The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
49
|
sequence length |
225
|
structure length |
225
|
Chain Sequence |
APYINAAFRSSSEYEVYFFAKNKYVRLHYTPGASSDTILTNLRLISSGFPSLAGTPFAEPGIDCSFHTEASEAYVFSGNHSAYIDYAPGTTNDKILVGPTTIAEMFPVLNNTVFEDSIDSAFRSTKGKEVYLFKGNKYVRIAYDSKQLVGNIRNIGDGFPVLNGTEFESGIDACFASHKEPEAYLFKGQNYVRIDFTPGGKADTLVGNIRPILDGWPVLKGIFPV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The structure of a haemopexin-fold protein from cow pea (Vigna unguiculata) suggests functional diversity of haemopexins in plants
pubmed doi rcsb |
molecule tags |
Plant protein
|
molecule keywords |
hemopexin fold protein CP4
|
total genus |
49
|
structure length |
225
|
sequence length |
225
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-09-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00045 | Hemopexin | Hemopexin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | 4 Propeller | Hemopexin | Hemopexin-like domain |
#chains in the Genus database with same CATH superfamily 1FBL A; 3BA0 A; 4FVL A; 1GXD A; 2MQS A; 4G0D A; 1QJS A; 2CLT A; 3S18 A; 4OEI A; 3C7X A; 1CK7 A; 4LL2 A; 3V6N A; 4AUO A; 2JXY A; 4FU4 A; 4RT6 B; 1GEN A; 3LP9 A; 4HSD A; 1RTG A; 1SU3 A; 1ITV A; 4YEH A; 1PEX A; 1HXN A; 1QHU A; 3OYO A; #chains in the Genus database with same CATH topology 1FBL A; 3BA0 A; 4FVL A; 1GXD A; 2MQS A; 4G0D A; 1QJS A; 2CLT A; 3S18 A; 4OEI A; 3C7X A; 1CK7 A; 4LL2 A; 3V6N A; 4AUO A; 2JXY A; 4FU4 A; 4RT6 B; 1GEN A; 3LP9 A; 4HSD A; 1RTG A; 1SU3 A; 1ITV A; 4YEH A; 1PEX A; 1HXN A; 1QHU A; 3OYO A; #chains in the Genus database with same CATH homology 1FBL A; 3BA0 A; 4FVL A; 1GXD A; 2MQS A; 4G0D A; 1QJS A; 2CLT A; 3S18 A; 4OEI A; 3C7X A; 1CK7 A; 4LL2 A; 3V6N A; 4AUO A; 2JXY A; 4FU4 A; 4RT6 B; 1GEN A; 3LP9 A; 4HSD A; 1RTG A; 1SU3 A; 1ITV A; 4YEH A; 1PEX A; 1HXN A; 1QHU A; 3OYO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...