  4J42 A;  1H38 A;  2P22 C;  1AR5 A;  4LCU C;  1YXB A;  3FX7 A;  4GCZ A;  4B3R B;  1SES A;  1K6Z A;  3LSS A;  2YUA A;  1W59 A;  1AI5 A;  4I0X B;  1IDS A;  4NTX A;  4JI8 B;  4JMF B;  4FLZ A;  5L3G A;  4NXN B;  1MA1 A;  3N2K B;  5FPO A;  1HNX B;  1N36 B;  1GN6 A;  2BSI A;  2P9N D;  3ULE F;  1SQQ H;  5LP6 B;  4TT3 G;  2GUZ B;  3HKC A;  4LH6 A;  4X62 B;  5IYZ A;  3CCU V;  5B66 Z;  4KL1 A;  4O4L B;  1IBM B;  2LW1 A;  4J80 A;  1K8A W;  3AG2 C;  1U97 A;  3VOU A;  4WFH A;  5LYJ A;  2CTW A;  4K3A A;  1Q6U A;  1HR0 B;  2BHO A;  1BCC H;  2E3C A;  2A0L A;  3UKM A;  3K0G A;  5IJ0 B;  1EN5 A;  1Y6X A;  4CH3 A;  1KP2 A;  4FMT A;  2VWJ A;  1EN4 A;  1HP8 A;  4J9Y B;  4FZ0 A;  2EZO A;  4WF9 V;  4DR6 O;  4GLX A;  4QJF B;  1XDC A;  1XNR B;  1ZLZ A;  1JYA A;  4AQY O;  1KP3 A;  3JD2 A;  1G4Y B;  1GK9 A;  5J2T B;  1NBM G;  3K08 A;  1OJH A;  3ZN1 A;  3ETG A;  1SQG A;  2Q8V A;  1YZB A;  1SQX H;  2F23 A;  2QWO B;  3QNE A;  1YJW V;  1N32 O;  4TUY A;  5B1B C;  2UXC B;  1BQ0 A;  3TET A;  3JD0 A;  1XUQ A;  2WLK A;  4RUE A;  2HG5 C;  4ZI7 B;  3CWB H;  2O57 A;  4R50 A;  1I5Y A;  1OCZ B;  4NTY A;  2K1E A;  1NS1 A;  3P3P A;  4XBF A;  2V7Q G;  1EZJ A;  5JQG B;  4CH4 A;  2Y69 B;  4MVU A;  1E79 G;  2BSK B;  1VQN V;  5IWA O;  1RPR A;  2NN4 A;  2JGD B;  2JK5 C;  2Q73 A;  1U96 A;  4DRX B;  1JMK C;  3HKE A;  4TV8 B;  2IU3 A;  1Q8I A;  2HR3 A;  2FTK A;  2XUM A;  1TAE A;  1VMG A;  4NYK A;  1FFX A;  1JR9 A;  2UXD O;  3ASN B;  4X66 B;  5GTH Z;  1NH2 B;  5GW7 A;  1HNW B;  4U3J B;  3MD0 A;  2R9R B;  1TUE B;  2FML A;  5KMG A;  3ZX6 A;  3CME V;  1LUW A;  2YEV B;  4LFB O;  3W7U A;  1WB7 A;  1K34 A;  4GYC B;  4YXW G;  1PD3 A;  5EIB C;  4LR3 A;  2BOC C;  4C7U A;  1CEZ A;  3U10 A;  1S28 A;  4JI7 O;  2GDS A;  1ENV A;  4LF8 B;  1BL8 A;  3LSQ A;  5CMU A;  1CPY A;  1ZTE A;  4F6R B;  2QE7 G;  4UXN A;  5K1P A;  2ADQ B;  1TA8 A;  1FPO A;  4U7N A;  4KUM A;  1MG1 A;  3CRR A;  1BHB A;  3ZN0 A;  4AHC A;  2MW2 B;  2WLL A;  3L72 H;  1GM8 A;  4B3M B;  2UU9 B;  3SYC A;  4BIU A;  3P30 A;  4B3T B;  3RWR D;  1VP7 A;  2X6B A;  2P9K D;  3JD4 A;  1D5N A;  1RY9 A;  1AI6 A;  1GM9 A;  2JRI A;  5JWP A;  1L8D A;  4ICG A;  3TJT A;  1NZ6 A;  3AG1 C;  2Q7G A;  3RYI B;  3T4Z A;  3J80 N;  3APO A;  4ZBM A;  4P2Z A;  1ARO P;  2DN9 A;  2OTJ V;  3DWL F;  5KHI A;  1RPO A;  2ZIM A;  3FKS G;  3WG7 B;  5GON A;  2QM4 A;  1JJ2 U;  4WCE V;  1QHT A;  1FXK B;  4O4J A;  5LP6 C;  3JYC A;  1I94 O;  3JAK B;  3T2M A;  2CGO A;  1P4R A;  3JD3 A;  4I0X A;  4G2K A;  3AG7 A;  2KSD A;  5BXZ A;  1WLE A;  1NH2 D;  1SZT A;  3D36 C;  4YHH O;  2ZT9 B;  1D5A A;  3N2K A;  2WSS G;  4FIP C;  2BSH A;  1T5E A;  4DYL A;  4MTF A;  2Q7H A;  3ML0 A;  5LP6 A;  2GUZ A;  4PJ0 Z;  4JYA O;  3P32 A;  2GSM B;  4O4L A;  3R66 A;  4X64 B;  1XMO O;  4JI6 B;  5CB4 B;  5LGT A;  4FFB B;  3CRA A;  3D36 A;  3G6B A;  4Q20 A;  1Q6H A;  3G80 A;  4CC6 A;  4GKK B;  2EUL A;  5IJ0 A;  1E1R G;  1WPB A;  3FAV B;  2PYL A;  2HVJ C;  3H1I H;  1GMG A;  1FYJ A;  1K7D A;  1MZE A;  4NXM O;  1S0V A;  2PZS A;  4LF7 B;  4Z1M G;  1X59 A;  3AG4 B;  1K92 A;  2X6C A;  1N33 B;  1YI2 V;  5IE9 A;  5LGU A;  4GUN A;  1V54 C;  2XAH A;  1JCH A;  1OCZ C;  1W0K G;  2HVK C;  1KEC A;  1IX9 A;  5J2T A;  4PI2 A;  2LW7 A;  1U2V D;  3NXS A;  2ZM6 O;  2KB1 A;  2Y69 C;  2K9P A;  1WAZ A;  2CTQ A;  2HHH O;  1PNM A;  2QGN A;  3LNM B;  2QKS A;  1V55 B;  1WA8 B;  4EEQ A;  4MSW C;  3SYO A;  1M93 A;  3F7Y C;  1ZX3 A;  2HKO A;  4ZI7 A;  4J7K A;  4LFC B;  3BVO A;  3UT5 B;  3LDC A;  4DR3 O;  4J11 A;  4LH7 A;  4LF4 O;  3SPH A;  3MHS C;  2CAZ C;  5JQG A;  2PUS A;  1AB3 A;  4BWA A;  2LP7 A;  4E2L A;  1RM1 B;  4I5S A;  4MVO A;  2WLN A;  2UXB O;  1KD1 W;  1SF9 A;  3RFR A;  3QTC A;  3ZRX A;  2JGD A;  3UKR D;  2GBO A;  1MNG A;  2Y0I A;  4DRX A;  1XOU A;  4TV8 A;  1XNQ O;  4I9Q A;  2Q7E A;  2EIL B;  3WFV A;  2VWK A; 
#chains in the Genus database with same CATH homology
 3ZMZ A;  1OCO C;  1PL0 A;  1M56 B;  2QM7 A;  3QO5 A;  2P9S D;  3B8M A;  4X8A A;  2QA4 V;  1K8K D;  4R6Z A;  4PDM A;  3DTU B;  2WLL B;  2OCC B;  1F51 A;  2JEX A;  3FYI B;  3K06 A;  3ZMS A;  2YEV A;  1R6K A;  4UV8 A;  3FB5 C;  4AKX A;  2B5U A;  3CP1 A;  2Q6A A;  5L3C A;  4GX1 A;  1YTF B;  2M7W A;  4P30 A;  3RSE D;  1JVM A;  1PNK A;  1K97 A;  1DF5 A;  4U7O A;  1JPX A;  3B77 A;  3G71 V;  4MW3 A;  3AEI A;  3RVY A;  3ABK B;  1V54 B;  4QE9 A;  1R3I C;  4G28 B;  1GKF A;  1L2W A;  5C93 A;  5EC1 C;  1VQ8 V;  2P9P D;  2WLJ A;  3PJS K;  1VQM V;  3OFN G;  5HFM A;  3CYO A;  1PKX A;  4MT8 A;  4WFA V;  1VQO V;  1QLN A;  4MTG A;  1YHQ V;  3SYA A;  3IFX A;  1XKP B;  4UVB A;  2WLM A;  1JQ0 A;  2B1G A;  4RQE A;  1YJ9 V;  1H8E G;  1H8H G;  2F43 G;  2EIM C;  1UJW B;  1VQP V;  5LHI A;  1AR1 B;  1U2V F;  3OR6 C;  4CZZ A;  3EPU A;  4H37 A;  2IJK A;  1Q81 W;  3ZMU A;  4I9W A;  5IY5 B;  1VQ6 V;  4GF3 A;  4QPJ A;  2ZR3 A;  2EIJ C;  3T4D A;  4PA4 A;  3SYQ A;  1H38 A;  2DWE C;  5IYC O;  1SRY A;  4H33 A;  4LCU C;  2UXN A;  3DXK F;  1NVP D;  4GCZ A;  2DYR B;  3WG7 C;  4HYO A;  1SES A;  5HFL A;  3LSS A;  1K6Z A;  4G6T A;  1AI5 A;  2XAJ A;  2DWD C;  4JMF B;  5L3G A;  5L3E A;  5CA3 A;  1FXK C;  2P9K F;  3ABT A;  3LUT B;  1SET A;  2Y48 A;  4N21 A;  2AHY A;  5L3B A;  1DTO A;  5IYD O;  3CCJ V;  3ASO B;  5H6Q A;  2EIK B;  2XOK G;  3DGE A;  3ZRW B;  2LPU A;  4MVS A;  1TYQ F;  3OEE G;  2BSI A;  1MAB G;  2IJJ A;  5CBH A;  2P9N D;  3ULE F;  1M1K W;  3F7V C;  3UKU D;  4TT3 G;  3AG3 C;  3B8N A;  2DYT A;  1F4M A;  2ZQM A;  3OUS A;  3CCU V;  3K04 A;  2XAQ A;  2ATK C;  1OCO B;  1I5X A;  2DYS C;  2P90 A;  4P9P A;  3SJQ C;  3G4S V;  1VQ5 V;  2LFR A;  3SPJ A;  3STZ C;  4MTO A;  3FB7 C;  5B3S B;  1K8A W;  4H5B A;  2XAF A;  3AG2 C;  1S72 V;  3VOU A;  3CXC U;  2QM8 A;  2BOB C;  4WFH A;  1VQ7 V;  1YIJ V;  4RAI A;  1FXK A;  1IXM A;  2H94 A;  3HPL C;  4J9Z B;  4UVA A;  4BAY A;  3H01 A;  5KA5 A;  4WFB V;  1S76 D;  1ROP A;  2BHO A;  3W7X A;  2A0L A;  4RUF A;  5E1A C;  5H9C A;  3UKM A;  3ASN C;  1K33 A;  3K0G A;  2WLI B;  2XND G;  4GX5 A;  5KUK A;  1K4D C;  3K9A A;  1KP2 A;  4FMT A;  4PDR A;  4J9Y B;  2OT5 A;  2EZO A;  4WF9 V;  1W2B U;  4ASU G;  1BMF G;  4X89 A;  2P9L F;  3RSE F;  3SPI A;  4WFE A;  4QJF B;  4PA6 A;  4FK5 C;  4BIZ A;  2UXX A;  1JYA A;  2EIN C;  1KP3 A;  3SYP A;  5EBW C;  3JD2 A;  4LP8 A;  1YTF D;  1EFR G;  1G4Y B;  1Q82 W;  1GK9 A;  2NNU A;  4JTD B;  2P9P F;  2Q68 A;  4MS2 A;  1NBM G;  5H6R A;  3K08 A;  3X2Q C;  3W7T A;  3OMA B;  3AG4 C;  5B1O A;  3ZN1 A;  3ETG A;  3QNE A;  1YJW V;  4GX0 A;  5B1B C;  4JYC A;  4XEI D;  5J9P C;  5EBL C;  2HLD G;  4PA9 A;  3TET A;  3ZIA G;  1R73 A;  3JD0 A;  3G6E V;  2JIZ G;  3CC4 V;  1TTW A;  2WLK A;  3CCE V;  4RUE A;  3STL C;  1NJI W;  3FB8 C;  4XDL A;  4UUJ C;  2BSJ A;  3OMN B;  2HG5 C;  1H2G A;  3CC7 V;  3QO8 A;  1Q7Y W;  1K73 W;  4R50 A;  3W7W A;  1I5Y A;  3ABU A;  2PI4 A;  1N5B A;  1OCZ B;  3D3I A;  1OCR B;  2HJF C;  5B1A B;  2K1E A;  2ZD9 A;  2ZXW B;  4XBF A;  2V1D A;  2ITC C;  2P9U F;  1QVF U;  4X88 A;  2AHZ A;  2V7Q G;  1EZJ A;  3TU3 A;  2Y69 B;  4MVU A;  1E79 G;  4QIW F;  2IW5 A;  3W7S A;  1S5H C;  3R65 A;  1WPX A;  1VQN V;  2W0F C;  3DWL D;  1RPR A;  1FXV A;  2JK5 C;  4MVR A;  3UKU F;  2IU3 A;  2WWW A;  5CBF A;  2HR3 A;  1XL6 A;  1QR9 A;  1M57 B;  1NKD A;  2FTK A;  2W6I G;  4QE7 A;  4R7C A;  1OHH G;  3ABM B;  3ASN B;  1NH2 B;  4JAU A;  4DXW A;  1VQK V;  4EBR A;  4DO2 A;  3ABL C;  5GW7 A;  3MD0 A;  2R9R B;  1TUE B;  3CME V;  3ZRS A;  3MHH C;  2EIL C;  2YEV B;  1K4C C;  3W7U A;  3I55 V;  4MVZ A;  3ZRV A;  1BHA A;  1K34 A;  5LBQ A;  1QLE B;  3KG2 A;  5IYB O;  4YXW G;  1K3S A;  1E1Q G;  1DLB A;  3OEH G;  1KKD A;  1PD3 A;  2XGA A;  3IGA C;  1W0J G;  1SER A;  2YSU B;  3RBZ A;  2BOC C;  2P67 A;  1CEZ A;  4JTC B;  4JF3 A;  1AJN A;  5LHG A;  5L3D A;  1S28 A;  3JD1 A;  1F4N A;  5LHH A;  3FB6 C;  1ENV A;  2IJH A;  1BL8 A;  2P7T C;  3OAA G;  4QPK A;  3UKR F;  1K9M W;  3LSQ A;  4R8C A;  5CMU A;  3BY6 A;  1CP9 A;  1CPY A;  1OZ0 A;  3ETE A;  3ABK C;  2QE7 G;  4PEL A;  4UXN A;  3CPW U;  4QNH B;  2JEU A;  4PDL A;  3OUF A;  4U7N A;  2Z3Y A;  3F5W C;  4KUM A;  1NQT A;  4MVQ A;  3SPG A;  1MG1 A;  2P9S F;  1K8K F;  1VQ9 V;  3OE7 G;  4OXS A;  2EJR A;  1FFT B;  1OCC C;  4RO2 A;  3ZN0 A;  1BHB A;  2WLL A;  2X6A A;  1GM8 A;  3CXJ A;  1VQL V;  5EBM C;  3ZCC A;  3CCR V;  2ITD C;  3SYC A;  2EZP A;  4BIU A;  3DXK D;  3P30 A;  2WAM A;  5DM6 V;  3JCZ A;  3TK1 A;  1HWY A;  5IY5 C;  1M90 W;  1THZ A;  2KC5 A;  2OTL V;  2X6B A;  1QCE A;  3M99 B;  1FXH A;  2NLJ C;  5KUM A;  5IDJ A;  2P9K D;  3JD4 A;  2JJ1 G;  1YJN V;  3E86 A;  1RY9 A;  1AI6 A;  4KFM A;  1GM9 A;  1JOY A;  3E2E A;  2EIM B;  4JD2 D;  3QO7 A;  4FJC C;  2A79 B;  4TSF G;  2WPD G;  4GT1 A;  3AG1 C;  4KP4 A;  1FS0 G;  1L1F A;  2EIJ B;  2C2A A;  3E35 A;  3T4Z A;  4ZBM A;  4P2Z A;  1ARO P;  3BEH A;  2OTJ V;  3DWL F;  3ASO C;  5FL7 G;  2EIK C;  1RPO A;  1PNL A;  3E83 A;  3FKS G;  3WG7 B;  3HB3 B;  4JYB A;  3CMA V;  3OR7 C;  4JAV A;  3E8H A;  1JJ2 U;  4WCE V;  3CC2 V;  1COW G;  1FXK B;  3VBB A;  4UVC A;  5LGN A;  3JYC A;  4TWK A;  4ZKI A;  5B1N A;  4LC1 A;  3T2M A;  3ZMV A;  4BW5 A;  1DF4 A;  2Q69 A;  1P4R A;  3JD3 A;  5B3S C;  1V55 C;  4UV9 A;  3E8G A;  4MTX A;  4G2K A;  4XDJ A;  5CBG A;  2D3O W;  3TCU A;  1WLE A;  3VX8 B;  1NH2 D;  3AG3 B;  2PLG A;  1SZT A;  2P9L D;  2P6J A;  4GX2 A;  2IJI A;  2P9I D;  1MOF A;  2DYS B;  4JGS A;  1S77 D;  3ZRW A;  2WSS G;  4FIP C;  2BSH A;  3DXM D;  3AG2 B;  5BZB A;  4MTF A;  2P9N F;  3IC7 A;  5CN0 A;  2XAS A;  1ORQ C;  3ML0 A;  3LDE A;  1QR8 A;  1AI4 A;  1RM1 C;  4GSL C;  3P32 A;  2GSM B;  3ETD A;  3ZJZ A;  2DW4 A;  1K3E A;  2JJ2 G;  1N8R W;  3OGC C;  1OCC B;  4CBC A;  1XL4 A;  3K03 A;  2EBO A;  4JAS A;  3OM3 B;  1MSW D;  5LGT A;  4RQF A;  2Z5U A;  2A9H A;  3E8F A;  2QTO A;  1R3K C;  3GWO A;  5KA6 A;  3D36 A;  4Q20 A;  1M9N A;  1F23 A;  2GHY A;  1VQ4 V;  3A0R A;  1M56 C;  2WLI A;  4L87 A;  2EIN B;  2IH1 C;  1E1R G;  1R6N A;  2HVJ C;  2X7R B;  2ZDI C;  1GMG A;  1Q86 W;  2OCC C;  2ZR2 A;  1K7D A;  2DQ0 A;  3I56 V;  1QVG U;  2FM8 A;  2HFE C;  3K79 A;  3UM7 A;  3CCV V;  1S0V A;  3OMI B;  2XAG A;  1GO3 F;  1GTO A;  3X2Q B;  4Z1M G;  1KQS U;  3EHB B;  2Q67 A;  3AG1 B;  3AG4 B;  2P9U D;  1AJQ A;  2JDI G;  1K92 A;  4P9O A;  3E89 A;  2X6C A;  2LFS A;  4HZ3 A;  1S3J A;  5B1B B;  1YI2 V;  3FYE B;  5LGU A;  1V54 C;  4JD2 F;  2XAH A;  1JCH A;  1OCZ C;  1W0K G;  2R9I A;  1OCR C;  1KEC A;  2HVK C;  3K3W A;  5B1A C;  1YIT V;  4F4L A;  2ZXW C;  2QEX V;  2H8P C;  5L3F A;  1U2V D;  4MW8 A;  4WFF A;  3NXS A;  1EBO A;  2KB1 A;  1NVP B;  1K5Q A;  4HAM A;  2CK3 G;  2Y69 C;  1XKP C;  4XEI F;  2X0L A;  1R3L C;  4MVM A;  1KC8 W;  1J95 A;  1Y66 A;  1R3J C;  2ZDI A;  3T1C A;  3RW0 A;  3EFF K;  3CCL V;  1LNQ A;  1NR7 A;  1PNM A;  3K0D A;  3VX7 B;  3LNM B;  2QKS A;  3KXY A;  5EK0 A;  4WFG A;  1JX9 A;  1V55 B;  1ZWI C;  4EKW A;  4JTA B;  1G8M A;  2IH3 C;  3CCQ V;  3GB7 C;  4PA3 A;  5DN6 G;  4MSW C;  3SYO A;  3F7Y C;  2HKO A;  1M57 C;  1QBZ A;  1K5S A;  5EC2 C;  3ABM C;  2PI5 A;  1P7B A;  3LDC A;  2IU0 A;  2MQD A;  2DYR C;  2B1I A;  3SPH A;  3CCM V;  3CCS V;  3MHS C;  4PA7 A;  4JPR A;  3OW2 U;  3E8B A;  1JYO A;  4LBE C;  1TYQ D;  2LP7 A;  3CD6 V;  3ULE D;  1YSC A;  4E2L A;  4FPP A;  1RM1 B;  4N23 A;  2P9I F;  4I5S A;  1QLE C;  2DQ3 A;  4MVO A;  2WLN A;  3RVZ A;  1KD1 W;  3DXM F;  3ZMT A;  3UKR D;  4G27 B;  1Y4M A;  3ABL B;  1GM7 A;  4XDK A;  3ZRX A;  1B6Q A;  3LDD A;  1NR1 A;  1AI7 A;  1AJP A;  2W6J G;  4PDV A;  2EIL B;  2WLH A;  3WFV A;  3SPC A;  2MK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...